GCF_008824145.1 - 27 region(s)

Download region SVG

Location: 381,381 - 422,436 nt. (total: 41,056 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

F7P10_RS01825: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS01840: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

F7P10_RS01845: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

F7P10_RS01860: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

F7P10_RS01880: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

F7P10_RS01945: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

F7P10_RS01965: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: sulfotransferase

F7P10_RS01905: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

Hydrolases: dehalogenase hydrolase

F7P10_RS01820: isochorismatase

smcogs: SMCOG1027: isochorismatase

F7P10_RS01850: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

F7P10_RS01915: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: synthase

F7P10_RS01900: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002332.2	0.47	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0000894.4	0.45	other (other)	citrinin	Monascus aurantiacus
BGC0000843.5	0.45	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000252.5	0.44	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0002496.3	0.43	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001077.4	0.43	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002034.3	0.43	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0001177.4	0.43	PKS	mensacaricin	Streptomyces bottropensis
BGC0001917.4	0.42	PKS	5aTHQ-9i, 5aTHQ-9n, 5aTHQ-10a, STAMs-9i, STAMs-9n	Streptomyces nigrescens
BGC0000232.5	0.42	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002332.2	0.47	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0000894.4	0.45	other (other)	citrinin	Monascus aurantiacus
BGC0000843.5	0.45	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000252.5	0.44	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0002496.3	0.43	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001077.4	0.43	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002034.3	0.43	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0001177.4	0.43	PKS	mensacaricin	Streptomyces bottropensis
BGC0001917.4	0.42	PKS	5aTHQ-9i, 5aTHQ-9n, 5aTHQ-10a, STAMs-9i, STAMs-9n	Streptomyces nigrescens
BGC0000232.5	0.42	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

Additional weak hits (22):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.53 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.71 out of 23.43

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.65 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.42 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.91 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.31 out of 30.25

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.80 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.78 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.12 out of 36.54

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.67 out of 24.78

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.34 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.92 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.10 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.33 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.59 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.60 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.10 out of 25.88

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP044407.1 - Region 2 - redox-cofactor

Download region SVG

Location: 427,549 - 450,324 nt. (total: 22,776 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

F7P10_RS02015: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS02020: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS02025: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

F7P10_RS02050: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

F7P10_RS02095: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.49	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000867.3	0.48	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0001948.3	0.44	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000231.5	0.44	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.44	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000671.3	0.44	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000218.5	0.44	PKS	doxorubicin	Streptomyces peucetius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.49	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000867.3	0.48	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0001948.3	0.44	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000231.5	0.44	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.44	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000671.3	0.44	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000218.5	0.44	PKS	doxorubicin	Streptomyces peucetius

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

Additional weak hits (11):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.38 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.84 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.02 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.37 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.16 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.00 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.27 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.72 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.64 out of 28.19

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Mycofactocin_RRE; Location: 6 - 86; Score: 100.1

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP044407.1 - Region 3 - T1PKS,lassopeptide

Download region SVG

Location: 543,924 - 675,139 nt. (total: 131,216 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

F7P10_RS02600: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F7P10_RS02690: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F7P10_RS02760: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

F7P10_RS02770: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F7P10_RS02800: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

F7P10_RS02810: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

F7P10_RS02920: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS02930: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

F7P10_RS43810: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase aminotransferase methyltransferase sulfotransferase

F7P10_RS02685: methyltransferase

smcogs: SMCOG1089: methyltransferase

F7P10_RS02805: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

F7P10_RS02925: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

F7P10_RS44985: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Hydrolases: esterase hydrolase phosphatase

F7P10_RS02710: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

F7P10_RS02795: thioesterase

smcogs: SMCOG1004: thioesterase

F7P10_RS02885: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: synthase

F7P10_RS02660: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F7P10_RS02680: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS02715: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

F7P10_RS02750: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS43040: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS43045: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F7P10_RS43050: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS43820: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001655.3	0.54	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001493.5	0.54	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001539.4	0.53	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001548.4	0.53	ribosomal	citrulassin A	Streptomyces albulus
BGC0001506.5	0.52	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001552.3	0.52	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002053.3	0.52	ribosomal	ulleungdin	Streptomyces sp.
BGC0001550.3	0.50	ribosomal	citrulassin D	Streptomyces katrae
BGC0001549.3	0.50	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001781.4	0.50	ribosomal	sphaericin	Planomonospora sphaerica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000018.5	0.70	PKS	angolamycin	Streptomyces eurythermus
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002175.3	0.65	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000107.3	0.65	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.46 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (30):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.09 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.35 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.04 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.20 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.64 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.31 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.11 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.89 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.55 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.03 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.50 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.60 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.49 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.91 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.70 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.03 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.84 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.40 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.62 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.49 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.90 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.17 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.17 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.23 out of 25.88

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 3, location 543923 - 675139:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - pk - redmal) + (Me-ohmal) + (Me-redmal - ccmal) + (Me-ohmal) + (pk - redmal) + (Me-ohmal - pk) + (mal)
Non-colinear ordering:: F7P10_RS02805 + F7P10_RS43040 + F7P10_RS02680 + F7P10_RS02660 + F7P10_RS43810 + F7P10_RS02750 + F7P10_RS43820 + F7P10_RS43050 + F7P10_RS43045

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 543923 - 666574:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - pk - redmal) + (Me-ohmal) + (Me-redmal - ccmal) + (Me-ohmal) + (pk - redmal) + (Me-ohmal - pk) + (mal)
Non-colinear ordering:: F7P10_RS02805 + F7P10_RS43040 + F7P10_RS02680 + F7P10_RS02660 + F7P10_RS43810 + F7P10_RS02750 + F7P10_RS43820 + F7P10_RS43050 + F7P10_RS43045

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

F7P10_RS02660: mmal

PKS_AT (589..853): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 165.0
Ethylmalonyl-CoA: 164.4
Methoxymalonyl-CoA: 135.7
trans-1,2-CPDA: 85.1
Malonyl-CoA: 84.0
2-Methylbutyryl-CoA: 80.9
Propionyl-CoA: 75.3
CHC-CoA: 68.0
Isobutyryl-CoA: 38.7
Benzoyl-CoA: 21.6
Acetyl-CoA: 19.9
inactive: 19.8
3-Methylbutyryl-CoA: 5.3
fatty_acid: 0.0

F7P10_RS43040: mmal

PKS_AT (510..721): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Methoxymalonyl-CoA: 70.8%; Malonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 133.6
Ethylmalonyl-CoA: 131.7
Methoxymalonyl-CoA: 110.0
2-Methylbutyryl-CoA: 72.1
Malonyl-CoA: 72.0
trans-1,2-CPDA: 69.0
CHC-CoA: 65.8
Propionyl-CoA: 64.0
Isobutyryl-CoA: 31.3
Benzoyl-CoA: 21.1
inactive: 19.7
Acetyl-CoA: 15.3
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

F7P10_RS02680: mmal - mal

PKS_AT (1162..1459): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.1
Ethylmalonyl-CoA: 204.5
Methoxymalonyl-CoA: 171.0
2-Methylbutyryl-CoA: 148.9
Malonyl-CoA: 117.5
trans-1,2-CPDA: 114.0
Propionyl-CoA: 110.0
CHC-CoA: 94.8
Isobutyryl-CoA: 87.1
Benzoyl-CoA: 72.8
Acetyl-CoA: 45.7
inactive: 43.5
3-Methylbutyryl-CoA: 36.9
fatty_acid: 24.9

PKS_AT (3230..3523): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.3
inactive: 75.5
Methoxymalonyl-CoA: 68.4
Methylmalonyl-CoA: 63.2
Ethylmalonyl-CoA: 26.2
fatty_acid: 25.8
Propionyl-CoA: 25.1
Isobutyryl-CoA: 19.4
2-Methylbutyryl-CoA: 16.8
Acetyl-CoA: 16.4
Benzoyl-CoA: 11.2
CHC-CoA: 0.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

F7P10_RS43045: mal

PKS_AT (297..590): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.2
inactive: 74.8
Methoxymalonyl-CoA: 65.0
Methylmalonyl-CoA: 56.4
Propionyl-CoA: 22.6
Ethylmalonyl-CoA: 15.1
Acetyl-CoA: 14.9
2-Methylbutyryl-CoA: 14.0
Isobutyryl-CoA: 13.8
fatty_acid: 13.6
CHC-CoA: 0.2
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

