GCF_007896905.1 - 25 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_VOGX01000018.1 (Streptomyces albidoflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	T2PKS,ectoine,butyrolactone	54,520	127,080	Medium	kosinostatin	NRPS:Type I+PKS
Region 1.2	terpene,NRPS-like,NRPS	278,959	355,839
Region 1.3	NRPS,T1PKS	508,182	557,592	High	SGR PTMs/SGR PTM Compound b/SGR PTM Compound c/SGR PTM Compound d	NRPS:Type I+PKS
Region 1.4	terpene	592,121	618,679	High	hopene	terpene
Region 1.5	RiPP-like	684,414	694,629
Region 1.6	RiPP-like	1,142,582	1,153,910
Region 1.7	NRPS	1,381,828	1,432,041	High	cyclofaulknamycin	PKS
Region 1.8	NI-siderophore	1,534,620	1,567,657
Region 1.9	terpene	1,805,960	1,828,245	High	geosmin	terpene:Sesquiterpene
Region 1.10	terpene-precursor	2,109,914	2,130,957
Region 1.11	terpene	2,140,767	2,161,741	Low	julichrome Q3-3/julichrome Q3-5	PKS
Region 1.12	azole-containing-RiPP,RRE-containing	2,648,734	2,683,418

NZ_VOGX01000023.1 (Streptomyces albidoflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	azole-containing-RiPP,NRPS	46,348	145,635	High	surugamide A/surugamide D	NRPS:Type I

NZ_VOGX01000028.1 (Streptomyces albidoflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	ectoine	93,340	103,738	High	ectoine	other:other

NZ_VOGX01000034.1 (Streptomyces albidoflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	terpene,RiPP-like	703,193	732,511	High	isorenieratene	terpene
Region 16.2	RiPP-like	804,583	815,950	Medium	streptamidine	ribosomal:unmodified
Region 16.3	T3PKS	831,484	872,581	Low	valinomycin/montanastatin	saccharide:hybrid/tailoring+NRPS:Type I
Region 16.4	T1PKS,terpene-precursor,NRPS-like,NRPS,lanthipeptide-class-ii,transAT-PKS	877,544	1,149,744	High	candicidin	NRPS:Type I+PKS

NZ_VOGX01000001.1 (Streptomyces albidoflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	NRPS	272,571	322,860

NZ_VOGX01000054.1 (Streptomyces albidoflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 38.1	NRPS	296,676	341,070	Low	dudomycin A	NRPS:Type I
Region 38.2	NI-siderophore	560,163	587,295	High	desferrioxamin B	other:other

NZ_VOGX01000061.1 (Streptomyces albidoflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 42.1	NRPS	1	29,317	Medium	SF2768	NRPS:Type I

NZ_VOGX01000074.1 (Streptomyces albidoflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 58.1	NRPS-like	1	8,672	High	minimycin/indigoidine	NRPS:Type I+saccharide

NZ_VOGX01000092.1 (Streptomyces albidoflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 78.1	lanthipeptide-class-iii	57,649	80,234	High	SAL-2242	ribosomal:RiPP:Lanthipeptide
Region 78.2	NRPS	106,545	167,029	Medium	mannopeptimycin	NRPS:Type I

No secondary metabolite regions were found in these records:: NZ_VOGX01000019.1 (Streptomyces albidoflavus); NZ_VOGX01000020.1 (Streptomyces albidoflavus); NZ_VOGX01000021.1 (Streptomyces albidoflavus); NZ_VOGX01000022.1 (Streptomyces albidoflavus); NZ_VOGX01000024.1 (Streptomyces albidoflavus); NZ_VOGX01000025.1 (Streptomyces albidoflavus); NZ_VOGX01000026.1 (Streptomyces albidoflavus); NZ_VOGX01000027.1 (Streptomyces albidoflavus); NZ_VOGX01000029.1 (Streptomyces albidoflavus); NZ_VOGX01000030.1 (Streptomyces albidoflavus); NZ_VOGX01000031.1 (Streptomyces albidoflavus); NZ_VOGX01000032.1 (Streptomyces albidoflavus); NZ_VOGX01000035.1 (Streptomyces albidoflavus); NZ_VOGX01000036.1 (Streptomyces albidoflavus); NZ_VOGX01000037.1 (Streptomyces albidoflavus); NZ_VOGX01000038.1 (Streptomyces albidoflavus); NZ_VOGX01000039.1 (Streptomyces albidoflavus); NZ_VOGX01000040.1 (Streptomyces albidoflavus); NZ_VOGX01000041.1 (Streptomyces albidoflavus); NZ_VOGX01000042.1 (Streptomyces albidoflavus); NZ_VOGX01000043.1 (Streptomyces albidoflavus); NZ_VOGX01000045.1 (Streptomyces albidoflavus); NZ_VOGX01000044.1 (Streptomyces albidoflavus); NZ_VOGX01000046.1 (Streptomyces albidoflavus); NZ_VOGX01000002.1 (Streptomyces albidoflavus); NZ_VOGX01000048.1 (Streptomyces albidoflavus); NZ_VOGX01000050.1 (Streptomyces albidoflavus); NZ_VOGX01000049.1 (Streptomyces albidoflavus); NZ_VOGX01000051.1 (Streptomyces albidoflavus); NZ_VOGX01000057.1 (Streptomyces albidoflavus); NZ_VOGX01000052.1 (Streptomyces albidoflavus); NZ_VOGX01000053.1 (Streptomyces albidoflavus); NZ_VOGX01000055.1 (Streptomyces albidoflavus); NZ_VOGX01000056.1 (Streptomyces albidoflavus); NZ_VOGX01000058.1 (Streptomyces albidoflavus); NZ_VOGX01000062.1 (Streptomyces albidoflavus); NZ_VOGX01000063.1 (Streptomyces albidoflavus); NZ_VOGX01000064.1 (Streptomyces albidoflavus); NZ_VOGX01000065.1 (Streptomyces albidoflavus); NZ_VOGX01000003.1 (Streptomyces albidoflavus); NZ_VOGX01000004.1 (Streptomyces albidoflavus); NZ_VOGX01000005.1 (Streptomyces albidoflavus); NZ_VOGX01000066.1 (Streptomyces albidoflavus); NZ_VOGX01000067.1 (Streptomyces albidoflavus); NZ_VOGX01000068.1 (Streptomyces albidoflavus); NZ_VOGX01000070.1 (Streptomyces albidoflavus); NZ_VOGX01000069.1 (Streptomyces albidoflavus); NZ_VOGX01000071.1 (Streptomyces albidoflavus); NZ_VOGX01000072.1 (Streptomyces albidoflavus); NZ_VOGX01000073.1 (Streptomyces albidoflavus); NZ_VOGX01000075.1 (Streptomyces albidoflavus); NZ_VOGX01000076.1 (Streptomyces albidoflavus); NZ_VOGX01000077.1 (Streptomyces albidoflavus); NZ_VOGX01000079.1 (Streptomyces albidoflavus); NZ_VOGX01000078.1 (Streptomyces albidoflavus); NZ_VOGX01000080.1 (Streptomyces albidoflavus); NZ_VOGX01000081.1 (Streptomyces albidoflavus); NZ_VOGX01000086.1 (Streptomyces albidoflavus); NZ_VOGX01000082.1 (Streptomyces albidoflavus); NZ_VOGX01000083.1 (Streptomyces albidoflavus); NZ_VOGX01000084.1 (Streptomyces albidoflavus); NZ_VOGX01000085.1 (Streptomyces albidoflavus); NZ_VOGX01000009.1 (Streptomyces albidoflavus); NZ_VOGX01000010.1 (Streptomyces albidoflavus); NZ_VOGX01000006.1 (Streptomyces albidoflavus); NZ_VOGX01000007.1 (Streptomyces albidoflavus); NZ_VOGX01000008.1 (Streptomyces albidoflavus); NZ_VOGX01000087.1 (Streptomyces albidoflavus); NZ_VOGX01000088.1 (Streptomyces albidoflavus); NZ_VOGX01000089.1 (Streptomyces albidoflavus); NZ_VOGX01000090.1 (Streptomyces albidoflavus); NZ_VOGX01000091.1 (Streptomyces albidoflavus); NZ_VOGX01000093.1 (Streptomyces albidoflavus); NZ_VOGX01000094.1 (Streptomyces albidoflavus); NZ_VOGX01000095.1 (Streptomyces albidoflavus); NZ_VOGX01000011.1 (Streptomyces albidoflavus); NZ_VOGX01000012.1 (Streptomyces albidoflavus); NZ_VOGX01000013.1 (Streptomyces albidoflavus); NZ_VOGX01000014.1 (Streptomyces albidoflavus); NZ_VOGX01000015.1 (Streptomyces albidoflavus); NZ_VOGX01000016.1 (Streptomyces albidoflavus)

Compact view

NZ_VOGX01000018.1 - Region 1 - T2PKS,butyrolactone,ectoine

Download region GenBank file

Download region SVG

Location: 54,520 - 127,080 nt. (total: 72,561 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
ectoine: ectoine_synt
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

FRZ02_RS02665: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FRZ02_RS02690: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FRZ02_RS02700: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

FRZ02_RS02715: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

FRZ02_RS02735: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FRZ02_RS02760: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FRZ02_RS02825: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FRZ02_RS02840: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FRZ02_RS02885: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: PPTase glycosyltransferase methyltransferase

