LOCUS NZ_RDBM01000066 1512 bp DNA linear CON 01-JAN-2025 DEFINITION Streptomyces sp. gb1(2016) Scaffold_67, whole genome shotgun sequence. ACCESSION NZ_RDBM01000066 VERSION NZ_RDBM01000066.1 KEYWORDS WGS; RefSeq. SOURCE Streptomyces sp. gb1(2016) ORGANISM Streptomyces sp. gb1(2016) Bacteria; Bacillati; Actinomycetota; Actinomycetes; Kitasatosporales; Streptomycetaceae; Streptomyces. REFERENCE 1 (bases 1 to 1512) AUTHORS Hariharan,J., Choudoir,M.J., Diebold,P., Panke-Buisse,K., Campbell,A.N. and Buckley,D.H. TITLE Direct Submission JOURNAL Submitted (16-OCT-2018) Soil and Crop Sciences, Cornell University, 306 Tower Road, Ithaca, NY 14850, USA COMMENT ##Genome-Assembly-Data-START## Assembly Date :: 2018 Assembly Method :: A5+MeDuSa v. JUNE-2018 Genome Representation :: Full Expected Final Version :: Yes Genome Coverage :: 66x Sequencing Technology :: Illumina MiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_008042065.1-RS_2025_01_01 Annotation Date :: 01/01/2025 02:23:01 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.9 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 7,414 CDSs (total) :: 7,333 Genes (coding) :: 6,887 CDSs (with protein) :: 6,887 Genes (RNA) :: 81 rRNAs :: 6, 1, 2 (5S, 16S, 23S) complete rRNAs :: 6, 1, 1 (5S, 16S, 23S) partial rRNAs :: 1 (23S) tRNAs :: 69 ncRNAs :: 3 Pseudo Genes (total) :: 447 CDSs (without protein) :: 446 Pseudo Genes (ambiguous residues) :: 0 of 447 Pseudo Genes (frameshifted) :: 94 of 447 Pseudo Genes (incomplete) :: 395 of 447 Pseudo Genes (internal stop) :: 7 of 447 Pseudo Genes (multiple problems) :: 48 of 447 ##Genome-Annotation-Data-END## ##antiSMASH-Data-START## Version :: 8.dev-cf2fc5ee(changed) Run date :: 2025-09-13 13:17:57 NOTE :: This is a single region extracted from a larger record! Orig. start :: 0 Orig. end :: 1512 ##antiSMASH-Data-END## REFSEQ INFORMATION: The reference sequence is identical to RDBM01000066.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ FEATURES Location/Qualifiers gene <1..628 /locus_tag="EAO74_RS36830" /old_locus_tag="EAO74_36890" source 1..1512 /collection_date="2009" /db_xref="taxon:1828321" /geo_loc_name="USA: Greensboro, North Carolina" /isolation_source="soil" /lat_lon="36.09 N 79.89 W" /mol_type="genomic DNA" /organism="Streptomyces sp. gb1(2016)" /strain="gb1(2016)" /submitter_seqid="Scaffold_67" region 1..1512 /candidate_cluster_numbers="1" /contig_edge="True" /product="terpene" /region_number="1" /rules="(PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)" /tool="antismash" cand_cluster 1..1512 /candidate_cluster_number="1" /contig_edge="True" /detection_rules="(PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)" /kind="single" /product="terpene" /protoclusters="1" /tool="antismash" protocluster 1..1512 /aStool="rule-based-clusters" /category="terpene" /contig_edge="True" /core_location="[<940:1438](-)" /cutoff="20000" /detection_rule="(PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)" /neighbourhood="10000" /product="terpene" /protocluster_number="1" /tool="antismash" proto_core complement(<941..1438) /aStool="rule-based-clusters" /tool="antismash" /cutoff="20000" /detection_rule="(PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)" /neighbourhood="10000" /product="terpene" /protocluster_number="1" CDS <3..628 /codon_start=2 /inference="COORDINATES: similar to AA sequence:RefSeq:WP_010071295.1" /locus_tag="EAO74_RS36830" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /old_locus_tag="EAO74_36890" /product="NPCBM/NEW2 