F7P10_RS43820: mmal - pk

PKS_AT (587..875): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 182.1
Ethylmalonyl-CoA: 179.6
Methoxymalonyl-CoA: 147.1
Malonyl-CoA: 102.5
trans-1,2-CPDA: 101.0
2-Methylbutyryl-CoA: 99.7
Propionyl-CoA: 88.2
CHC-CoA: 81.1
Isobutyryl-CoA: 60.3
Benzoyl-CoA: 35.7
Acetyl-CoA: 30.9
inactive: 23.4
3-Methylbutyryl-CoA: 15.3
fatty_acid: 14.1

PKS_AT (2085..2382): pk

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 87.5%; Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 171.4
Ethylmalonyl-CoA: 166.8
Methoxymalonyl-CoA: 147.6
trans-1,2-CPDA: 103.6
Malonyl-CoA: 102.2
Propionyl-CoA: 93.0
2-Methylbutyryl-CoA: 88.0
CHC-CoA: 78.1
Isobutyryl-CoA: 68.4
Benzoyl-CoA: 52.2
Acetyl-CoA: 46.3
fatty_acid: 39.4
inactive: 31.6
3-Methylbutyryl-CoA: 11.2

F7P10_RS02750: pk - mal

PKS_AT (565..861): pk

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Methylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 179.1
Ethylmalonyl-CoA: 166.0
Methoxymalonyl-CoA: 138.8
trans-1,2-CPDA: 102.3
Malonyl-CoA: 93.9
2-Methylbutyryl-CoA: 89.5
Propionyl-CoA: 86.9
Isobutyryl-CoA: 75.7
CHC-CoA: 72.4
Acetyl-CoA: 48.1
Benzoyl-CoA: 44.2
fatty_acid: 35.0
3-Methylbutyryl-CoA: 27.7
inactive: 24.3

PKS_AT (2318..2607): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.9
inactive: 90.3
Methoxymalonyl-CoA: 60.7
Methylmalonyl-CoA: 45.3
Propionyl-CoA: 20.8
Ethylmalonyl-CoA: 18.1
Acetyl-CoA: 18.1
Isobutyryl-CoA: 16.6
Benzoyl-CoA: 13.3
2-Methylbutyryl-CoA: 10.1
CHC-CoA: 9.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

F7P10_RS02805: mal - pk - mal

PKS_AT (530..829): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.1
inactive: 109.7
Methoxymalonyl-CoA: 69.8
Methylmalonyl-CoA: 57.1
Propionyl-CoA: 29.0
Isobutyryl-CoA: 25.4
Acetyl-CoA: 23.7
Ethylmalonyl-CoA: 20.8
Benzoyl-CoA: 14.3
2-Methylbutyryl-CoA: 12.3
trans-1,2-CPDA: 9.2
fatty_acid: 7.6
3-Methylbutyryl-CoA: 0.0
CHC-CoA: -0.3

PKS_AT (1557..1852): pk

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Methylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 182.0
Ethylmalonyl-CoA: 171.0
Methoxymalonyl-CoA: 146.8
trans-1,2-CPDA: 106.7
Malonyl-CoA: 101.3
Propionyl-CoA: 93.0
2-Methylbutyryl-CoA: 91.3
CHC-CoA: 82.7
Isobutyryl-CoA: 69.5
Acetyl-CoA: 46.8
Benzoyl-CoA: 38.3
fatty_acid: 37.1
inactive: 27.1
3-Methylbutyryl-CoA: 22.7

PKS_AT (3267..3555): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.9
inactive: 96.2
Methoxymalonyl-CoA: 77.3
Methylmalonyl-CoA: 61.4
Ethylmalonyl-CoA: 30.3
Propionyl-CoA: 30.2
Isobutyryl-CoA: 26.2
Acetyl-CoA: 17.3
fatty_acid: 16.3
Benzoyl-CoA: 12.7
2-Methylbutyryl-CoA: 12.6
trans-1,2-CPDA: 7.7
CHC-CoA: 7.3
3-Methylbutyryl-CoA: 5.6

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 80; Score: 71.7

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

NZ_CP044407.1 - Region 4 - T3PKS

Download region SVG

Location: 797,040 - 838,101 nt. (total: 41,062 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

F7P10_RS03555: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS03575: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

F7P10_RS03580: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

F7P10_RS03595: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS03610: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

F7P10_RS03625: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

F7P10_RS03635: Methylation

MITE: MITE0000155Methylation (identity: 61.30%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Ligases: ligase synthase

F7P10_RS03615: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS03630: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.71	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001831.3	0.58	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.55	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000671.3	0.47	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.71	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001831.3	0.58	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.55	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000671.3	0.47	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

Additional weak hits (16):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.06 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.05 out of 19.26

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.48 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.69 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.75 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.59 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.80 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.32 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.61 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.62 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.74 out of 25.31

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

F7P10_RS03615: X

AMP-binding (10..421): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAWNHTFGYAGAMGGTGAAFTAYGLSEAAGVVSV
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP044407.1 - Region 5 - NRPS

Download region SVG

Location: 1,034,868 - 1,098,243 nt. (total: 63,376 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F7P10_RS04575: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acyltransferase glycosyltransferase kinase

F7P10_RS04440: acyltransferase

smcogs: SMCOG1141: acyltransferase

F7P10_RS04475: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

F7P10_RS04610: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: deaminase esterase

F7P10_RS04490: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

F7P10_RS04505: thioesterase

smcogs: SMCOG1004: thioesterase

F7P10_RS04560: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: hydratase

F7P10_RS04600: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

F7P10_RS04520: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F7P10_RS04525: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS04545: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F7P10_RS04550: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS04555: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

F7P10_RS04615: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS45295: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS45300: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.74	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.74	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.34 out of 23.79

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.56 out of 23.43

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.96 out of 23.79

Confidence: medium

Additional weak hits (11):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.20 out of 39.62

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.13 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.14 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.26 out of 21.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.44 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.81 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.96 out of 29.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.25 out of 27.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.53 out of 32.74

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.03 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 1034867 - 1098243:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala) + (X - D-Thr) + (X - D-Thr) + (Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

F7P10_RS04520: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (463..864): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDGSFDASLYETFLLTGGEGNVYGPTEATTYTTV
Nearest Stachelhaus code(s):: Val or aIle DAYFLGVTFK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

F7P10_RS04525: X - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (457..843): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YAHAFDTSWMGWNTLLGGERNFYGPTESTIDTMN
Nearest Stachelhaus code(s):: Lys DTDDMGFIDK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1496..1930): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

F7P10_RS45295: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (1..399): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

F7P10_RS45300: Ala - X

Search NORINE for peptide: strict or relaxed

AMP-binding (202..695): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEVSGVLAGESNVYGPTEATVYAAA
Nearest Stachelhaus code(s):: Ala DVFSVAVVYK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1355..1799): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FESTFDVSVFEVSGALGGESNIYGPTEATIFVTG
Nearest Stachelhaus code(s):: Thr DVFSAGFIYK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

F7P10_RS04550: X

AMP-binding (58..473): X

nrpys: Dpr, Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISIWQCELIATGELNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (88% 8Å match); Dab DIWELTADDK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

F7P10_RS04615: X

AMP-binding (8..411): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAEGYHSAQWLQHLWHGAAHEYYGSTESSVNSVI
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism

NZ_CP044407.1 - Region 6 - terpene

Download region SVG

Location: 1,389,400 - 1,415,466 nt. (total: 26,067 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F7P10_RS06035: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

F7P10_RS06040: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.59	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000664.5	0.48	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.47	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.46	terpene	carotenoid	Myxococcus xanthus
BGC0002309.2	0.46	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001227.3	0.46	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.59	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000664.5	0.48	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.47	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.46	terpene	carotenoid	Myxococcus xanthus
BGC0002309.2	0.46	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001227.3	0.46	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

F7P10_RS06025: PT_phytoene_like

Domain 1 (21 - 226): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

F7P10_RS06030: PT_phytoene_like

Domain 1 (1 - 128): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

F7P10_RS06040: PT_FPPS_like

Domain 1 (44 - 323): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

F7P10_RS06045: T2TS

Domain 1 (20 - 639): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 24.15 out of 27.55

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (7):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.30 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.24 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.08 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.63 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.93 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.76 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.80 out of 30.22

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_CP044407.1 - Region 7 - T1PKS