FRZ02_RS02695: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

FRZ02_RS02740: methyltransferase

smcogs: SMCOG1089: methyltransferase

FRZ02_RS02835: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

FRZ02_RS02730: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

FRZ02_RS02855: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase

FRZ02_RS02810: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

FRZ02_RS02845: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

FRZ02_RS02655: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

FRZ02_RS02785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FRZ02_RS02800: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

FRZ02_RS02805: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

FRZ02_RS02970: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.97	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.73	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.59	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001135.5	0.52	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001240.4	0.52	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001249.5	0.52	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.52	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.52	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001261.3	0.52	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.51	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.69	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000231.5	0.64	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000850.5	0.63	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0002075.3	0.61	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.29 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.26 out of 23.79

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.68 out of 30.11

Confidence: medium

Additional weak hits (13):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.27 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.37 out of 20.01

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.00 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.22 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.99 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.19 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.31 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.24 out of 25.88

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.77 out of 32.38

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.08 out of 27.18

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 30.11

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.69 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

FRZ02_RS02785: X

AMP-binding (28..408): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLCLLDTQGLFTGDHNIYGCTETSFWYEV
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 54519 to 127080
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 655.3; E-value: 6.7e-200)
Product molecular weight(s):: acetyl-CoA_8: 530 Da
acetyl-CoA_9: 572 Da

FRZ02_RS02690: KR C17 (Score: 354.2; E-value: 7.8e-109)
FRZ02_RS02695: GT (Score: 426.4; E-value: 3.3e-130)
FRZ02_RS02720: CYC C5-C14 (Score: 454.6; E-value: 3e-139)
FRZ02_RS02735: KR C17 (Score: 407.4; E-value: 4.7e-125)
FRZ02_RS02740: MET carboxy_O (Score: 331.6; E-value: 6.2e-102)
FRZ02_RS02790: ACP (Score: 112.4; E-value: 1.8e-35)
FRZ02_RS02800: CLF 8|9 (Score: 655.3; E-value: 6.7e-200)
FRZ02_RS02805: KS (Score: 748.8; E-value: 3.3e-228)
FRZ02_RS02810: CYC C7-C12 (Score: 443.2; E-value: 9.1e-136)
FRZ02_RS02815: CYC C1-C18|C2-C19 (Score: 185.2; E-value: 1.2e-57)
FRZ02_RS02845: CYC C7-C12 (Score: 232.1; E-value: 1.6e-71)
FRZ02_RS02885: OXY (Score: 319.7; E-value: 8.3e-98)

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_VOGX01000018.1 - Region 2 - NRPS,NRPS-like,terpene

Download region GenBank file

Download region SVG

Location: 278,959 - 355,839 nt. (total: 76,881 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FRZ02_RS03690: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

FRZ02_RS03695: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FRZ02_RS03705: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FRZ02_RS03830: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FRZ02_RS03840: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

FRZ02_RS03900: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: kinase methyltransferase

FRZ02_RS03875: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

FRZ02_RS03935: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase phosphatase

FRZ02_RS03715: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

FRZ02_RS03835: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: ligase synthase

FRZ02_RS03820: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

FRZ02_RS03845: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FRZ02_RS03855: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FRZ02_RS03860: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.85	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.84	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.82	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.82	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.82	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.80	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.80	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001050.5	0.78	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001166.5	0.75	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.72	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

FRZ02_RS03725: PT_phytoene_like

Domain 1 (279 - 552): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 27.07 out of 28.19

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.62 out of 36.53

Confidence: medium

Additional weak hits (17):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.73 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.55 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.41 out of 30.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.12 out of 39.62

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 11.72 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.24 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.67 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.78 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.23 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.49 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.96 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.43 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 14.99 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.01 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.20 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.91 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 278958 - 355839:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal - X) + (Thr - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 295460 - 337263:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal - X) + (Thr - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 297325 - 355839:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal - X) + (Thr - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS03845: X

AMP-binding (12..412): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MDRSWDGALLLPVCVLAGERNEYGPTETTVAVLA
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

FRZ02_RS03855: X

AMP-binding (1272..1661): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWSAFDISVLESVALC-GEWNAYGPTECTVFATA
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (65% 8Å match)
Stachelhaus code match:: 60% (weak)

FRZ02_RS03860: Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (461..876): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFSVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2556..2935): X

nrpys: Val, Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RDPSWDAVVYEAFLATGGDVHLYGPVENTTFSLG
Nearest Stachelhaus code(s):: Ile or aIle DAYFWGVTFK (62% 8Å match); Val DAYFWGVTFK (59% 8Å match); Val or aIle DAYFLGVTFK (59% 8Å match); Ile or Val DAYFWGVTFK (56% 8Å match); Ile DAYFWGVTFK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_VOGX01000018.1 - Region 3 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 508,182 - 557,592 nt. (total: 49,411 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxygenase

FRZ02_RS04675: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FRZ02_RS04680: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FRZ02_RS04685: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FRZ02_RS04690: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FRZ02_RS04710: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: acetyltransferase kinase

FRZ02_RS04665: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

FRZ02_RS04760: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Ligases: synthase

FRZ02_RS04695: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	1.21	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	1.21	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001273.3	0.91	PKS	asperlactone	Aspergillus ochraceus
BGC0000996.5	0.90	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001275.3	0.90	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.89	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002075.3	0.83	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001726.4	0.75	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001556.5	0.70	NRPS, PKS	combamide	Streptomyces sp.
BGC0002509.3	0.69	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	0.84	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	0.84	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0000996.5	0.75	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001726.4	0.70	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001556.5	0.68	NRPS, PKS	combamide	Streptomyces sp.
BGC0002509.3	0.68	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (11):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.69 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.14 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.97 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.39 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.61 out of 27.04

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.06 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 508181 - 557592:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS04695: pk - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (558..854): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; CE-Malonyl-CoA: 54.2%; Acetyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 103.9
Methoxymalonyl-CoA: 96.3
Malonyl-CoA: 91.2
Ethylmalonyl-CoA: 85.2
Propionyl-CoA: 63.6
Isobutyryl-CoA: 60.3
Benzoyl-CoA: 57.0
Acetyl-CoA: 49.4
trans-1,2-CPDA: 48.2
2-Methylbutyryl-CoA: 46.0
fatty_acid: 28.9
CHC-CoA: 27.0
inactive: 21.8
3-Methylbutyryl-CoA: 15.4

AMP-binding (2311..2724): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: ASWAFDVFTGDRELIVGSDLNSYGVTEATIDSAC
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_VOGX01000018.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 592,121 - 618,679 nt. (total: 26,559 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FRZ02_RS05020: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FRZ02_RS05055: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

FRZ02_RS04995: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

FRZ02_RS05060: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthetase

FRZ02_RS05015: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

FRZ02_RS05010: T2TS

Domain 1 (28 - 656): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

FRZ02_RS05015: PT_FPPS_like

Domain 1 (60 - 354): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

FRZ02_RS05025: PT_phytoene_like

Domain 1 (17 - 299): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

FRZ02_RS05030: PT_phytoene_like

Domain 1 (17 - 293): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.25 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.96 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 26.85

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.57 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_VOGX01000018.1 - Region 5 - RiPP-like

Download region GenBank file

Download region SVG

Location: 684,414 - 694,629 nt. (total: 10,216 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

FRZ02_RS05370: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001862.4	0.44	ribosomal	pallidocin	Aeribacillus pallidus
BGC0000484.5	0.43	ribosomal	glycocin F	Lactobacillus plantarum
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001862.4	0.44	ribosomal	pallidocin	Aeribacillus pallidus
BGC0000484.5	0.43	ribosomal	glycocin F	Lactobacillus plantarum
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.61 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.77 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.44 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_VOGX01000018.1 - Region 6 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,142,582 - 1,153,910 nt. (total: 11,329 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FRZ02_RS07370: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase

FRZ02_RS07345: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001868.4	0.40	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001221.5	0.33	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0002788.2	0.30	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001596.3	0.30	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001377.5	0.30	PKS	uncialamycin	Streptomyces uncialis
BGC0001984.3	0.27	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0001060.5	0.27	PKS	dynemicin A	Micromonospora chersina
BGC0000241.5	0.25	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.25	PKS	nenestatin	Micromonospora echinospora
BGC0000240.5	0.24	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001868.4	0.40	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001221.5	0.33	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0002788.2	0.30	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001596.3	0.30	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001377.5	0.30	PKS	uncialamycin	Streptomyces uncialis
BGC0001984.3	0.27	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0001060.5	0.27	PKS	dynemicin A	Micromonospora chersina
BGC0000241.5	0.25	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.25	PKS	nenestatin	Micromonospora echinospora
BGC0000240.5	0.24	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

NZ_VOGX01000018.1 - Region 7 - NRPS

Download region GenBank file

Download region SVG

Location: 1,381,828 - 1,432,041 nt. (total: 50,214 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FRZ02_RS08385: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

FRZ02_RS08460: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase

FRZ02_RS08400: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: esterase hydrolase

FRZ02_RS08435: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

FRZ02_RS08470: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

FRZ02_RS08440: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FRZ02_RS08445: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