domain-containing protein" /protein_id="WP_187282035.1" /transl_table=11 /translation="GTGRRISRSSSSPERIRPTHEARNSVNFTRWSARLPGTQRRAAAP TPTPTPAPPAPEEPPPAPEVYQVNQLAYSLTGDHTGPEILLGRSQGVFWQRQGLSVAST MYAHGVTAPSRSSVTVQLNRECTRYKAMAGVDDLTLGLGAVRFSVYGGEGARLWQSPVV RGGEPAVPVSVGIEGQETIRLVVEPSGPLGGAALADWAASSISCR" gene complement(685..921) /locus_tag="EAO74_RS39105" CDS complement(685..921) /codon_start=1 /inference="COORDINATES: ab initio prediction:GeneMarkS-2+" /locus_tag="EAO74_RS39105" /note="Derived by automated computational analysis using gene prediction method: GeneMarkS-2+." /product="hypothetical protein" /protein_id="WP_261988505.1" /transl_table=11 /translation="MELDQGATAARILGAAGAWRVDSPRSAAEESQVTAATARLHTALG PRRYEEESALGLGLTPDEVLALLTDTAEDLSGG" gene complement(<941..1438) /locus_tag="EAO74_RS36835" /old_locus_tag="EAO74_36895" /pseudo="" CDS complement(<941..1438) /codon_start=1 /gene_functions="biosynthetic (rule-based-clusters) terpene: T1TS" /gene_functions="regulatory (smcogs) SMCOG1041: transcriptional regulator, SARP family" /gene_kind="biosynthetic" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_010044953.1" /locus_tag="EAO74_RS36835" /note="internal stop; incomplete; partial in the middle of a contig; missing C-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /old_locus_tag="EAO74_36895" /product="BTAD domain-containing putative transcriptional regulator" /pseudo="" /sec_met_domain="T1TS (E-value: 1.4e-07, bitscore: 18.8, seeds: 237, tool: rule-based-clusters)" /transl_table=11 /translation="MRYLILGVTEARDEHGGPLPVGGARLRTLLAALALRAGRPASVAG LIDDVWDDDPPQDAPAALQALVGRLRRVLGREAVAGTPGGYRLTAGPDDIELYVFERLA RQGAAELDAGTPEDAARTLRAALAL" ORIGIN 1 ggggaccggc cgcagaatca gcagaagcag cagctcgccc gagcggatcc gaccgacaca 61 cgaggccaga aattccgtga acttcacgcg ctggagcgcc cgccttcccg gaacgcagcg 121 tcgagccgcc gcgccgacgc ccacgccgac cccggcaccg cccgccccgg aggagccgcc 181 gcccgcgccg gaggtctacc aggtgaacca gctggcgtac tccctcaccg gtgaccacac 241 gggccccgag atcctgctcg gccggagcca gggtgtgttc tggcagcgcc aggggctgtc 301 ggtcgcctcc acgatgtacg cccacggggt gaccgccccc tcccgctcct ctgtgaccgt 361 ccagctcaac cgggagtgca cccgctacaa ggcgatggcc ggggtcgacg acctgaccct 421 ggggctcggc gcggtgcgct tctcggtgta cggcggggag ggggcgcggc tgtggcagtc 481 cccggtggtc cggggcggtg agcccgccgt accggtgagc gtgggcatcg agggccagga 541 gacgatccgg ctggtcgtgg agccgtccgg gccgctcggc ggggccgcgc tggccgactg 601 ggcggcgtcg agcatcagtt gccgctgaga tcctcggcgg cgtgacgtat caactgccgc 661 cgcgttcccc ggccgcagcg agcctcagcc gccgctgaga tcctcggccg tgtcggtcag 721 gagggccagg acctcgtccg gtgtcaggcc gaggcccagg gcgctctcct cctcgtaccg 781 ccgggggccc agcgccgtgt gcagccgtgc cgtcgccgcg gtcacctggg actcctccgc 841 cgcggagcgg gggctgtcca cccgccaggc gccggccgcc ccgaggatcc gggccgcggt 901 cgcgccctgg tccagctcca ccagcgaggc cggccgtggc cccgcgccgc aggtccgcct 961 cgatgcgctg ctggagcgcg gtgagccggt gggcctcggc ctggagcccg tgctcgtgcc 1021 cggggagatc ggcgagggcg gggccgcgct acagggcgag tgcggcgcgc agggtgcggg 1081 cggcgtcctc gggggtgccc gcgtcgagct cggcggcgcc ctggcgggcg aggcgctcga 1141 agacgtacag ctcgatgtcg tcagggccgg cggtgagccg gtagccgccc ggggtgccgg 1201 ccaccgcctc ccggccgagg acgcgccgca gccgtccgac gagggcttgg agggcggcgg 1261 gggcgtcctg cggaggatcg tcgtcccata cgtcgtcgat gagcccggcg acgctcgcgg 1321 ggcggcccgc gcggagggcg agggcggcga gcagggtgcg cagccgggcg ccgccgacgg 1381 gcagcggccc gccgtgctcg tctcgcgcct cggtgacgcc caggatcaga taccgcaccc 1441 ggccattgtg tcccgccggg cgcgctgccc gtcggcggcg cccggctgcg caccctgctc 1501 gccgccctcg cc //