Download region SVG

Location: 1,551,759 - 1,603,789 nt. (total: 52,031 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

F7P10_RS06815: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Isomerases: mutase

F7P10_RS06785: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

F7P10_RS06820: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS45015: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000863.3	0.51	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000044.3	0.51	PKS	dawenol	Stigmatella aurantiaca DW4/3-1
BGC0002648.2	0.50	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.50	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000056.3	0.49	PKS	esperamicin	Actinomadura verrucosospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000863.3	0.51	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000044.3	0.51	PKS	dawenol	Stigmatella aurantiaca DW4/3-1
BGC0002648.2	0.50	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.50	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000056.3	0.49	PKS	esperamicin	Actinomadura verrucosospora

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.72 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

Additional weak hits (18):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.53 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.14 out of 18.57

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.28 out of 19.26

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.85 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.16 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.11 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.05 out of 21.55

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.24 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.54 out of 21.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.25 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.63 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.36 out of 24.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.50 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 1551758 - 1603789:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal)
Non-colinear ordering:: F7P10_RS06820 + F7P10_RS42055

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

F7P10_RS06820: mal

PKS_AT (604..818): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 11.7
Methylmalonyl-CoA: 11.1
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

F7P10_RS45015: mal

PKS_AT (1177..1424): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 47.1
Methylmalonyl-CoA: 16.5
Methoxymalonyl-CoA: 13.9
Ethylmalonyl-CoA: 7.4
Propionyl-CoA: 3.9
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
CHC-CoA: -3.6

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP044407.1 - Region 8 - lanthipeptide-class-iii

Download region SVG

Location: 2,185,006 - 2,207,627 nt. (total: 22,622 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

F7P10_RS09655: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase

F7P10_RS09610: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

F7P10_RS09595: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

F7P10_RS09590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS09660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000519.4	0.72	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000519.4	0.72	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for F7P10_RS09635

F7P10_RS09640

Leader:

MTILDTAKEVNTDMASILELQNLDVERADSAAAA

Core:

DSNGSVWECCSTGSWVPFTCGC

Core with dehydrations:

DDhaNGDhaVWECysCysDhaDhbGDhaWVPFDhbCysGCys

antiSMASH-DB 4.0 matches for F7P10_RS09640

100.0%

NZ_BDDE01000019.1and 1 other:

NZ_CP044407.1 Lanthipeptides: F7P10_RS09640_lanthipeptide

Lanthipeptides: K4S16_RS30760_lanthipeptide

1

DSNGSVWECCSTGSWVPFTCGC

22

DSNGSVWECCSTGSWVPFTCGC

1

DSNGSVWECCSTGSWVPFTCGC

22

81.8%

Lanthipeptides: HNR61_RS17190_lanthipeptide

2

SNGSVWECCSTGSWVPFTC

20

SN SVWECCSTGSWVPFTC

1

SNASVWECCSTGSWVPFTC

19

45.5%

Lanthipeptides: HNR61_RS17195_lanthipeptide

2

SNGSVWECCSTGS

14

S+ S+WECCSTGS

1

SDWSLWECCSTGS

13

with 7 more sequence matches

40.9%

NZ_BDDE01000019.1:

Lanthipeptides: K4S16_RS30765_lanthipeptide

2

SNGSVWECCSTGS

14

S+ S+WECCS GS

1

SDWSLWECCSHGS

13

40.9%

NZ_CP044407.1:

Lanthipeptides: allorf_2197860_2197985_lanthipeptide

2

SNGSVWECCSTGS

14

S+ S WECCS GS

1

SDFSWWECCSQGS

13

36.4%

NZ_GG657757.1and 1 other:

NZ_GG657757.1 Lanthipeptides: allorf_4712326_4712541_lanthipeptide

Lanthipeptides: allorf_4712326_4712541_lanthipeptide

3

NGSVWECCSTGSWVPF

18

GS C T S VPF

1

RGSHPPLCRTESLVPF

16

29.2%

NZ_JAKVIH010000006.1:

Lanthipeptides: allorf_24523_24666_lanthipeptide

2

SNGSVWECCSTGSWVPFTCG

21

S G + C T W+P G

1

SFGMFFVICITIVWLPLRRG

20

20.8%

NZ_VATK01000028.1:

Lanthipeptides: FDO66_RS19480_lanthipeptide

14

SWVPFTCGC

22

+W+PF C C

14

AWLPFGCSC

22

19.0%

NZ_FUWS01000010.1:

Lanthipeptides: B5D66_RS17810_lanthipeptide

6

VWECCSTGSWVPFTCGC

22

++ C ST S+ PFT C

21

IYACASTCSFGPFTIAC

37

18.2%

NZ_JADG01000011.1:

Lanthipeptides: P696_RS0120030_lanthipeptide

6

VWECCSTGSWVPFTCGC

22

++ C ST S+ PFT C

21

IYACSSTCSFGPFTIVC

37

allorf_2197860_2197985

Leader:

MKPKMAKILELQSLHVEHASGAR

Core:

SDFSWWECCSQGSLFNCC

Core with dehydrations:

DhaDFDhaWWECysCysDhaQGDhaLFNCysCys

antiSMASH-DB 4.0 matches for allorf_2197860_2197985

100.0%

NZ_CP044407.1:

Lanthipeptides: allorf_2197860_2197985_lanthipeptide

1

SDFSWWECCSQGSLFNCC

18

SDFSWWECCSQGSLFNCC

1

SDFSWWECCSQGSLFNCC

18

83.3%

NZ_BDDE01000019.1:

Lanthipeptides: K4S16_RS30765_lanthipeptide

1

SDFSWWECCSQGSLFNCC

18

SD+S WECCS GSLFNCC

1

SDWSLWECCSHGSLFNCC

18

77.8%

Lanthipeptides: HNR61_RS17195_lanthipeptide

1

SDFSWWECCSQGSLFNCC

18

SD+S WECCS GSLF CC

1

SDWSLWECCSTGSLFACC

18

with 3 more sequence matches

60.0%

Lanthipeptides: HNR61_RS17190_lanthipeptide

1

SDFSWWECCSQGS--LFNCC

18

S+ S WECCS GS F CC

1

SNASVWECCSTGSWVPFTCC

20

42.1%

NZ_CP084585.1:

Lanthipeptides: LFM56_RS02715_lanthipeptide

4

SWWECCSQGSLFNC

17

SW C S GS+F C

6

SWVFCFSTGSIFGC

19

40.9%

NZ_BDDE01000019.1and 1 other:

NZ_CP044407.1 Lanthipeptides: F7P10_RS09640_lanthipeptide

Lanthipeptides: K4S16_RS30760_lanthipeptide

1

SDFSWWECCSQGS

13

S+ S WECCS GS

2

SNGSVWECCSTGS

14

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.32 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.46 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.75 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.19 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.48 out of 25.88

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.22 out of 20.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.59 out of 26.85

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

F7P10_RS09640 - Class III

Cleavage pHMM score: 16.30

RODEO score: 0

Monoisotopic mass: 2231.9 Da

Molecular weight: 2233.4 Da

Number of bridges: 4

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 2251.4 Da N = 1; 2269.5 Da N = 2

allorf_2197860_2197985 - Class III

Cleavage pHMM score: 17.10

RODEO score: 0

Monoisotopic mass: 2044.7 Da

Molecular weight: 2046.2 Da

Number of bridges: 4

Additional modifications: OH

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_CP044407.1 - Region 9 - NRPS,T3PKS

Download region SVG

Location: 2,258,474 - 2,368,530 nt. (total: 110,057 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase methyltransferase sulfotransferase transferase

F7P10_RS10005: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

F7P10_RS10125: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

F7P10_RS10130: aminotransferase

smcogs: SMCOG1019: aminotransferase

F7P10_RS10160: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

Hydrolases: hydrolase

F7P10_RS09965: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: hydratase

F7P10_RS10105: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

F7P10_RS10110: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

F7P10_RS09950: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

F7P10_RS10025: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS10030: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F7P10_RS10040: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS10045: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F7P10_RS10050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS10055: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F7P10_RS10060: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS10120: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

F7P10_RS43230: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS44155: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F7P10_RS44160: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS44165: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.77	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.76	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.72	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.70	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.77	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.74	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.74	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (20):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.25 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.69 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.30 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.61 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.39 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.91 out of 36.54