FRZ02_RS08370: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002358.3	0.86	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002358.3	0.86	PKS	cyclofaulknamycin	Streptomyces albidoflavus
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.57 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.48 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 1381827 - >1432041:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe - D-X - Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS08440: Phe - X - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (258..650): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LVQAFDAAFWEMTLVVAGEINAYGPTETTVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1304..1692): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAEAFDGAVMEMLLVVGGEINAYGPTESTVVATM
Nearest Stachelhaus code(s):: Thr DGMLVGAIVK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2821..3219): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LASAFDASTFETWLLAGGDTNGYGPTEATTFTTT
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_VOGX01000018.1 - Region 8 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1,534,620 - 1,567,657 nt. (total: 33,038 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FRZ02_RS08920: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

FRZ02_RS08970: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

FRZ02_RS08915: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.90 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (11):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.37 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.85 out of 26.06

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.32 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.07 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_VOGX01000018.1 - Region 9 - terpene

Download region GenBank file

Download region SVG

Location: 1,805,960 - 1,828,245 nt. (total: 22,286 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FRZ02_RS10105: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

FRZ02_RS10125: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

FRZ02_RS10135: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000846.5	0.40	other (other)	tabtoxin	Pseudomonas syringae
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001221.5	0.36	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001940.3	0.32	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0000453.5	0.30	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0001712.3	0.28	other (other)	ochrindole A	Aspergillus steynii IBT 23096
BGC0001215.5	0.28	NRPS	conglobatin	Streptomyces conglobatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000846.5	0.40	other (other)	tabtoxin	Pseudomonas syringae
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001221.5	0.36	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001940.3	0.32	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0000453.5	0.30	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0001712.3	0.28	other (other)	ochrindole A	Aspergillus steynii IBT 23096
BGC0001215.5	0.28	NRPS	conglobatin	Streptomyces conglobatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

FRZ02_RS10125: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (351 - 717): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.93 out of 36.54

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.96 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.12 out of 27.18

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description

NZ_VOGX01000018.1 - Region 10 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 2,109,914 - 2,130,957 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

FRZ02_RS11370: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

FRZ02_RS11420: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000340.5	0.38	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000561.5	0.38	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000340.5	0.38	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000561.5	0.38	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0001605.3	0.38	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

FRZ02_RS11420: PT_FPPS_like

Domain 1 (61 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.78 out of 30.98

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.69 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_VOGX01000018.1 - Region 11 - terpene

Download region GenBank file

Download region SVG

Location: 2,140,767 - 2,161,741 nt. (total: 20,975 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FRZ02_RS11550: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

FRZ02_RS11560: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

FRZ02_RS11555: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.81	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.81	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

FRZ02_RS11555: T1TS

Domain 1 (2 - 303): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.29 out of 27.04

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.01 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.14 out of 24.78

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.17 out of 25.88

Confidence: medium

Additional weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.73 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.28 out of 27.04

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
PsrA	Oleic acid responsive regulator

NZ_VOGX01000018.1 - Region 12 - RRE-containing,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 2,648,734 - 2,683,418 nt. (total: 34,685 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

FRZ02_RS13850: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: amidase hydrolase

FRZ02_RS13760: amidase

smcogs: SMCOG1105: amidase

FRZ02_RS13775: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: dehydratase

FRZ02_RS13810: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Isomerases: mutase

FRZ02_RS13870: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.41	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001146.5	0.37	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000605.5	0.34	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0001472.5	0.33	ribosomal	berninamycin A	Streptomyces bernensis
BGC0001640.3	0.33	ribosomal	kocurin	Kocuria rosea
BGC0000569.5	0.32	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001860.4	0.32	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000628.4	0.32	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0000603.5	0.32	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001170.5	0.32	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.54	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001146.5	0.51	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000628.4	0.50	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0000613.5	0.49	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001860.4	0.49	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0001170.5	0.48	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000605.5	0.48	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0001640.3	0.48	ribosomal	kocurin	Kocuria rosea
BGC0001174.4	0.48	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001472.5	0.47	ribosomal	berninamycin A	Streptomyces bernensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.37 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.79 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.83 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.71 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.91 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.58 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.97 out of 30.98

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 24 - 102; Score: 59.7; RRE type: Heterocycloanthracin_C_RRE; Location: 23 - 107; Score: 37.3
: RRE type: Thiopeptide_F_RRE; Location: 24 - 102; Score: 59.7; RRE type: Heterocycloanthracin_C_RRE; Location: 23 - 107; Score: 37.3

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_VOGX01000023.1 - Region 1 - NRPS,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 46,348 - 145,635 nt. (total: 99,288 nt) Show pHMM detection rules used

Region on contig edge.

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FRZ02_RS16035: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acyltransferase

FRZ02_RS16080: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

FRZ02_RS16085: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: hydrolase

FRZ02_RS16040: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

FRZ02_RS16075: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

FRZ02_RS16090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FRZ02_RS16095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001792.5	0.79	NRPS	surugamide A, surugamide D	Streptomyces albidoflavus
BGC0001135.5	0.44	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.44	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.42	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.40	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.40	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.39	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.39	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.39	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.38	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001792.5	0.85	NRPS	surugamide A, surugamide D	Streptomyces albidoflavus
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.70	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (16):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.25 out of 33.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.82 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.02 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.31 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.81 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.90 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.45 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.79 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.57 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.34 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.49 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.27 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.82 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 1, location 46347 - 145635:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - D-Ala - Ile - D-X - Lys) + (Trp - D-Leu - Val - Thr) + (Ile - D-Leu - Val - D-Ala - Val - D-Ala) + (D-Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 49328 - 145635:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - D-Ala - Ile - D-X - Lys) + (Trp - D-Leu - Val - Thr) + (Ile - D-Leu - Val - D-Ala - Val - D-Ala) + (D-Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS16080: Ile - Ala - Ile - X - Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (12..399): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDAATYEVFLWTGGEVHVYGPTETTTFAVC
Nearest Stachelhaus code(s):: Ile DAYFWGVTFK (97% 8Å match); Ile or aIle DAYFWGVTFK (94% 8Å match); Ile or Val DAYFWGVTFK (88% 8Å match); Val DAYFWGVTFK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1050..1423): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEGSAVLAGEANIYGPTEATVYATG
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2559..2952): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDAATYEVFLWTGGEVHVYGPTEATTFALC
Nearest Stachelhaus code(s):: Ile DAYFWGVTFK (100% 8Å match); Ile or Val DAYFWGVTFK (88% 8Å match); Val DAYFWGVTFK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3616..4002): X

nrpys: Ile, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDAATYEAFLWTGGEVHVYGPTETTTFAIS
Nearest Stachelhaus code(s):: Ile or aIle DAYFWGVTFK (97% 8Å match); Ile or Val DAYFWGVTFK (85% 8Å match); Leu DAYFWGVTFK (82% 8Å match); Val DAYFWGVTFK (82% 8Å match); Ile DAYFWGVTFK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5127..5537): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: GSWAFDVFVSDHDTAGGADVNGYGVTEATVESCV
Nearest Stachelhaus code(s):: Lys DVSDAGGVEK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

FRZ02_RS16085: Trp - Leu - Val - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (43..432): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHVFDVAMADMMVVIGGEVNAYGPTEATVCTTL
Nearest Stachelhaus code(s):: Trp DVAMVGAVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1106..1482): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FALAFDASVMEMLIATGGELNAYGPTEITVAASI
Nearest Stachelhaus code(s):: Leu DAMLAGAVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2623..3011): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDGSFDAATYEVWIWTGGDVNGYGPTETTTFAVS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3661..4073): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFTVWEGNQVFGGEVNMYGITETTVHVTS
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

FRZ02_RS16090: Ile - Leu - Val - Ala - Val - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (525..926): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWFSFLDSVTEGTLVSSGELNLYGSSEISADSLA
Nearest Stachelhaus code(s):: Ile LDTTVSLADK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1587..1964): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FALAFDASVMEMLIATGGELNAYGPTEITVAASI
Nearest Stachelhaus code(s):: Leu DAMLAGAVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3090..3479): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHSFDAATYEVWIWTGGDVNGYGPTETTTFAVS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4139..4509): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWASFDVSVFEGSAVLAGEANIYGPTEATVYATG
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5635..6026): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDAATYEVWIWTGGDVNGYGPTETTTFAVT
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (6685..7058): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEGSGVLAGEANIYGPTEATVYATG
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

FRZ02_RS16095: X - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (504..879): X

nrpys: Ile, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDAATYEAFLWTGGEVHVYGPTETTTFAIS
Nearest Stachelhaus code(s):: Ile or aIle DAYFWGVTFK (97% 8Å match); Ile or Val DAYFWGVTFK (85% 8Å match); Leu DAYFWGVTFK (82% 8Å match); Val DAYFWGVTFK (82% 8Å match); Ile DAYFWGVTFK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1409..1806): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSLAFDASVLELLIFTGGEVNAYGPTETTVVATM
Nearest Stachelhaus code(s):: Leu DALLFGAVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 18 - 113; Score: 69.1; RRE type: NHLP_CD_RRE; Location: 18 - 110; Score: 47.2; RRE type: Cyanobactin_D_RRE; Location: 18 - 94; Score: 34.8

TFBS definitions

Regulator	Description

Core peptide predictions

No core peptides found.