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.69 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.77 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.44 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.03 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.46 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.40 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.04 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 2258473 - 2368530:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - D-X - D-X) + (D-X) + (D-X) + (X) + (Thr - D-X) + (Val) + (Val) + (X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 2258473 - 2361831:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - D-X - D-X) + (D-X) + (D-X) + (X) + (Thr - D-X) + (Val) + (Val) + (X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 2327342 - 2368530:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - D-X - D-X) + (D-X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

F7P10_RS44155: X - X

AMP-binding (474..844): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDTAFDASTYETHASTGGDRTTYGPTEATAFATH
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1510..1880): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDSAFDASTFETHASTGGDRTTYGPTEATAFATH
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (65% 8Å match); Hpg DAFHLGLLCK (62% 8Å match)
Stachelhaus code match:: 60% (weak)

F7P10_RS44160: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (405..783): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: FDSAFDASTYETVALTGGDRSTYGPTETTGFATH
Nearest Stachelhaus code(s):: Dhpg DAYNLGTLCK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

F7P10_RS10025: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (2..338): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: FDTAFDASTYETHASTGGDRSTYGPTETTGFATH
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

F7P10_RS10040: X

AMP-binding (1..323): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDSAFDASTFETHASTGGDRTTYGPTEATAFATQ
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (65% 8Å match); Hpg DAFHLGLLCK (62% 8Å match)
Stachelhaus code match:: 60% (weak)

F7P10_RS10050: X - Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (0..252): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDTAFDASTYETHASTGGDRTTYGPTETTAFATQ
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (913..1320): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LETHFDFSVWEGNQVFGGEVNMYGITETTVHVTS
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1978..2349): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDEAFDASTYETHASTGGDRTTYGPTETTAFTTR
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

F7P10_RS10060: X

AMP-binding (486..868): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDEAFDASTYETHASTGGDRTTYGPTETTAFTTQ
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

F7P10_RS44165: X

AMP-binding (471..892): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWRAFDTSVSEPTFVTAGEHNEYGPTEVTVDVTC
Nearest Stachelhaus code(s):: His DTWTIASVDK (62% 8Å match); Tyr DASTVAAVCK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

F7P10_RS43230: Ser - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (456..863): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWLTFDVSVPEGHFLASGELNLYGPTEAAVEVTA
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (82% 8Å match); Dpr DVRHLSMVEK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2177..2551): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDTAFDASTYETHASTGGDRTTYGPTEATAFATH
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (3663..4037): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDTAFDASTFETHASTGGDRTTYGPTEATAFATH
Nearest Stachelhaus code(s):: Dhpg DAYHGGTLCK (65% 8Å match); Hpg DAFHLGLLCK (62% 8Å match)
Stachelhaus code match:: 60% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP044407.1 - Region 10 - lanthipeptide-class-iv

Download region SVG

Location: 3,390,063 - 3,412,633 nt. (total: 22,571 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

F7P10_RS14815: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: methyltransferase

F7P10_RS14810: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.59	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.48	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000496.5	0.48	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.47	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002111.3	0.45	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0001579.4	0.45	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001210.5	0.42	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.59	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.48	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000496.5	0.48	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.47	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002111.3	0.45	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0001579.4	0.45	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001210.5	0.42	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (9):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.10 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.36 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.46 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.67 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.30 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.22 out of 25.88

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.61 out of 20.01

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
RpoN	Regulator of nitrogen assimilation and virulence

NZ_CP044407.1 - Region 11 - NRPS,RiPP-like,T1PKS,terpene

Download region SVG

Location: 3,675,172 - 3,776,928 nt. (total: 101,757 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase reductase

F7P10_RS16020: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS16070: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

F7P10_RS16140: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

F7P10_RS16170: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

F7P10_RS16205: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

F7P10_RS16235: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

F7P10_RS16305: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS16340: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

F7P10_RS16375: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: acylase methyltransferase

F7P10_RS16135: methyltransferase

smcogs: SMCOG1089: methyltransferase

F7P10_RS16280: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

F7P10_RS16315: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

F7P10_RS16145: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

F7P10_RS16110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS16115: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS16160: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F7P10_RS16310: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS16330: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS16335: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.90	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.89	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.89	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.89	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.85	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000107.3	0.85	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0000037.4	0.78	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001876.2	0.62	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

F7P10_RS16210: PT_phytoene_like

Domain 1 (7 - 300): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.05 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.57 out of 20.97

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.27 out of 23.43

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.02 out of 26.85

Confidence: medium

Additional weak hits (76):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.40 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.53 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.80 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.73 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.09 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.47 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.74 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.27 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.55 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.83 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.00 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.94 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.19 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.91 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.35 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.94 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.06 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.31 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.66 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.01 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.89 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.58 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.96 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.11 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.39 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.21 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.54 out of 20.97

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.36 out of 32.93

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.98 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.23 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.96 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.77 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.79 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.16 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.42 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.45 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.54 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.75 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.26 out of 33.14

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.42 out of 32.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.50 out of 23.43

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.47 out of 27.18

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.46 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.67 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.87 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.05 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.88 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.31 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.72 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.19 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.25 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.44 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.28 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.15 out of 23.43

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.16 out of 20.01

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.43 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 3675171 - 3776928:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (ohmal) + (Me-ohmal) + (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 16, location 3675171 - 3725748:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 18, location 3720373 - 3776928:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal) + (Me-ccmal)
Non-colinear ordering:: F7P10_RS16280 + F7P10_RS16315

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

F7P10_RS16110: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (542..949): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDLSFDLSVHDGNTFLSADVSLGGATEASIWSIC
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (85% 8Å match)
Stachelhaus code match:: 80% (moderate)

F7P10_RS16115: mal

PKS_AT (521..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 91.6
Methoxymalonyl-CoA: 56.5
Methylmalonyl-CoA: 54.2
Ethylmalonyl-CoA: 31.2
Propionyl-CoA: 29.9
inactive: 28.4
2-Methylbutyryl-CoA: 15.7
CHC-CoA: 12.2
Isobutyryl-CoA: 10.9
Acetyl-CoA: 10.9
trans-1,2-CPDA: 10.2
Benzoyl-CoA: 8.8
fatty_acid: 5.8
3-Methylbutyryl-CoA: 0.0

F7P10_RS16280: mmal

PKS_AT (567..866): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 142.2
Ethylmalonyl-CoA: 120.5
Methoxymalonyl-CoA: 115.1
Malonyl-CoA: 93.1
2-Methylbutyryl-CoA: 84.7
trans-1,2-CPDA: 82.1
Propionyl-CoA: 78.8
Isobutyryl-CoA: 73.2
Acetyl-CoA: 41.0
3-Methylbutyryl-CoA: 39.9
inactive: 37.6
Benzoyl-CoA: 35.1
CHC-CoA: 33.8
fatty_acid: 27.8

F7P10_RS16310: NH2

CAL_domain (72..511): NH2

minowa: NH2

Prediction, score:

NH2: 132.5
fatty_acid: 19.4
Acetyl-CoA: 17.9
AHBA: 9.2
shikimic_acid: -0.6

F7P10_RS16315: mmal

PKS_AT (642..935): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 79.2%; Malonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 149.9
Ethylmalonyl-CoA: 124.7
Methoxymalonyl-CoA: 115.9
2-Methylbutyryl-CoA: 99.0
Malonyl-CoA: 94.7
Propionyl-CoA: 88.2
trans-1,2-CPDA: 66.9
Isobutyryl-CoA: 56.9
Acetyl-CoA: 53.7
fatty_acid: 49.6
3-Methylbutyryl-CoA: 43.0
CHC-CoA: 33.4
Benzoyl-CoA: 32.0
inactive: 28.9

F7P10_RS16335: X

AMP-binding (19..367): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NRTLHQWGLSLLDACTGGALDGYGSTEAGNITFA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP044407.1 - Region 12 - lanthipeptide-class-i

BGC0001155.5 (AGY49587.1):

Download region SVG

Location: 4,288,509 - 4,314,971 nt. (total: 26,463 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F7P10_RS18975: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase dehydratase

F7P10_RS18935: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

F7P10_RS18940: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002316.2	0.54	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0002343.3	0.37	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0001221.5	0.36	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001626.3	0.32	PKS	isoindolinone	Stachybotrys chlorohalonata IBT 40285
BGC0000252.5	0.31	PKS	nonactin	Streptomyces griseus subsp. griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002316.2	0.54	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0002343.3	0.37	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0001221.5	0.36	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001626.3	0.32	PKS	isoindolinone	Stachybotrys chlorohalonata IBT 40285
BGC0000252.5	0.31	PKS	nonactin	Streptomyces griseus subsp. griseus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for F7P10_RS18935

F7P10_RS18930

Leader:

MLRNSTVEPEAVAGPTDAAPDAFELDVRLLEIADPA

Core:

GLVNVTDDGCTSTCGACISNAY

Core with dehydrations:

GLVNVDhbDDGCysDhbDhaDhbCysGACysIDhaNAY

antiSMASH-DB 4.0 matches for F7P10_RS18930

100.0%

NZ_CP044407.1:

Lanthipeptides: F7P10_RS18930_lanthipeptide

1

GLVNVTDDGCTSTCGACISNAY

22

GLVNVTDDGCTSTCGACISNAY

1

GLVNVTDDGCTSTCGACISNAY

22

72.7%

NZ_BCMN01000021.1:

Lanthipeptides: AV140_RS32375_lanthipeptide

1

GLVNVTDDGCTSTCGACISN

20

GLVN+TDDGC STCGAC +N

1

GLVNLTDDGCGSTCGACTTN

20

68.2%

NZ_AQRK01000088.1and 27 others:

NZ_BMVQ01000014.1 Lanthipeptides: IE283_RS30975_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS19645_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS08000_lanthipeptideNZ_CP022438.1 Lanthipeptides: CGZ69_RS15030_lanthipeptideNZ_CP022438.1 Lanthipeptides: CGZ69_RS15030_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS04650_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS17265_lanthipeptideNZ_CP023702.1 Lanthipeptides: CP967_RS19640_lanthipeptideNZ_CP033073.1 Lanthipeptides: D9753_RS20300_lanthipeptideNZ_CP063808.1 Lanthipeptides: IOD14_RS42650_lanthipeptideNZ_CP071872.1 Lanthipeptides: J4032_RS33705_lanthipeptideNZ_CP071872.1 Lanthipeptides: J4032_RS33705_lanthipeptideNZ_CP075691.1 Lanthipeptides: KKZ08_RS16460_lanthipeptideNZ_CP082362.1 Lanthipeptides: K4G22_RS18080_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS33095_lanthipeptideNZ_CP101138.1 Lanthipeptides: M6G08_RS35600_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS13565_lanthipeptideNZ_CP117866.1 Lanthipeptides: PBV52_RS22590_lanthipeptideNZ_JAFIQY010000056.1 Lanthipeptides: JXZ78_RS36930_lanthipeptideNZ_JAJDST010000050.1 Lanthipeptides: LJC81_RS33260_lanthipeptideNZ_JAJDST010000050.1 Lanthipeptides: LJC81_RS33260_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0119395_lanthipeptideNZ_KB890926.1 Lanthipeptides: B053_RS0114140_lanthipeptideNZ_KB891987.1 Lanthipeptides: B079_RS0100320_lanthipeptideNZ_KB912961.1 Lanthipeptides: B065_RS0117615_lanthipeptideNZ_KQ947985.1 Lanthipeptides: AQI70_RS05650_lanthipeptideNZ_LIPF01000016.1 Lanthipeptides: AMK11_RS35705_lanthipeptide

Lanthipeptides: YUW_RS13695_lanthipeptide

1

GLVNVTDDGCTSTCGACISN

20

GLVN+TDD C STCGAC +N

1

GLVNLTDDNCGSTCGACTTN

20

with 150 more sequence matches

Only the first 10 are displayed here.

63.6%

NZ_CP048882.1:

Lanthipeptides: G4Z16_RS00540_lanthipeptide

1

GLVNVTDDGCTSTCGACISN

20

GLV++T+DGC STCGAC +N

1

GLVSITNDGCGSTCGACTTN

20

63.6%

NZ_CP070379.1and 1 other:

NZ_LFBV01000012.1 Lanthipeptides: AB852_RS38205_lanthipeptide

Lanthipeptides: JVE63_RS15825_lanthipeptide

1

GLVNVTDDGCTSTCGACISN

20

GLVN+TDD C +TCGAC +N

1

GLVNLTDDNCGTTCGACTTN

20

59.1%

NZ_CP028834.1and 1 other:

NZ_CP074380.1 Lanthipeptides: KGS77_RS25025_lanthipeptide

Lanthipeptides: DBP13_RS26755_lanthipeptide

1

GLVNVTDDGCTSTCGACISN

20

GL+++TDDGC TCGAC +N

1

GLISLTDDGCGETCGACTTN

20

56.5%

NZ_BBOJ01000005.1and 2 others:

NZ_CM001439.1 Lanthipeptides: SACMADRAFT_RS29465_lanthipeptideNZ_CM001439.1 Lanthipeptides: SACMADRAFT_RS29465_lanthipeptide

Lanthipeptides: AOM45_RS49405_lanthipeptide

2

LVNVTDDGCTSTC--GACISNA

21

L+N+TDDGC TC CIS A

2

LINMTDDGCGHTCEKSTCISAA

23

56.5%

NZ_CM001439.1and 3 others:

NZ_CP015163.1 Lanthipeptides: A4R43_RS24965_lanthipeptideNZ_FOKG01000036.1 Lanthipeptides: BM199_RS31630_lanthipeptideNZ_JALMDK010000002.1 Lanthipeptides: MZC64_RS10125_lanthipeptide

Lanthipeptides: SACMADRAFT_RS28825_lanthipeptide

2

LVNVTDDGCTSTC--GACISNA

21

L+N+TDDGC +TC CIS A

2

LINMTDDGCGTTCEKSTCISAA

23

56.5%

NZ_CP045572.1and 1 other:

NZ_CP045572.1 Lanthipeptides: GBF35_RS37485_lanthipeptide

Lanthipeptides: GBF35_RS37485_lanthipeptide

2

LVNVTDDGCTSTCG-ACIS

19

L+ +TDDGC STCG AC+S

2

LIRMTDDGCNSTCGTACVS

20

56.5%

NZ_FOUP01000006.1:

Lanthipeptides: BM016_RS18395_lanthipeptide

2

LVNVTDDGCTSTC--GACISNA

21

L+N+TDDGC TC CIS+A

2

LINMTDDGCGHTCEKSTCISSA

23

56.5%

NZ_SWMS01000027.1:

Lanthipeptides: FCN18_RS31945_lanthipeptide

2

LVNVTDDGCTSTC--GACISNA

21

L+N+TDDGC TC CIS A

2

LINMTDDGCGQTCEKSTCISAA

23

54.5%

NZ_BBVA01000002.1and 7 others:

NZ_CP030865.1 Lanthipeptides: MicB006_RS27820_lanthipeptideNZ_FMCS01000017.1 Lanthipeptides: GA0070214_RS30700_lanthipeptideNZ_JAGPXW010000015.1 Lanthipeptides: KBX71_RS18490_lanthipeptideNZ_JALJRJ010000030.1 Lanthipeptides: OC439_RS27920_lanthipeptideNZ_LT594324.1 Lanthipeptides: GA0070621_RS04875_lanthipeptideNZ_LT607410.1 Lanthipeptides: GA0074696_RS20405_lanthipeptideNZ_LT607753.1 Lanthipeptides: GA0070614_RS02740_lanthipeptide

Lanthipeptides: A4R25_RS30565_lanthipeptide

4

NVTDDGCTSTCGACISN

20

N+TDDGC STC AC +N

1

NLTDDGCGSTCTACTTN

17

54.5%

NZ_BMSI01000021.1and 1 other:

NZ_JAPTYM010000001.1 Lanthipeptides: O1M07_RS07535_lanthipeptide

Lanthipeptides: IE189_RS36010_lanthipeptide

5

VTDDGCTSTCGACISN

20

+TDDGC STCGAC +N

1

LTDDGCGSTCGACTTN

16

MIBiG 4.0 matches for F7P10_RS18930

22.7%

Thiopeptide: GE2270

10

CTSTCGACIS

19

C CG C S

2

CNCVCGFCCS

11

15.4%

BGC0002110.3 (QKV49894.1):

Lanthipeptide: birimositide

10

CTSTC

14

CTS C

22

CTSKC

26

10.8%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

10

CTSTC

14

CTS C

33

CTSRC

37

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.79 out of 26.85

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (3):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