NZ_VOGX01000028.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 93,340 - 103,738 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

FRZ02_RS16750: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase

FRZ02_RS16725: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

FRZ02_RS16735: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

FRZ02_RS16760: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.17 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.04 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.78 out of 28.14

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.64 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_VOGX01000034.1 - Region 1 - RiPP-like,terpene

Download region GenBank file

Download region SVG

Location: 703,193 - 732,511 nt. (total: 29,319 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FRZ02_RS21395: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

FRZ02_RS21435: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FRZ02_RS21460: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FRZ02_RS21525: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Ligases: synthase synthetase

FRZ02_RS21430: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

FRZ02_RS21490: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.51	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.43	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.41	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.41	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.30	terpene	carotenoid	Myxococcus xanthus
BGC0002309.2	0.29	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000677.5	0.28	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000644.3	0.26	terpene	carotenoid	Dietzia sp. CQ4
BGC0001911.3	0.25	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.73	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.67	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.64	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.64	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.64	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000645.3	0.50	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

FRZ02_RS21430: PT_FPPS_like

Domain 1 (72 - 368): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

FRZ02_RS21440: PT_phytoene_like

Domain 1 (16 - 313): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

FRZ02_RS21465: Lycopene_cycl

Domain 1 (5 - 382): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.48 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.85 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

Additional weak hits (10):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.02 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.26 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.73 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.17 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.02 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.97 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.73 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.75 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_VOGX01000034.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 804,583 - 815,950 nt. (total: 11,368 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.89	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000513.3	0.43	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002005.2	0.41	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000590.5	0.41	ribosomal	microcin N	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.89	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000513.3	0.43	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002005.2	0.41	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000590.5	0.41	ribosomal	microcin N	Escherichia coli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.61 out of 29.25

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.15 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_VOGX01000034.1 - Region 3 - T3PKS

Download region GenBank file

Download region SVG

Location: 831,484 - 872,581 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FRZ02_RS22045: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

FRZ02_RS22065: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FRZ02_RS22080: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FRZ02_RS22120: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FRZ02_RS22125: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FRZ02_RS22130: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: synthase

FRZ02_RS22075: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.63	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.56	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001905.4	0.50	PKS	violapyrone B	Streptomyces somaliensis
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001377.5	0.47	PKS	uncialamycin	Streptomyces uncialis
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.63	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.56	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001905.4	0.50	PKS	violapyrone B	Streptomyces somaliensis
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001377.5	0.47	PKS	uncialamycin	Streptomyces uncialis
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.18 out of 30.12

Confidence: medium

Additional weak hits (13):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.84 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.66 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.14 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.02 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.88 out of 30.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.43 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.86 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.49 out of 26.06

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.35 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.81 out of 29.38

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.72 out of 30.98

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_VOGX01000034.1 - Region 4 - NRPS,NRPS-like,T1PKS,lanthipeptide-class-ii,terpene-precursor,transAT-PKS

Download region GenBank file

Download region SVG

Location: 877,544 - 1,149,744 nt. (total: 272,201 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene-precursor: (PT_FPPS_like and not PT_HPP)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FRZ02_RS22260: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FRZ02_RS22360: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FRZ02_RS22445: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FRZ02_RS22485: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FRZ02_RS22590: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FRZ02_RS22705: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: acetyltransferase acylase acyltransferase aminotransferase formyltransferase glycosyltransferase halogenase

FRZ02_RS22320: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

FRZ02_RS22325: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

FRZ02_RS22340: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

FRZ02_RS22365: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

FRZ02_RS22370: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

FRZ02_RS22495: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

FRZ02_RS22605: halogenase

smcogs: SMCOG1119: halogenase

FRZ02_RS22620: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

FRZ02_RS22625: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase protease

FRZ02_RS22350: thioesterase

smcogs: SMCOG1004: thioesterase

FRZ02_RS22575: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

FRZ02_RS22665: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase dehydratase

FRZ02_RS22300: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

FRZ02_RS22525: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Isomerases: isomerase

FRZ02_RS22345: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase synthetase

FRZ02_RS22270: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

FRZ02_RS22305: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FRZ02_RS22310: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FRZ02_RS22315: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FRZ02_RS22480: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FRZ02_RS22490: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FRZ02_RS22500: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

FRZ02_RS22515: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FRZ02_RS22630: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FRZ02_RS22640: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FRZ02_RS22650: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000958.5	2.31	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001164.3	2.11	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	2.11	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	2.05	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	2.04	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	2.04	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001284.4	2.00	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001244.3	1.98	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	1.92	PKS	asperlactone	Aspergillus ochraceus
BGC0001216.5	1.87	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000034.5	0.97	NRPS, PKS	candicidin	Streptomyces sp. FR-008
BGC0000958.5	0.96	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001216.5	0.87	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0001455.6	0.81	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.72	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.72	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for FRZ02_RS22525

allorf_1079300_1079488

Leader:

MGDGGTWGSGPHLSWRARRGPGG

Core:

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

Core with dehydrations:

RAGDhbADhaPPCysGWARDhbPPRGHDhaGDhbGMPVREGVDKDhaLRALRDha

antiSMASH-DB 4.0 matches for allorf_1079300_1079488

100.0%

NZ_AP025692.1and 6 others:

NZ_AP025692.1 Lanthipeptides: allorf_0069478_0069666_lanthipeptideNZ_CP056773.1 Lanthipeptides: allorf_6887512_6887700_lanthipeptideNZ_CP056773.1 Lanthipeptides: allorf_6887512_6887700_lanthipeptideNZ_OX371412.1 Lanthipeptides: allorf_0056080_0056268_lanthipeptideNZ_VOGX01000034.1 Lanthipeptides: allorf_1079300_1079488_lanthipeptideNZ_VOGX01000034.1 Lanthipeptides: allorf_1079300_1079488_lanthipeptide

Lanthipeptides: allorf_0069478_0069666_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

97.4%

NZ_CP047147.1and 1 other:

NZ_CP047147.1 Lanthipeptides: allorf_0132945_0133133_lanthipeptide

Lanthipeptides: allorf_0132945_0133133_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

RAGTASPPCGWA TPPRGHSGTGMPVREGVDKSLRALRS

1

RAGTASPPCGWAPTPPRGHSGTGMPVREGVDKSLRALRS

39

94.9%

NZ_KB890710.1and 1 other:

NZ_KB890710.1 Lanthipeptides: allorf_068944_069132_lanthipeptide

Lanthipeptides: allorf_068944_069132_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

R GTASPPCGWA TPPRGHSGTGMPVREGVDKSLRALRS

1

RPGTASPPCGWAPTPPRGHSGTGMPVREGVDKSLRALRS

39

with 5 more sequence matches

81.8%

NZ_JAHUVY010000001.1and 1 other:

NZ_JAHUVY010000001.1 Lanthipeptides: allorf_0075041_0075244_lanthipeptide

Lanthipeptides: allorf_0075041_0075244_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

R G SPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

6

RDGPPSPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

44

79.5%

NZ_CP079112.1and 1 other:

NZ_CP079112.1 Lanthipeptides: allorf_0069403_0069606_lanthipeptide

Lanthipeptides: allorf_0069403_0069606_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

R G SPPCGWA TPPRGHSGTGMPVREGVDKSLRALRS

6

RDGPPSPPCGWAPTPPRGHSGTGMPVREGVDKSLRALRS

44

77.3%

NZ_CP014485.1and 1 other:

NZ_CP014485.1 Lanthipeptides: allorf_7106951_7107154_lanthipeptide

Lanthipeptides: allorf_7106951_7107154_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

R G SPPCGWA TPPRG SGTGMPVREGVDKSLRALRS

6

RDGPPSPPCGWAPTPPRGPSGTGMPVREGVDKSLRALRS

44

20.5%

NZ_CP096021.1:

Lanthipeptides: allorf_398794_398988_lanthipeptide

16

PRGHS-GTGMPVREGVDKSLR

35

PR ++ G G+P+R S+R

3

PRIYNYGIGLPLRSAATVSIR

23

14.3%

NZ_JADKRR010000001.1:

Lanthipeptides: allorf_2139761_2139970_lanthipeptide

10

GWARTPPRGHSGTGMP

25

GW RTP H T P

22

GWPRTPMTAHRTTAAP

37

Lanthipeptide(s) for FRZ02_RS22545

allorf_1079300_1079488

Leader:

MGDGGTWGSGPHLSWRARRGPGG

Core:

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

Core with dehydrations:

RAGDhbADhaPPCysGWARDhbPPRGHDhaGDhbGMPVREGVDKDhaLRALRDha

antiSMASH-DB 4.0 matches for allorf_1079300_1079488

100.0%

NZ_AP025692.1and 6 others:

NZ_AP025692.1 Lanthipeptides: allorf_0069478_0069666_lanthipeptideNZ_CP056773.1 Lanthipeptides: allorf_6887512_6887700_lanthipeptideNZ_CP056773.1 Lanthipeptides: allorf_6887512_6887700_lanthipeptideNZ_OX371412.1 Lanthipeptides: allorf_0056080_0056268_lanthipeptideNZ_VOGX01000034.1 Lanthipeptides: allorf_1079300_1079488_lanthipeptideNZ_VOGX01000034.1 Lanthipeptides: allorf_1079300_1079488_lanthipeptide

Lanthipeptides: allorf_0069478_0069666_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

97.4%

NZ_CP047147.1and 1 other:

NZ_CP047147.1 Lanthipeptides: allorf_0132945_0133133_lanthipeptide

Lanthipeptides: allorf_0132945_0133133_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

RAGTASPPCGWA TPPRGHSGTGMPVREGVDKSLRALRS

1

RAGTASPPCGWAPTPPRGHSGTGMPVREGVDKSLRALRS

39

94.9%

NZ_KB890710.1and 1 other:

NZ_KB890710.1 Lanthipeptides: allorf_068944_069132_lanthipeptide

Lanthipeptides: allorf_068944_069132_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

R GTASPPCGWA TPPRGHSGTGMPVREGVDKSLRALRS

1

RPGTASPPCGWAPTPPRGHSGTGMPVREGVDKSLRALRS

39

with 5 more sequence matches

81.8%

NZ_JAHUVY010000001.1and 1 other:

NZ_JAHUVY010000001.1 Lanthipeptides: allorf_0075041_0075244_lanthipeptide

Lanthipeptides: allorf_0075041_0075244_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

R G SPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

6

RDGPPSPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

44

79.5%

NZ_CP079112.1and 1 other:

NZ_CP079112.1 Lanthipeptides: allorf_0069403_0069606_lanthipeptide

Lanthipeptides: allorf_0069403_0069606_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

R G SPPCGWA TPPRGHSGTGMPVREGVDKSLRALRS

6

RDGPPSPPCGWAPTPPRGHSGTGMPVREGVDKSLRALRS

44

77.3%

NZ_CP014485.1and 1 other:

NZ_CP014485.1 Lanthipeptides: allorf_7106951_7107154_lanthipeptide

Lanthipeptides: allorf_7106951_7107154_lanthipeptide

1

RAGTASPPCGWARTPPRGHSGTGMPVREGVDKSLRALRS

39

R G SPPCGWA TPPRG SGTGMPVREGVDKSLRALRS

6

RDGPPSPPCGWAPTPPRGPSGTGMPVREGVDKSLRALRS

44

20.5%

NZ_CP096021.1:

Lanthipeptides: allorf_398794_398988_lanthipeptide

16

PRGHS-GTGMPVREGVDKSLR

35

PR ++ G G+P+R S+R

3

PRIYNYGIGLPLRSAATVSIR

23

14.3%

NZ_JADKRR010000001.1:

Lanthipeptides: allorf_2139761_2139970_lanthipeptide

10

GWARTPPRGHSGTGMP

25

GW RTP H T P

22

GWPRTPMTAHRTTAAP

37

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

FRZ02_RS22270: PT_FPPS_like

Domain 1 (80 - 367): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.29 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.49 out of 30.12

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (23):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.40 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.58 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.31 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.11 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.77 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.63 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.72 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.01 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.65 out of 29.65

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.09 out of 30.11

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.49 out of 23.43

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.16 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Core peptide predictions

allorf_1079300_1079488 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 3945.1 Da

Molecular weight: 3947.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3965.5 Da N = 1; 3983.5 Da N = 2; 4001.5 Da N = 3; 4019.5 Da N = 4; 4037.5 Da N = 5; 4055.6 Da N = 6

allorf_1079300_1079488 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 3945.1 Da

Molecular weight: 3947.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3965.5 Da N = 1; 3983.5 Da N = 2; 4001.5 Da N = 3; 4019.5 Da N = 4; 4037.5 Da N = 5; 4055.6 Da N = 6

Predicted core structure(s)

For candidate cluster 5, location 877543 - 1149744:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - pk - ohmal - ohmal - ohmal) + (redmal - redmal - ohmal - redmal) + (ccmal) + (Me-ohmal - Me-redmal - Me-ccmal) + (ccmal - ccmal - ccmal - ccmal - ccmal - ccmal) + (X - mal) + (mal) + (Thr - fatty_acid) + (Acetyl-CoA - mal - Pro) + (Gly) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 877543 - 1032792:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - pk - ohmal - ohmal - ohmal) + (redmal - redmal - ohmal - redmal) + (ccmal) + (Me-ohmal - Me-redmal - Me-ccmal) + (ccmal - ccmal - ccmal - ccmal - ccmal - ccmal) + (X - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 1031368 - 1097705:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - mal - Pro) + (Thr - fatty_acid) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 1085382 - 1149744:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS22305: mal - mal - pk - mal - mal - mal

PKS_AT (558..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.6
inactive: 91.1
Methoxymalonyl-CoA: 52.8
Methylmalonyl-CoA: 42.8
Isobutyryl-CoA: 27.8
Propionyl-CoA: 26.7
Ethylmalonyl-CoA: 20.5
Benzoyl-CoA: 20.3
Acetyl-CoA: 17.4
2-Methylbutyryl-CoA: 16.2
CHC-CoA: 13.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2311..2618): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.9
inactive: 103.3
Methoxymalonyl-CoA: 57.9
Methylmalonyl-CoA: 45.5
Propionyl-CoA: 34.7
Acetyl-CoA: 21.2
Isobutyryl-CoA: 20.3
Benzoyl-CoA: 16.9
2-Methylbutyryl-CoA: 16.4
fatty_acid: 7.4
CHC-CoA: 7.3
Ethylmalonyl-CoA: 6.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3870..4167): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 224.9
Methylmalonyl-CoA: 223.8
Methoxymalonyl-CoA: 181.4
2-Methylbutyryl-CoA: 163.1
trans-1,2-CPDA: 134.0
Propionyl-CoA: 118.2
CHC-CoA: 117.5
Malonyl-CoA: 109.9
Isobutyryl-CoA: 84.8
Benzoyl-CoA: 67.1
Acetyl-CoA: 52.7
3-Methylbutyryl-CoA: 37.3
inactive: 32.4
fatty_acid: 31.4

PKS_AT (5406..5713): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.1
inactive: 112.2
Methoxymalonyl-CoA: 61.9
Methylmalonyl-CoA: 54.9
Propionyl-CoA: 21.6
Isobutyryl-CoA: 16.8
Ethylmalonyl-CoA: 13.8
Acetyl-CoA: 13.6
Benzoyl-CoA: 10.6
fatty_acid: 9.6
CHC-CoA: 9.0
3-Methylbutyryl-CoA: 6.6
trans-1,2-CPDA: 3.5
2-Methylbutyryl-CoA: -0.2

PKS_AT (6933..7232): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 238.0
inactive: 117.7
Methoxymalonyl-CoA: 64.5
Methylmalonyl-CoA: 58.6
Propionyl-CoA: 27.4
Benzoyl-CoA: 22.0
Isobutyryl-CoA: 20.3
Acetyl-CoA: 19.7
Ethylmalonyl-CoA: 15.5
fatty_acid: 15.2
CHC-CoA: 12.8
2-Methylbutyryl-CoA: 12.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8462..8763): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 226.1
inactive: 105.4
Methoxymalonyl-CoA: 65.6
Methylmalonyl-CoA: 59.3
Isobutyryl-CoA: 28.1
Ethylmalonyl-CoA: 27.7
Propionyl-CoA: 27.5
Benzoyl-CoA: 19.2
Acetyl-CoA: 18.8
fatty_acid: 17.6
CHC-CoA: 16.1
trans-1,2-CPDA: 13.0
2-Methylbutyryl-CoA: 11.0
3-Methylbutyryl-CoA: 0.0

FRZ02_RS22310: mal - mal - mal - mal

PKS_AT (551..846): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.9
inactive: 116.1
Methoxymalonyl-CoA: 63.1
Methylmalonyl-CoA: 56.5
Isobutyryl-CoA: 27.3
Propionyl-CoA: 24.2
Benzoyl-CoA: 22.9
Acetyl-CoA: 21.2
Ethylmalonyl-CoA: 14.7
fatty_acid: 11.4
2-Methylbutyryl-CoA: 8.7
CHC-CoA: 8.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2593..2892): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.6
inactive: 93.9
Methoxymalonyl-CoA: 61.5
Methylmalonyl-CoA: 51.7
Benzoyl-CoA: 23.4
Ethylmalonyl-CoA: 20.0
Isobutyryl-CoA: 18.8
Acetyl-CoA: 18.7
fatty_acid: 15.9
Propionyl-CoA: 14.8
CHC-CoA: 12.2
2-Methylbutyryl-CoA: 10.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4636..4932): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.8
inactive: 115.5
Methoxymalonyl-CoA: 69.4
Methylmalonyl-CoA: 62.0
Propionyl-CoA: 37.0
Isobutyryl-CoA: 28.6
Ethylmalonyl-CoA: 23.0
Benzoyl-CoA: 22.7
fatty_acid: 20.8
Acetyl-CoA: 19.9
CHC-CoA: 17.3
2-Methylbutyryl-CoA: 16.9
trans-1,2-CPDA: 10.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (6163..6461): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 217.7
inactive: 109.7
Methoxymalonyl-CoA: 61.5
Methylmalonyl-CoA: 53.3
Propionyl-CoA: 23.8
Acetyl-CoA: 21.2
Benzoyl-CoA: 19.3
2-Methylbutyryl-CoA: 18.9
CHC-CoA: 18.1
Ethylmalonyl-CoA: 17.5
Isobutyryl-CoA: 16.0
fatty_acid: 14.7
trans-1,2-CPDA: 9.3
3-Methylbutyryl-CoA: 0.0

FRZ02_RS22315: mal

PKS_AT (547..843): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.8
inactive: 116.5
Methoxymalonyl-CoA: 58.9
Methylmalonyl-CoA: 54.5
Propionyl-CoA: 25.1
Isobutyryl-CoA: 22.7
Acetyl-CoA: 19.6
Benzoyl-CoA: 17.0
fatty_acid: 14.7
CHC-CoA: 10.3
Ethylmalonyl-CoA: 9.8
2-Methylbutyryl-CoA: 8.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