F7P10_RS18930 - Class I

Cleavage pHMM score: -8.30

RODEO score: 21

Monoisotopic mass: 2072.9 Da

Molecular weight: 2074.3 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2092.3 Da N = 1; 2110.3 Da N = 2

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 161 - 253; Score: 71.5

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP044407.1 - Region 13 - T1PKS,oligosaccharide

Download region SVG

Location: 4,342,978 - 4,416,826 nt. (total: 73,849 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

F7P10_RS19325: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase glycosyltransferase methyltransferase sulfhydrylase transferase

F7P10_RS19215: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

F7P10_RS19235: methyltransferase

smcogs: SMCOG1089: methyltransferase

F7P10_RS19270: methyltransferase

smcogs: SMCOG1089: methyltransferase

F7P10_RS19290: methyltransferase

smcogs: SMCOG1248: methyltransferase

F7P10_RS19295: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

F7P10_RS19300: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

F7P10_RS19320: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

F7P10_RS19330: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

F7P10_RS19335: methyltransferase

smcogs: SMCOG1089: methyltransferase

F7P10_RS19345: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

F7P10_RS19350: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Lyases: dehydratase

F7P10_RS19280: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

F7P10_RS19165: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS19245: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.41	PKS	esperamicin	Actinomadura verrucosospora
BGC0001817.5	0.37	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0001164.3	0.26	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001060.5	0.24	PKS	dynemicin A	Micromonospora chersina
BGC0001872.3	0.23	PKS	fabclavine-polyamine	Xenorhabdus bovienii SS-2004
BGC0002545.3	0.23	PKS	sungeidine C, sungeidine B, sungeidine D, sungeidine H, sungeidine A, sungeidine E, sungeidine F, sungeidine G	Micromonospora sp.
BGC0000825.5	0.22	other (other)	staurosporine	Streptomyces sp. TP-A0274
BGC0000826.5	0.22	other (other)	staurosporine	Streptomyces clavuligerus ATCC 27064
BGC0001377.5	0.22	PKS	uncialamycin	Streptomyces uncialis
BGC0000283.4	0.21	other (cyclitol)	cetoniacytone A	Actinomyces sp. Lu 9419

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.72	PKS	esperamicin	Actinomadura verrucosospora
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001817.5	0.55	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000898.5	0.53	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000899.4	0.50	saccharide	desosamine	Streptomyces narbonensis
BGC0000863.3	0.49	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000193.3	0.49	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000214.5	0.49	PKS	cosmomycin B	Streptomyces olindensis
BGC0001661.5	0.49	PKS	mayamycin	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.88 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.97 out of 32.93

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (98):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.23 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.52 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.26 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.64 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 26.85

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.33 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.49 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.63 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 39.62

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.51 out of 26.06

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.74 out of 29.72

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.42 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.95 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.62 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.35 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.89 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.14 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.51 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.67 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.29 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.56 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.03 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.42 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.92 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.46 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.08 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.59 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.94 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.01 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.90 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.07 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.43 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.26 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.93 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.76 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.85 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.68 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.11 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.80 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.47 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.84 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.89 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.58 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.83 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.41 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.89 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.58 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.68 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.04 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.57 out of 23.43

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.20 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.85 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.37 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.54 out of 31.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.33 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.22 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.56 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.50 out of 27.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.05 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.65 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.79 out of 32.93

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.06 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.75 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.42 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.46 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.23 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.21 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.66 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.53 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.21 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.73 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.87 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.96 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.83 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.41 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.95 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.52 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.59 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.45 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.65 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.27 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.62 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 21, location 4342977 - 4416826:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 22, location 4342977 - 4388647:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

F7P10_RS19165: mal

PKS_AT (617..841): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 54.2%; Ethylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 71.3
Methylmalonyl-CoA: 67.7
Methoxymalonyl-CoA: 64.3
Ethylmalonyl-CoA: 40.8
CHC-CoA: 35.8
trans-1,2-CPDA: 30.8
Isobutyryl-CoA: 29.2
Propionyl-CoA: 27.1
inactive: 24.6
Benzoyl-CoA: 20.9
Acetyl-CoA: 19.9
2-Methylbutyryl-CoA: 19.8
fatty_acid: 16.3
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
LexA variant 3	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP044407.1 - Region 14 - T1PKS

Download region SVG

Location: 4,909,798 - 4,955,794 nt. (total: 45,997 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F7P10_RS21870: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acylase glycosyltransferase

F7P10_RS21855: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

F7P10_RS21865: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: ligase

F7P10_RS21845: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

F7P10_RS21850: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.77	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.77	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.81 out of 23.79

Confidence: medium

Additional weak hits (19):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.16 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 21.55

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.40 out of 29.51

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.48 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.83 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.67 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.03 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.96 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.68 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.46 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.28 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.17 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.88 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.42 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 24, location 4909797 - 4955794:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

F7P10_RS21845: NH2

CAL_domain (54..499): NH2

minowa: NH2

Prediction, score:

NH2: 92.4
Acetyl-CoA: 34.6
fatty_acid: 26.1
AHBA: 13.7
shikimic_acid: 0.0

F7P10_RS21865: pk

PKS_AT (450..751): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 111.5
Ethylmalonyl-CoA: 95.2
Methoxymalonyl-CoA: 87.9
Propionyl-CoA: 70.8
fatty_acid: 65.0
Isobutyryl-CoA: 62.5
trans-1,2-CPDA: 61.4
2-Methylbutyryl-CoA: 61.2
Acetyl-CoA: 50.3
3-Methylbutyryl-CoA: 32.4
CHC-CoA: 32.0
inactive: 24.4
Benzoyl-CoA: 23.1
Malonyl-CoA: -2.8

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP044407.1 - Region 15 - terpene

Download region SVG

Location: 5,452,064 - 5,480,007 nt. (total: 27,944 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

F7P10_RS24480: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

F7P10_RS24485: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Ligases: synthetase

F7P10_RS24445: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001911.3	0.55	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.55	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000286.3	0.45	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001948.3	0.44	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001197.5	0.43	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001605.3	0.43	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001483.4	0.41	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001911.3	0.55	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.55	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000286.3	0.45	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001948.3	0.44	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001197.5	0.43	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001605.3	0.43	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001483.4	0.41	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

F7P10_RS24445: PT_FPPS_like

Domain 1 (41 - 331): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

F7P10_RS24470: T2TS

Domain 1 (40 - 577): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

F7P10_RS24475: T1TS

Domain 1 (37 - 261): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.45 out of 27.78

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (6):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.99 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.07 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.91 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.39 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria

NZ_CP044407.1 - Region 16 - terpene

Download region SVG

Location: 5,881,092 - 5,902,177 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F7P10_RS26500: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Transferases: methyltransferase

F7P10_RS26530: methyltransferase

smcogs: SMCOG1089: methyltransferase

F7P10_RS26545: methyltransferase

smcogs: SMCOG1089: methyltransferase

F7P10_RS26560: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

F7P10_RS26540: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.74	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.63	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000563.4	0.37	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000880.4	0.35	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0002330.2	0.34	ribosomal	landornamide A	Kamptonema sp. PCC 6506
BGC0001972.4	0.34	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.74	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.63	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000563.4	0.37	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000880.4	0.35	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0002330.2	0.34	ribosomal	landornamide A	Kamptonema sp. PCC 6506
BGC0001972.4	0.34	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

F7P10_RS26540: T1TS

Domain 1 (12 - 358): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.64 out of 26.85

Confidence: medium

Additional weak hits (12):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.03 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.39 out of 26.85

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.07 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.38 out of 27.04

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.91 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.13 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.66 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.30 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.59 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.14 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.30 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP044407.1 - Region 17 - lanthipeptide-class-iv

Download region SVG

Location: 5,915,930 - 5,938,668 nt. (total: 22,739 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

F7P10_RS26650: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.64	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.64	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000551.5	0.61	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.59	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002337.2	0.57	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000513.3	0.57	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.56	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.56	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.44	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000553.3	0.44	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.64	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.64	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000551.5	0.61	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.59	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002337.2	0.57	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000513.3	0.57	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.56	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.56	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.44	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000553.3	0.44	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 22.86 out of 26.12

Confidence: medium

Additional weak hits (14):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.20 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.26 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.21 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.86 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.73 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.13 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.69 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
LuxO	Repressor of luminescence

NZ_CP044407.1 - Region 18 - terpene

Download region SVG

Location: 6,199,441 - 6,221,594 nt. (total: 22,154 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

F7P10_RS28060: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

F7P10_RS28105: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

F7P10_RS28125: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: hydrolase

F7P10_RS28075: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

F7P10_RS28090: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

F7P10_RS28055: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.43	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001840.2	0.43	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001483.4	0.42	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000738.3	0.42	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0002127.3	0.42	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002482.2	0.38	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0000725.5	0.38	saccharide	alginate	Pseudomonas aeruginosa PAO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.43	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001840.2	0.43	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001483.4	0.42	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000738.3	0.42	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0002127.3	0.42	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002482.2	0.38	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0000725.5	0.38	saccharide	alginate	Pseudomonas aeruginosa PAO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

F7P10_RS28090: T1TS + T1TS

Domain 1 (1 - 327): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (332 - 687): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.80 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.01 out of 21.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 25.19 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.00 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.71 out of 27.04

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.85 out of 27.18

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP044407.1 - Region 19 - NRPS,T1PKS

Download region SVG

Location: 6,636,656 - 6,754,396 nt. (total: 117,741 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

F7P10_RS30180: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

F7P10_RS30195: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

F7P10_RS30250: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

F7P10_RS30345: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F7P10_RS30360: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F7P10_RS30370: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F7P10_RS43530: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS44745: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS44785: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS45580: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase glycosyltransferase halogenase methyltransferase transferase

F7P10_RS30170: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

F7P10_RS30215: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

F7P10_RS30225: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

F7P10_RS30340: methyltransferase

smcogs: SMCOG1089: methyltransferase

F7P10_RS30355: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

F7P10_RS30365: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

F7P10_RS30375: methyltransferase

smcogs: SMCOG1248: methyltransferase

F7P10_RS30400: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: esterase hydrolase

F7P10_RS30245: thioesterase

smcogs: SMCOG1004: thioesterase

F7P10_RS30265: thioesterase

smcogs: SMCOG1004: thioesterase

F7P10_RS30380: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

F7P10_RS30230: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS30235: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F7P10_RS30240: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F7P10_RS30260: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F7P10_RS30275: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F7P10_RS30280: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS30330: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F7P10_RS44770: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	1.28	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	1.22	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	1.16	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	1.02	PKS	oronofacic acid	Pseudomonas syringae
BGC0002192.3	0.96	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.95	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.95	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.94	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001825.4	0.94	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.93	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.80	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.79	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.77	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.77	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.65	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.26 out of 23.79

Confidence: medium

Additional weak hits (30):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.59 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.13 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.06 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.75 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.68 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.25 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.21 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.53 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.48 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.39 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.19 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.20 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.29 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.29 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.71 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.94 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.94 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.31 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.66 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.90 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.13 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.56 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.96 out of 36.53

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.21 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.95 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.99 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.00 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.21 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.68 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 29, location 6636655 - 6754396:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal) + (Me-ccmal) + (ccmal) + (redmal) + (Cys) + (Me-Cys) + (Cys) + (ccmal) + (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 30, location 6636655 - 6692141:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal) + (ccmal) + (Cys) + (Me-Cys) + (Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 31, location 6657960 - 6713236:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal) + (Cys) + (Me-Cys) + (Cys) + (ccmal) + (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 32, location 6683745 - 6754396:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal) + (Me-ccmal) + (ccmal) + (redmal) + (Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

F7P10_RS30230: mmal

PKS_AT (564..861): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 147.5
Methoxymalonyl-CoA: 115.1
Ethylmalonyl-CoA: 104.9
Malonyl-CoA: 85.3
Propionyl-CoA: 67.3
trans-1,2-CPDA: 64.2
Benzoyl-CoA: 62.5
Isobutyryl-CoA: 59.4
2-Methylbutyryl-CoA: 54.6
CHC-CoA: 45.0
3-Methylbutyryl-CoA: 35.4
Acetyl-CoA: 23.4
inactive: 21.0
fatty_acid: 8.1

F7P10_RS30235: mal

PKS_AT (1783..2074): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.8
inactive: 113.5
Methoxymalonyl-CoA: 87.6
Methylmalonyl-CoA: 84.0
Isobutyryl-CoA: 68.6
Ethylmalonyl-CoA: 51.2
Propionyl-CoA: 49.7
Benzoyl-CoA: 42.7
fatty_acid: 41.2
2-Methylbutyryl-CoA: 33.0
Acetyl-CoA: 28.3
CHC-CoA: 24.7
trans-1,2-CPDA: 24.0
3-Methylbutyryl-CoA: 14.3

F7P10_RS30260: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (498..895): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVWDGNSLLSGDIAMGGATEASIWSNL
Nearest Stachelhaus code(s):: Cys DLWNLSLIWK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

F7P10_RS30275: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (538..941): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSLLSGDISLGGATEASIWSIC
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

F7P10_RS30280: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (540..931): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVYDGNSLLSGDVSLGGATEASIWSIC
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

F7P10_RS45550: mal

PKS_AT (0..159): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 68.4
inactive: 28.3
Methoxymalonyl-CoA: 18.0
Methylmalonyl-CoA: 12.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

F7P10_RS45555: mal

PKS_AT (56..175): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 64.0
inactive: 27.0
Methoxymalonyl-CoA: 23.7
Isobutyryl-CoA: 17.6
Methylmalonyl-CoA: 13.7
Propionyl-CoA: 10.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

F7P10_RS45565: mmal

PKS_AT (14..127): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 40.4
Ethylmalonyl-CoA: 39.4
Methoxymalonyl-CoA: 30.8
trans-1,2-CPDA: 19.5
Isobutyryl-CoA: 16.5
Propionyl-CoA: 12.2
2-Methylbutyryl-CoA: 10.5
Benzoyl-CoA: 9.6
inactive: 0.0
fatty_acid: 0.0
Malonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

F7P10_RS44770: mal

PKS_AT (527..825): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 153.6
inactive: 63.1
Methoxymalonyl-CoA: 55.7
Methylmalonyl-CoA: 45.5
Propionyl-CoA: 22.7
Isobutyryl-CoA: 21.1
CHC-CoA: 8.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -2.7

F7P10_RS30330: mal

PKS_AT (570..868): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 83.3%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 151.5
inactive: 62.0
Methoxymalonyl-CoA: 54.5
Methylmalonyl-CoA: 44.2
Propionyl-CoA: 21.7
Isobutyryl-CoA: 20.3
CHC-CoA: 7.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -2.7

F7P10_RS44785: mmal

PKS_AT (1183..1482): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Malonyl-CoA: 79.2%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 178.6
Ethylmalonyl-CoA: 159.0
Methoxymalonyl-CoA: 154.4
2-Methylbutyryl-CoA: 119.3
Propionyl-CoA: 115.5
Malonyl-CoA: 102.9
trans-1,2-CPDA: 100.2
CHC-CoA: 83.5
Isobutyryl-CoA: 69.8
Benzoyl-CoA: 58.8
Acetyl-CoA: 48.5
3-Methylbutyryl-CoA: 27.7
inactive: 25.2
fatty_acid: 22.3

F7P10_RS43635: mal - mmal

PKS_AT (528..823): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.2
inactive: 96.5
Methoxymalonyl-CoA: 61.6
Methylmalonyl-CoA: 52.4
Isobutyryl-CoA: 32.9
Ethylmalonyl-CoA: 27.8
Propionyl-CoA: 21.8
Benzoyl-CoA: 19.4
Acetyl-CoA: 16.9
trans-1,2-CPDA: 11.4
2-Methylbutyryl-CoA: 10.0
CHC-CoA: 9.3
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1541..1836): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 188.9
Ethylmalonyl-CoA: 178.5
Methoxymalonyl-CoA: 163.8
2-Methylbutyryl-CoA: 122.5
trans-1,2-CPDA: 117.0
Propionyl-CoA: 113.1
Malonyl-CoA: 93.2
CHC-CoA: 92.7
Isobutyryl-CoA: 81.0
Benzoyl-CoA: 68.1
Acetyl-CoA: 36.2
3-Methylbutyryl-CoA: 23.5
fatty_acid: 22.4
inactive: 12.1

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_CP044407.1 - Region 20 - polyyne

Download region SVG

Location: 6,915,874 - 6,944,443 nt. (total: 28,570 nt) Show pHMM detection rules used

polyyne: ((PP-binding_2 or PP-binding) and delta9_cd03505 and delta12_cd03507 and FAAL_cd05931 and (4HBT_2 or Thioesterase or PF00561))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