FRZ02_RS22320: mmal - mmal - mmal

PKS_AT (573..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 215.1
Ethylmalonyl-CoA: 210.1
Methoxymalonyl-CoA: 166.3
2-Methylbutyryl-CoA: 152.5
trans-1,2-CPDA: 124.8
Propionyl-CoA: 117.5
Malonyl-CoA: 96.3
CHC-CoA: 91.4
Isobutyryl-CoA: 68.9
Benzoyl-CoA: 63.6
Acetyl-CoA: 47.6
fatty_acid: 40.6
inactive: 38.7
3-Methylbutyryl-CoA: 33.0

PKS_AT (2141..2438): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 215.1
Ethylmalonyl-CoA: 210.1
Methoxymalonyl-CoA: 166.3
2-Methylbutyryl-CoA: 152.5
trans-1,2-CPDA: 124.8
Propionyl-CoA: 117.5
Malonyl-CoA: 96.3
CHC-CoA: 91.4
Isobutyryl-CoA: 68.9
Benzoyl-CoA: 63.6
Acetyl-CoA: 47.6
fatty_acid: 40.6
inactive: 38.7
3-Methylbutyryl-CoA: 33.0

PKS_AT (4248..4545): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.1
Ethylmalonyl-CoA: 202.9
Methoxymalonyl-CoA: 169.3
2-Methylbutyryl-CoA: 131.7
trans-1,2-CPDA: 129.8
Propionyl-CoA: 108.2
Malonyl-CoA: 103.0
CHC-CoA: 98.2
Isobutyryl-CoA: 71.5
Benzoyl-CoA: 57.5
Acetyl-CoA: 41.0
inactive: 38.2
fatty_acid: 30.1
3-Methylbutyryl-CoA: 28.7

FRZ02_RS22325: mal - mal - mal - mal - mal - mal

PKS_AT (578..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 234.1
inactive: 108.7
Methoxymalonyl-CoA: 58.8
Methylmalonyl-CoA: 53.6
Propionyl-CoA: 34.6
Acetyl-CoA: 22.8
Isobutyryl-CoA: 21.7
Benzoyl-CoA: 18.6
Ethylmalonyl-CoA: 18.4
trans-1,2-CPDA: 16.5
2-Methylbutyryl-CoA: 13.3
fatty_acid: 11.9
CHC-CoA: 4.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (2320..2612): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.7
inactive: 109.8
Methoxymalonyl-CoA: 58.6
Methylmalonyl-CoA: 47.8
Propionyl-CoA: 27.9
Isobutyryl-CoA: 21.1
Benzoyl-CoA: 20.6
Acetyl-CoA: 20.2
Ethylmalonyl-CoA: 14.6
2-Methylbutyryl-CoA: 12.3
fatty_acid: 11.3
trans-1,2-CPDA: 9.4
CHC-CoA: 5.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4060..4350): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.7
inactive: 101.4
Methoxymalonyl-CoA: 52.7
Methylmalonyl-CoA: 48.9
Acetyl-CoA: 26.2
Propionyl-CoA: 22.0
Benzoyl-CoA: 14.2
Isobutyryl-CoA: 14.0
fatty_acid: 10.0
2-Methylbutyryl-CoA: 9.0
CHC-CoA: 8.7
Ethylmalonyl-CoA: 8.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5782..6074): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 228.9
inactive: 112.2
Methoxymalonyl-CoA: 56.4
Methylmalonyl-CoA: 53.7
Propionyl-CoA: 31.4
Acetyl-CoA: 24.0
Benzoyl-CoA: 19.8
trans-1,2-CPDA: 18.6
Isobutyryl-CoA: 18.2
Ethylmalonyl-CoA: 17.1
2-Methylbutyryl-CoA: 13.3
fatty_acid: 11.6
CHC-CoA: 3.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (7497..7788): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.5
inactive: 96.2
Methoxymalonyl-CoA: 55.8
Methylmalonyl-CoA: 47.6
Propionyl-CoA: 29.7
Acetyl-CoA: 19.8
Isobutyryl-CoA: 18.5
Ethylmalonyl-CoA: 16.3
Benzoyl-CoA: 14.5
trans-1,2-CPDA: 10.2
2-Methylbutyryl-CoA: 8.7
fatty_acid: 8.2
CHC-CoA: 1.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (9341..9630): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.5
inactive: 89.0
Methoxymalonyl-CoA: 40.7
Methylmalonyl-CoA: 40.0
Propionyl-CoA: 29.0
Acetyl-CoA: 25.1
Ethylmalonyl-CoA: 16.8
Isobutyryl-CoA: 9.8
Benzoyl-CoA: 9.8
2-Methylbutyryl-CoA: 6.6
CHC-CoA: 2.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

FRZ02_RS22340: X - mal

AMP-binding (31..440): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAALF--GLQSSVALTAGAVVVWGMSEAGNGTSS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

PKS_AT (1204..1498): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.8
inactive: 90.1
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 57.1
Isobutyryl-CoA: 48.8
Ethylmalonyl-CoA: 32.4
Acetyl-CoA: 31.3
Propionyl-CoA: 30.1
2-Methylbutyryl-CoA: 23.2
Benzoyl-CoA: 20.3
fatty_acid: 19.8
CHC-CoA: 11.2
trans-1,2-CPDA: 11.0
3-Methylbutyryl-CoA: 7.4

FRZ02_RS22480: X

AMP-binding (7..402): X

nrpys: Pyv, Ant

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IGWCHGSMVVSTWMLYGAARQVYGMTEVGGFVTL
Nearest Stachelhaus code(s):: Pyv or Ant GSVWLGVGFK (100% 8Å match); Ant GSVWLGVGFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

FRZ02_RS22490: mal

PKS_AT (543..825): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 125.5
inactive: 68.7
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 39.2
Ethylmalonyl-CoA: 23.7
Propionyl-CoA: 23.3
Isobutyryl-CoA: 15.1
Benzoyl-CoA: 13.3
Acetyl-CoA: 10.3
fatty_acid: 9.4
2-Methylbutyryl-CoA: 3.8
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

FRZ02_RS22495: Thr - fatty_acid

Search NORINE for peptide: strict or relaxed

AMP-binding (461..875): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LASHFDFSVWEGNQVLGGEVNMYGITETTVHVTF
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CAL_domain (1710..2121): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 16.7
Acetyl-CoA: 13.5
AHBA: 6.5
NH2: 1.5
shikimic_acid: 0.0

FRZ02_RS22515: Acetyl-CoA - mal - Pro

Search NORINE for peptide: strict or relaxed

CAL_domain (54..488): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 22.3
AHBA: 20.2
fatty_acid: 13.9
NH2: 12.8
shikimic_acid: 0.0

PKS_AT (1197..1479): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 58.3%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 92.8
inactive: 47.1
Methylmalonyl-CoA: 41.2
Methoxymalonyl-CoA: 35.1
Propionyl-CoA: 28.3
fatty_acid: 24.5
2-Methylbutyryl-CoA: 19.9
CHC-CoA: 18.9
Ethylmalonyl-CoA: 18.8
Benzoyl-CoA: 13.9
trans-1,2-CPDA: 12.0
Isobutyryl-CoA: 11.4
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (2584..2978): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LGHTFDVSVQETFMYSAGEYNQYGPTETSVIVTS
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

FRZ02_RS22620: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (567..948): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGITFDISLLELQALSGGEWNLYGPTEATVWASS
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

FRZ02_RS22625: mal

PKS_AT (133..422): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 119.4
inactive: 71.1
Methylmalonyl-CoA: 56.2
Methoxymalonyl-CoA: 55.5
Propionyl-CoA: 28.2
Ethylmalonyl-CoA: 26.3
Isobutyryl-CoA: 24.6
Benzoyl-CoA: 17.1
fatty_acid: 15.8
2-Methylbutyryl-CoA: 9.0
CHC-CoA: 8.0
trans-1,2-CPDA: 4.8
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

FRZ02_RS22640: mal

PKS_AT (1675..1971): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Isobutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 134.8
Methoxymalonyl-CoA: 54.5
inactive: 54.4
Methylmalonyl-CoA: 50.0
Propionyl-CoA: 41.7
fatty_acid: 26.7
Isobutyryl-CoA: 22.2
Ethylmalonyl-CoA: 19.2
Benzoyl-CoA: 9.5
2-Methylbutyryl-CoA: 9.0
Acetyl-CoA: 8.3
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_VOGX01000001.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 272,571 - 322,860 nt. (total: 50,290 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

FRZ02_RS01365: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: protease

FRZ02_RS01415: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.22 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.57 out of 27.04

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (15):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.39 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.91 out of 20.01

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.80 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.81 out of 39.62

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.64 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.22 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.05 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.09 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 272570 - 322860:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Orn - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS01365: X - Orn - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (469..866): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDASWDPWETALGGELNYYGPTETTVDAVT
Nearest Stachelhaus code(s):: Lys DADDAGTVDK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1523..1921): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDASWDPWETALGGEWNLYGPTEATVDALV
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (76% 8Å match); Lys DADDAGTVDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2582..2976): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHLFDAAWDPWETALGGELNLYGPTEATVDTLT
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (68% 8Å match); Lys DADDAGTVDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_VOGX01000054.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 296,676 - 341,070 nt. (total: 44,395 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FRZ02_RS25780: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FRZ02_RS25805: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Hydrolases: esterase hydrolase