F7P10_RS31170: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F7P10_RS31225: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acetyltransferase glycosyltransferase

F7P10_RS31240: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

F7P10_RS31255: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

F7P10_RS31270: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: deacetylase dehalogenase hydrolase

F7P10_RS31215: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

F7P10_RS31230: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

F7P10_RS31275: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Ligases: ligase

F7P10_RS31190: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002804.2	0.65	other (other)	protegencin	Pseudomonas protegens CHA0
BGC0000892.4	0.64	other (other)	caryoynencin	Burkholderia gladioli BSR3
BGC0001897.4	0.63	PKS	cepacin A	Burkholderia ambifaria IOP40-10
BGC0002274.2	0.62	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001831.3	0.48	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001895.4	0.47	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002804.2	0.65	other (other)	protegencin	Pseudomonas protegens CHA0
BGC0000892.4	0.64	other (other)	caryoynencin	Burkholderia gladioli BSR3
BGC0001897.4	0.63	PKS	cepacin A	Burkholderia ambifaria IOP40-10
BGC0002274.2	0.62	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001831.3	0.48	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001895.4	0.47	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.29 out of 30.11

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.38 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (14):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.88 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.60 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.96 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.62 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.19 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.34 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.22 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.06 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.97 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.37 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.20 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.80 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor

NZ_CP044407.1 - Region 21 - NI-siderophore

Download region SVG

Location: 7,039,999 - 7,071,090 nt. (total: 31,092 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

F7P10_RS31765: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase

F7P10_RS31815: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: decarboxylase hydratase

F7P10_RS31785: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

F7P10_RS31860: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

F7P10_RS31775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000942.4	0.50	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000947.5	0.49	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001498.5	0.45	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0002493.3	0.43	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0002683.2	0.43	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002474.2	0.42	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0002171.2	0.42	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000942.4	0.50	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000947.5	0.49	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001498.5	0.45	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0002493.3	0.43	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0002683.2	0.43	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002474.2	0.42	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0002171.2	0.42	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.26 out of 24.78

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.98 out of 36.53

Confidence: medium

Additional weak hits (14):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.35 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.13 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.25 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.23 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.73 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.27 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.06 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
LexA variant 2	Repressor of DNA damage response

NZ_CP044407.1 - Region 22 - NRPS

Download region SVG

Location: 7,372,058 - 7,439,326 nt. (total: 67,269 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

F7P10_RS33405: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Ligases: ligase

F7P10_RS33400: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS33410: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F7P10_RS44855: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.72	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.72	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.19 out of 36.53

Confidence: medium

Additional weak hits (15):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.35 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.87 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.21 out of 29.65

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.11 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.65 out of 32.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.37 out of 39.62

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.10 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.20 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.22 out of 24.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 39.62

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.04 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.44 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 35, location 7372057 - 7439326:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X) + (D-X - X) + (X - Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

F7P10_RS44855: X - X - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (135..506): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGSFIDAATETLTVCSGERNFYGSTEVTGDATT
Nearest Stachelhaus code(s):: bAla VDTVVSFGDK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1156..1527): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGSFIDAATETLTVCSGERNFYGSTEVTGDATT
Nearest Stachelhaus code(s):: bAla VDTVVSFGDK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2987..3405): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHTFDASWEQWDVSLGGEYNLYGPTEYTINALG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (82% 8Å match)
Stachelhaus code match:: 70% (weak)

F7P10_RS33400: X

AMP-binding (457..834): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWRTFDVAVPEWDLSVGGEWNNYGPTETAVDATG
Nearest Stachelhaus code(s):: Arg DADDSGCVDK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

F7P10_RS33405: X - X - X

AMP-binding (455..823): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGSFIDAATETLTVCSGERNFYGSTEVTGDATT
Nearest Stachelhaus code(s):: bAla VDTVVSFGDK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1468..1839): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGSFIDAATETLTVCSGERNFYGSTEVTGDATT
Nearest Stachelhaus code(s):: bAla VDTVVSFGDK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2487..2854): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGSFIDAATETLTVCSGERNFYGSTEVTGDATT
Nearest Stachelhaus code(s):: bAla VDTVVSFGDK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

F7P10_RS33410: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (38..444): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SASVHSMSVPGSSIHVGGAQQGFGMAEGLVNYNR
Nearest Stachelhaus code(s):: diOH-Bz PMPSGGVVNK (74% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_CP044407.1 - Region 23 - terpene

Download region SVG

Location: 7,925,513 - 7,946,532 nt. (total: 21,020 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

F7P10_RS36115: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000678.5	0.28	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002213.3	0.27	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001151.5	0.23	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0002313.3	0.23	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000703.4	0.20	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000705.3	0.18	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000433.5	0.18	NRPS	surfactin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000678.5	0.28	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002213.3	0.27	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001151.5	0.23	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0002313.3	0.23	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000703.4	0.20	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000705.3	0.18	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000433.5	0.18	NRPS	surfactin	Bacillus velezensis FZB42

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

F7P10_RS36115: T1TS

Domain 1 (19 - 321): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 27.44 out of 35.63

Confidence: medium

Additional weak hits (8):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 39.62

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.84 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.21 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.16 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.66 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.84 out of 21.55

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.84 out of 32.38

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
NrtR	NAD synthesis repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_CP044407.1 - Region 24 - RiPP-like

Download region SVG

Location: 8,001,793 - 8,012,701 nt. (total: 10,909 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

F7P10_RS36430: acyltransferase

smcogs: SMCOG1141: acyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001972.4	0.35	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0002351.3	0.29	NRPS	thanafactin A	Pseudomonas sp. SHC52
BGC0000842.5	0.29	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000197.5	0.28	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0002000.4	0.28	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001594.3	0.28	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000264.5	0.28	PKS	resistomycin, resistoflavine	Streptomyces resistomycificus
BGC0000221.5	0.27	PKS	erdacin	uncultured soil bacterium V167
BGC0000679.5	0.27	terpene	diazepinomicin	Micromonospora sp. M42
BGC0000874.5	0.27	other (other)	blasticidin S	Streptomyces griseochromogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001972.4	0.35	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0002351.3	0.29	NRPS	thanafactin A	Pseudomonas sp. SHC52
BGC0000842.5	0.29	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000197.5	0.28	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0002000.4	0.28	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001594.3	0.28	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000264.5	0.28	PKS	resistomycin, resistoflavine	Streptomyces resistomycificus
BGC0000221.5	0.27	PKS	erdacin	uncultured soil bacterium V167
BGC0000679.5	0.27	terpene	diazepinomicin	Micromonospora sp. M42
BGC0000874.5	0.27	other (other)	blasticidin S	Streptomyces griseochromogenes

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 25.87 out of 27.04

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.28 out of 27.04

Confidence: medium

Additional weak hits (1):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.87 out of 39.62

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_CP044407.1 - Region 25 - terpene-precursor

Download region SVG

Location: 8,022,856 - 8,043,908 nt. (total: 21,053 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

F7P10_RS36535: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

F7P10_RS36540: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

F7P10_RS36630: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: phosphorylase

F7P10_RS36550: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Lyases: decarboxylase dehydratase

F7P10_RS36565: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

F7P10_RS36610: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: synthetase

F7P10_RS36570: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001483.4	0.43	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000285.5	0.43	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0002343.3	0.41	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000843.5	0.41	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.40	other (other)	melanin	Streptomyces avermitilis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001483.4	0.43	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000285.5	0.43	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0002343.3	0.41	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000843.5	0.41	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.40	other (other)	melanin	Streptomyces avermitilis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

F7P10_RS36570: PT_FPPS_like

Domain 1 (43 - 338): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 24.00 out of 24.78

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.43 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.93 out of 29.65

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.05 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.34 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.60 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.89 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.99 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_CP044407.1 - Region 26 - ectoine

Download region SVG

Location: 8,228,914 - 8,239,309 nt. (total: 10,396 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

F7P10_RS37540: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase

F7P10_RS37550: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.82	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.71	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000855.3	0.55	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.55	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000854.3	0.54	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000857.3	0.51	other (other)	ectoine	Methylophaga alcalica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.82	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.71	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000855.3	0.55	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.55	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000854.3	0.54	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000857.3	0.51	other (other)	ectoine	Methylophaga alcalica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.45 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_CP044407.1 - Region 27 - betalactone