FRZ02_RS25740: putative esterase

smcogs: SMCOG1104: putative esterase

FRZ02_RS25850: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: lyase

FRZ02_RS25770: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

FRZ02_RS25775: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

FRZ02_RS25750: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

FRZ02_RS25785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FRZ02_RS25825: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.00 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

Additional weak hits (11):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.32 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.74 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.18 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.00 out of 18.57

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.65 out of 19.26

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.47 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.58 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.31 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.99 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 296675 - 341070:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS25785: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (21..432): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YSLTADLGNTCLKTLLGGEVNHYGPTETTVGVAA
Nearest Stachelhaus code(s):: Asp DLTKVGHVGK (71% 8Å match); OH-Asp DLTKVGHVGK (68% 8Å match); Asn DLTKLGEVGK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_VOGX01000054.1 - Region 2 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 560,163 - 587,295 nt. (total: 27,133 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FRZ02_RS26945: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

FRZ02_RS26975: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FRZ02_RS27000: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: decarboxylase

FRZ02_RS26950: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Translocases: transporter

FRZ02_RS26870: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.78	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.71	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.71	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.53	other (other)	bisucaberin B	Tenacibaculum mesophilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.78	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.71	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.71	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.53	other (other)	bisucaberin B	Tenacibaculum mesophilum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 26.85

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 36.53 out of 36.53

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.65 out of 23.43

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.62 out of 36.53

Confidence: medium

Additional weak hits (17):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.86 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.45 out of 21.55

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.23 out of 36.54

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.57 out of 23.43

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.75 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.10 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.36 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.33 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.57 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.87 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.08 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.33 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_VOGX01000061.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 29,317 nt. (total: 29,317 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FRZ02_RS30645: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Ligases: ligase synthase

FRZ02_RS30625: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FRZ02_RS30635: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FRZ02_RS30655: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

FRZ02_RS30705: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001574.5	0.63	NRPS	SF2768	Streptomyces thioluteus
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001250.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.62	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001574.5	0.63	NRPS	SF2768	Streptomyces thioluteus
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001250.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.62	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.55 out of 18.46

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (3):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.15 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.42 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 29317:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS30625: X

AMP-binding (468..855): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGAAFDTSIEELDLIIGGEVNTYGPTEGTVVATA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

FRZ02_RS30635: X

AMP-binding (26..424): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IAMI-GFHIGGWCVVYGGSAQIYGLTETGNTAVC
Nearest Stachelhaus code(s):: Val DFFCVGIVHK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
RpoN	Regulator of nitrogen assimilation and virulence

NZ_VOGX01000074.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 8,672 nt. (total: 8,672 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

FRZ02_RS31000: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase

FRZ02_RS31005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002295.3	0.62	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002295.3	0.62	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 8672:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS31005: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (20..420): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: QWLTFDAAQWEAQGFSGGEVNLYGPTETTINATS
Nearest Stachelhaus code(s):: Gln DAWQFGLINK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_VOGX01000092.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 57,649 - 80,234 nt. (total: 22,586 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FRZ02_RS31645: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: hydrolase

FRZ02_RS31630: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.81	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.80	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.66	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.63	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.56	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.81	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.80	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.66	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.63	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.56	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for FRZ02_RS31605

FRZ02_RS31600

Leader:

MALLDLQAMDTPQEEAVGDLAT

Core:

GSQISLLICEYSSLSVTLCTP

Core with dehydrations:

GDhaQIDhaLLICysEYDhaDhaLDhaVDhbLCysDhbP

antiSMASH-DB 4.0 matches for FRZ02_RS31600

100.0%

NC_020990.1and 26 others:

NZ_AMPN02000002.1 Lanthipeptides: SM8_RS12785_lanthipeptideNZ_AP025692.1 Lanthipeptides: MTP06_RS18190_lanthipeptideNZ_CM002273.1 Lanthipeptides: B590_RS12280_lanthipeptideNZ_CP009802.1 Lanthipeptides: SFR_RS12925_lanthipeptideNZ_CP014485.1 Lanthipeptides: Salbus254_RS12710_lanthipeptideNZ_CP016824.1 Lanthipeptides: BEN82_RS18165_lanthipeptideNZ_CP026490.1 Lanthipeptides: C3K23_RS19520_lanthipeptideNZ_CP031742.1 Lanthipeptides: D0C37_RS13445_lanthipeptideNZ_CP047147.1 Lanthipeptides: GR131_RS18520_lanthipeptideNZ_CP053539.1 Lanthipeptides: HN026_RS11800_lanthipeptideNZ_CP056773.1 Lanthipeptides: HWN34_RS12245_lanthipeptideNZ_CP063844.1 Lanthipeptides: IPZ55_RS12410_lanthipeptideNZ_CP064783.1 Lanthipeptides: IT782_RS12060_lanthipeptideNZ_CP076385.1 Lanthipeptides: KNZ81_RS12450_lanthipeptideNZ_CP079112.1 Lanthipeptides: STALF2_RS18135_lanthipeptideNZ_CP091820.1 Lanthipeptides: L2I08_RS02835_lanthipeptideNZ_CP106650.1 Lanthipeptides: B591_RS12385_lanthipeptideNZ_CP113103.1 Lanthipeptides: OSU72_RS17905_lanthipeptideNZ_JAHUVY010000001.1 Lanthipeptides: STALF3_RS17905_lanthipeptideNZ_JALLPQ010000001.1 Lanthipeptides: MWG58_RS12385_lanthipeptideNZ_KB890715.1 Lanthipeptides: B048_RS0115750_lanthipeptideNZ_KN549183.1 Lanthipeptides: D076_RS30740_lanthipeptideNZ_KZ195583.1 Lanthipeptides: B9W68_RS12440_lanthipeptideNZ_MNPQ01000004.1 Lanthipeptides: BGV78_RS11170_lanthipeptideNZ_OX371412.1 Lanthipeptides: OZE77_RS18215_lanthipeptideNZ_VOGX01000092.1 Lanthipeptides: FRZ02_RS31600_lanthipeptide

Lanthipeptides: XNR_RS11575_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQISLLICEYSSLSVTLCTP

1

GSQISLLICEYSSLSVTLCTP

21

95.2%

NZ_CM001165.1and 4 others:

NZ_CP021118.1 Lanthipeptides: CAC01_RS28155_lanthipeptideNZ_CP049945.1 Lanthipeptides: G9U55_RS17850_lanthipeptideNZ_CP119149.1 Lanthipeptides: P0D76_RS02270_lanthipeptideNZ_RWGV01000033.1 Lanthipeptides: EJA11_RS20985_lanthipeptide

Lanthipeptides: STTU_RS29395_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICEYSSLSVTLCTP

1

GSQVSLLICEYSSLSVTLCTP

21

90.5%

NZ_BDHJ01000008.1and 4 others:

NZ_CP032543.1 Lanthipeptides: D6270_RS22715_lanthipeptideNZ_CP076457.1 Lanthipeptides: KME66_RS09945_lanthipeptideNZ_CP077652.1 Lanthipeptides: KRR37_RS22855_lanthipeptideNZ_WUEJ01000001.1 Lanthipeptides: GRQ63_RS04560_lanthipeptide

Lanthipeptides: BHQ08_RS03045_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSVTLCTP

1

GSQVSLLVCEYSSLSVTLCTP

21

with 70 more sequence matches

Only the first 10 are displayed here.

90.5%

NZ_CP045178.1:

Lanthipeptides: GBW32_RS28450_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICEYSSLSV LCTP

1

GSQVSLLICEYSSLSVVLCTP

21

90.5%

NZ_ML123034.1:

Lanthipeptides: EES43_RS19795_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICE+SSLSVTLCTP

1

GSQVSLLICEFSSLSVTLCTP

21

85.7%

NC_010572.1and 60 others:

NC_021177.1 Lanthipeptides: SFUL_RS24355_lanthipeptideNZ_AQRK01000102.1 Lanthipeptides: YUW_RS30025_lanthipeptideNZ_ARPF01000003.1 Lanthipeptides: B083_RS0107255_lanthipeptideNZ_BMRY01000001.1 Lanthipeptides: IE140_RS02070_lanthipeptideNZ_BMSP01000003.1 Lanthipeptides: IE150_RS06495_lanthipeptideNZ_BMSZ01000003.1 Lanthipeptides: IE135_RS07550_lanthipeptideNZ_BMTW01000017.1 Lanthipeptides: IE134_RS28550_lanthipeptideNZ_BMUG01000009.1 Lanthipeptides: IE264_RS25430_lanthipeptideNZ_BMVK01000002.1 Lanthipeptides: IE272_RS07115_lanthipeptideNZ_BNBJ01000002.1 Lanthipeptides: IE304_RS05195_lanthipeptideNZ_CM003601.1 Lanthipeptides: JI76_RS25200_lanthipeptideNZ_CP010833.1 Lanthipeptides: TK78_RS10875_lanthipeptideNZ_CP011522.1 Lanthipeptides: ABE83_RS11805_lanthipeptideNZ_CP013738.1 Lanthipeptides: WQO_RS23525_lanthipeptideNZ_CP015362.1 Lanthipeptides: A6E92_RS09975_lanthipeptideNZ_CP020563.1 Lanthipeptides: B7C62_RS24450_lanthipeptideNZ_CP020570.1 Lanthipeptides: B1H20_RS34690_lanthipeptideNZ_CP024957.1 Lanthipeptides: CVT27_RS22730_lanthipeptideNZ_CP029361.1 Lanthipeptides: DIJ69_RS10225_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS22865_lanthipeptideNZ_CP061072.1 Lanthipeptides: HYC88_RS10560_lanthipeptideNZ_CP079114.1 Lanthipeptides: KV381_RS24895_lanthipeptideNZ_CP084357.1 Lanthipeptides: LEL86_RS29435_lanthipeptideNZ_CP086102.1 Lanthipeptides: LK895_RS11660_lanthipeptideNZ_CP090837.1 Lanthipeptides: LZ559_RS24025_lanthipeptideNZ_CP096281.1 Lanthipeptides: MWG59_RS25685_lanthipeptideNZ_CP101397.1 Lanthipeptides: NLU04_RS06465_lanthipeptideNZ_CP110539.1 Lanthipeptides: OH133_RS12690_lanthipeptideNZ_CP112880.1 Lanthipeptides: N7925_RS11185_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS22935_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS24530_lanthipeptideNZ_DS999644.1 Lanthipeptides: SSGG_RS09925_lanthipeptideNZ_GL877172.1 Lanthipeptides: SACT1_RS12960_lanthipeptideNZ_JAAWWP010000002.1 Lanthipeptides: HFV08_RS04115_lanthipeptideNZ_JAGGOV010000004.1 Lanthipeptides: J7E92_RS02930_lanthipeptideNZ_JAHHWT010000009.1 Lanthipeptides: KM153_RS24430_lanthipeptideNZ_JALDPQ010000064.1 Lanthipeptides: MQC87_RS23965_lanthipeptideNZ_JAMFLF010000002.1 Lanthipeptides: M1212_RS07295_lanthipeptideNZ_JANRMN010000004.1 Lanthipeptides: NW249_RS08610_lanthipeptideNZ_JNLT01000003.1 Lanthipeptides: CD02_RS0108685_lanthipeptideNZ_KB890925.1 Lanthipeptides: B053_RS0113845_lanthipeptideNZ_KL573549.1 Lanthipeptides: BG84_RS0119125_lanthipeptideNZ_KQ257779.1 Lanthipeptides: IQ60_RS22540_lanthipeptideNZ_KZ195572.1 Lanthipeptides: B9W61_RS11940_lanthipeptideNZ_KZ679082.1 Lanthipeptides: C6W96_RS24050_lanthipeptideNZ_KZ819154.1 Lanthipeptides: DBP12_RS10285_lanthipeptideNZ_KZ819178.1 Lanthipeptides: DBP20_RS23960_lanthipeptideNZ_KZ819182.1 Lanthipeptides: DBP21_RS24660_lanthipeptideNZ_LACR01000009.1 Lanthipeptides: YW5_RS12280_lanthipeptideNZ_LIPB01000001.1 Lanthipeptides: AMK17_RS03280_lanthipeptideNZ_LIPE01000001.1 Lanthipeptides: AMK12_RS03355_lanthipeptideNZ_LIVT01000001.1 Lanthipeptides: AMK24_RS01700_lanthipeptideNZ_LIVW01000001.1 Lanthipeptides: AMK28_RS03165_lanthipeptideNZ_LIXK01000001.1 Lanthipeptides: AMK23_RS04085_lanthipeptideNZ_LMEL01000012.1 Lanthipeptides: ASD29_RS10010_lanthipeptideNZ_LZRD01000054.1 Lanthipeptides: A3Q37_RS33745_lanthipeptideNZ_ML123117.1 Lanthipeptides: EES46_RS10300_lanthipeptideNZ_NNBN01000004.1 Lanthipeptides: CG717_RS12310_lanthipeptideNZ_VEHK01000004.1 Lanthipeptides: FS984_RS13530_lanthipeptideNZ_WWGD01000029.1 Lanthipeptides: GTY72_RS23245_lanthipeptide

Lanthipeptides: SGR_RS11800_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSV LCTP

1

GSQVSLLVCEYSSLSVVLCTP

21

85.7%

NZ_LWLE01000019.1:

Lanthipeptides: A6A29_RS44250_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICE+SSLS+TLCTP

1

GSQVSLLICEHSSLSLTLCTP

21

81.0%

NZ_CP010519.1and 1 other:

NZ_CP092644.1 Lanthipeptides: MID12_RS21330_lanthipeptide

Lanthipeptides: SLNWT_RS22370_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSV LC+P

1

GSQVSLLVCEYSSLSVVLCSP

21

81.0%

NZ_CP045702.1:

Lanthipeptides: F0344_RS33200_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CE+SSLS+TLCTP

1

GSQVSLLVCEHSSLSLTLCTP

21

81.0%

NZ_CP054926.1and 11 others:

NZ_CP068598.1 Lanthipeptides: IFE09_RS23820_lanthipeptideNZ_CP071044.1 Lanthipeptides: JHY03_RS23495_lanthipeptideNZ_CP080029.1 Lanthipeptides: KZO11_RS24935_lanthipeptideNZ_JAJUKK010000008.1 Lanthipeptides: LXH09_RS27635_lanthipeptideNZ_JOJC01000009.1 Lanthipeptides: IO23_RS0108435_lanthipeptideNZ_KB891296.1 Lanthipeptides: B061_RS0103425_lanthipeptideNZ_KZ268499.1 Lanthipeptides: CE422_RS23450_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS22830_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS10975_lanthipeptideNZ_LZQS01000001.1 Lanthipeptides: STIB_RS05225_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS24840_lanthipeptide

Lanthipeptides: HUT09_RS23550_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CE+SSLSV LCTP

1

GSQVSLLVCEFSSLSVVLCTP

21

81.0%

NZ_CP058556.1and 5 others:

NZ_CP059898.1 Lanthipeptides: H3V39_RS22935_lanthipeptideNZ_CP070242.1 Lanthipeptides: I6J39_RS23755_lanthipeptideNZ_CP070260.1 Lanthipeptides: I6J40_RS10935_lanthipeptideNZ_JAJDST010000047.1 Lanthipeptides: LJC81_RS16960_lanthipeptideNZ_WWGL01000003.1 Lanthipeptides: GTY38_RS03410_lanthipeptide

Lanthipeptides: HXS80_RS11105_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+S+L+CEYSSLSV LCTP

1

GSQVSVLVCEYSSLSVVLCTP

21

76.2%

NZ_AQRJ01000051.1and 1 other:

NZ_LFBV01000002.1 Lanthipeptides: AB852_RS09920_lanthipeptide

Lanthipeptides: YW7_RS14945_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SL++CEYSSLS LCTP

1

GSQVSLIVCEYSSLSALLCTP

21

66.7%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

1

GSQISLLICEYSSLSVTLCT

20

GSQ SLL+C SSLSVT C

2

GSQASLLLCGDSSLSVTTCN

21

MIBiG 4.0 matches for FRZ02_RS31600

81.8%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSV LCTP

2

GSQVSLLVCEYSSLSVVLCTP

22

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

Additional weak hits (6):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.62 out of 27.04

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.35 out of 20.01

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.30 out of 18.57

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.07 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.11 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.71 out of 26.06

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

FRZ02_RS31600 - Class III

Cleavage pHMM score: 30.10

RODEO score: 0

Monoisotopic mass: 2087.1 Da

Molecular weight: 2088.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2106.4 Da N = 1; 2124.5 Da N = 2; 2142.5 Da N = 3; 2160.5 Da N = 4; 2178.5 Da N = 5

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_VOGX01000092.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 106,545 - 167,029 nt. (total: 60,485 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

FRZ02_RS31955: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acetyltransferase aminotransferase

FRZ02_RS31860: aminotransferase

smcogs: SMCOG1019: aminotransferase

FRZ02_RS31865: aminotransferase

smcogs: SMCOG1019: aminotransferase

FRZ02_RS31900: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

FRZ02_RS31970: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

FRZ02_RS31880: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Isomerases: mutase

FRZ02_RS31930: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase

FRZ02_RS31885: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FRZ02_RS31890: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.67	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.67	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.16 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.93 out of 30.25

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.45 out of 27.04

Confidence: strong

Additional weak hits (15):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.84 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.20 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.24 out of 29.51

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.87 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.80 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.30 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.43 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.89 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.08 out of 27.18

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.46 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.23 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.15 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 106544 - 167029:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - D-Leu) + (D-X - X - D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FRZ02_RS31885: X - X - X

AMP-binding (518..914): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDAAFYETTLAVAGEFNAYGPTETTVCATV
Nearest Stachelhaus code(s):: Tyr DASTAAAVCK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2031..2438): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MAWSVDLFFADLVTLVGSEANAYGSTETTVDSTA
Nearest Stachelhaus code(s):: ohEnd DLSVMGAVDK (88% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3094..3501): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LEHAFDSSVVGVEIVLGGEENTYGPTECTVETLY
Nearest Stachelhaus code(s):: Dhpg DGLSVGTVMK (62% 8Å match); Arg DSDDVGAVDK (53% 8Å match); Gln or Tyr DAESVGTVVK (50% 8Å match); His DAVLVGEVLK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

FRZ02_RS31890: Ser - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (12..435): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSSHFDVSVWEGSQVFAGEVNMYGITETTVHASF
Nearest Stachelhaus code(s):: Ser DVWSVAMVHK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1099..1494): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDAAVWEPFLLTGGDVNNYGPTESAVVATA
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
DasR	N-acetylglucosamine dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems