GCF_007677885.1 - 5 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NZ_VEDP01000001.1 (Enterococcus casseliflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	terpene	568,204	589,127
Region 7.2	terpene-precursor	628,359	649,255

NZ_VEDP01000003.1 (Enterococcus casseliflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	lanthipeptide-class-i	255,337	279,558

NZ_VEDP01000006.1 (Enterococcus casseliflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	ranthipeptide	1	20,459

NZ_VEDP01000008.1 (Enterococcus casseliflavus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	T3PKS	1	38,901

Region	Type	From	To	Most similar known cluster
Region 7.1	terpene	568,204	589,127
Region 7.2	terpene-precursor	628,359	649,255
Region 9.1	lanthipeptide-class-i	255,337	279,558
Region 12.1	ranthipeptide	1	20,459
Region 14.1	T3PKS	1	38,901

No secondary metabolite regions were found in these records:: NZ_VEDP01000010.1 (Enterococcus casseliflavus); NZ_VEDP01000011.1 (Enterococcus casseliflavus); NZ_VEDP01000012.1 (Enterococcus casseliflavus); NZ_VEDP01000013.1 (Enterococcus casseliflavus); NZ_VEDP01000014.1 (Enterococcus casseliflavus); NZ_VEDP01000015.1 (Enterococcus casseliflavus); NZ_VEDP01000002.1 (Enterococcus casseliflavus); NZ_VEDP01000004.1 (Enterococcus casseliflavus); NZ_VEDP01000005.1 (Enterococcus casseliflavus); NZ_VEDP01000007.1 (Enterococcus casseliflavus); NZ_VEDP01000009.1 (Enterococcus casseliflavus)

Compact view

NZ_VEDP01000001.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 568,204 - 589,127 nt. (total: 20,924 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FS693_RS02595: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: kinase phosphotransferase

FS693_RS02575: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

FS693_RS02625: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.76	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000645.3	0.49	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000664.5	0.48	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000630.3	0.48	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0001456.3	0.48	terpene	isorenieratene	Streptomyces argillaceus
BGC0000656.5	0.47	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000635.3	0.47	terpene	carotenoid	Paracoccus sp. N81106
BGC0000633.3	0.46	terpene	carotenoid	Streptomyces avermitilis
BGC0000642.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.76	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000645.3	0.49	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000664.5	0.48	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000630.3	0.48	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0001456.3	0.48	terpene	isorenieratene	Streptomyces argillaceus
BGC0000656.5	0.47	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000635.3	0.47	terpene	carotenoid	Paracoccus sp. N81106
BGC0000633.3	0.46	terpene	carotenoid	Streptomyces avermitilis
BGC0000642.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none

Genes with terpene domains:

FS693_RS02590: PT_phytoene_like

Domain 1 (14 - 302): Prenyltransferase; Phytoene synthase like

Subtype: Diapophytoene synthase

Reactions:: FPP → diapophytoene

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.02 out of 30.25

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.08 out of 23.79

Confidence: medium

Additional weak hits (2):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.68 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.04 out of 30.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
IolR	Regulator of the inositol catabolism

NZ_VEDP01000001.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 628,359 - 649,255 nt. (total: 20,897 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: peptidase

FS693_RS02895: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Ligases: synthetase

FS693_RS02925: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000558.5	0.43	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001962.3	0.40	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000634.3	0.37	terpene	carotenoid	Brevundimonas sp. SD212

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000558.5	0.43	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001962.3	0.40	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000634.3	0.37	terpene	carotenoid	Brevundimonas sp. SD212

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

FS693_RS02925: PT_FPPS_like

Domain 1 (32 - 276): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 23.90 out of 29.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.77 out of 27.78

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.31 out of 27.78

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.38 out of 25.88

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.76 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.94 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.84 out of 29.38

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.02 out of 21.55

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.42 out of 25.88

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.38 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.37 out of 24.78

Confidence: medium

Additional weak hits (3):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.83 out of 26.12

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.13 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.62 out of 29.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
FuR variant 1	Ferric Uptake Regulator
LexA variant 2	Repressor of DNA damage response
PsrA	Oleic acid responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence
SypG	Regulator of biofilm formation and host colonization
ZuR variant 1	Zinc-responsive repressor

NZ_VEDP01000003.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 255,337 - 279,558 nt. (total: 24,222 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

FS693_RS10075: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

FS693_RS10080: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Ligases: synthase

FS693_RS10100: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001289.5	0.50	ribosomal	penisin	Paenibacillus ehimensis
BGC0000538.3	0.48	ribosomal	nisin Z	Lactococcus lactis
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.46	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000556.5	0.46	ribosomal	streptin	Streptococcus pyogenes
BGC0000515.4	0.45	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.45	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0001727.3	0.44	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000559.4	0.44	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000535.4	0.43	ribosomal	nisin A	Lactococcus lactis subsp. lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001289.5	0.50	ribosomal	penisin	Paenibacillus ehimensis
BGC0000538.3	0.48	ribosomal	nisin Z	Lactococcus lactis
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.46	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000556.5	0.46	ribosomal	streptin	Streptococcus pyogenes
BGC0000515.4	0.45	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.45	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0001727.3	0.44	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000559.4	0.44	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000535.4	0.43	ribosomal	nisin A	Lactococcus lactis subsp. lactis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for FS693_RS10075

FS693_RS10090

Leader:

MDKLFDLDVEVVKTNTQARSG

Core:

IGTLGVYCFTTGQGVMCSSGAGSHSCMTSATRCTGTQSACAILPSSLKK

Core with dehydrations:

IGDhbLGVYCysFDhbDhbGQGVMCysDhaDhaGAGDhaHDhaCysMDhbDhaADhbRCysDhbGDhbQDhaACysAILPDhaDhaLKK

antiSMASH-DB 4.0 matches for FS693_RS10090

100.0%

NZ_KE350253.1and 1 other:

NZ_VEDP01000003.1 Lanthipeptides: FS693_RS10090_lanthipeptide

Lanthipeptides: D932_RS16685_lanthipeptide

IGTLGVYCFTTGQGVMCSSGAGSHSCMTSATRCTGTQSACAILPSSLKK

18.4%

NC_005071.1:

Lanthipeptides: AKG35_RS01305_lanthipeptide

GQGVMCSSGAGSHSCMTSATRCTGTQSACAI

G GV+C +G +T + T A I

GNGVLCFTGTEEIDAITDGRKKTDFMKAKRI

17.6%

NZ_KB903814.1:

Lanthipeptides: allorf_854978_855211_lanthipeptide

CFTTGQGVMCSSGAGSHSCMTS

CF G CSSG C++S

CFPRNHGQRCSSGHSMPKCLSS

with 1 more sequence matches

13.0%

NZ_CABY01000005.1:

Lanthipeptides: SZBHS5_RS06435_lanthipeptide

GTLGVYCFTTGQ

G GVYC+ TG+

GGTGVYCWNTGK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 25.42 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.58 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.11 out of 26.06

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.18 out of 29.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.52 out of 19.52

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.15 out of 25.88

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

FS693_RS10090 - Class I

Cleavage pHMM score: 3.20

RODEO score: 22

Monoisotopic mass: 4588.2 Da

Molecular weight: 4591.3 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 4609.3 Da N = 1; 4627.3 Da N = 2; 4645.3 Da N = 3; 4663.4 Da N = 4; 4681.4 Da N = 5; 4699.4 Da N = 6; 4717.4 Da N = 7; 4735.4 Da N = 8; 4753.5 Da N = 9; 4771.5 Da N = 10

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 160 - 228; Score: 25.5

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_VEDP01000006.1 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 1 - 20,459 nt. (total: 20,459 nt) Show pHMM detection rules used

Region on contig edge.

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Translocases: transporter

FS693_RS14225: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

FS693_RS14270: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.41	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000916.5	0.40	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000495.5	0.36	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002754.2	0.29	NRPS	hectoramide B	Moorena producens JHB
BGC0000268.5	0.28	PKS	Sch-47554, Sch-47555	Streptomyces sp. SCC 2136
BGC0001011.5	0.27	NRPS, PKS	meridamycin	Streptomyces sp. NRRL 30748
BGC0001093.3	0.26	NRPS, PKS	disorazol A	Sorangium cellulosum
BGC0002657.2	0.26	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000388.5	0.26	NRPS	mannopeptimycin	Streptomyces hygroscopicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.41	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000916.5	0.40	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000495.5	0.36	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002754.2	0.29	NRPS	hectoramide B	Moorena producens JHB
BGC0000268.5	0.28	PKS	Sch-47554, Sch-47555	Streptomyces sp. SCC 2136
BGC0001011.5	0.27	NRPS, PKS	meridamycin	Streptomyces sp. NRRL 30748
BGC0001093.3	0.26	NRPS, PKS	disorazol A	Sorangium cellulosum
BGC0002657.2	0.26	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000388.5	0.26	NRPS	mannopeptimycin	Streptomyces hygroscopicus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 25.37 out of 28.14

Confidence: medium

Additional weak hits (2):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.58 out of 32.93

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 19.93 out of 30.11

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Thurincin_rSAM_RRE; Location: 31 - 81; Score: 30.6; RRE type: PqqD_RRE; Location: 28 - 87; Score: 30.3; RRE type: Subtilosin_rSAM_RRE; Location: 32 - 85; Score: 26.1

TFBS definitions

Regulator	Description
PerR	Peroxide regulator

NZ_VEDP01000008.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1 - 38,901 nt. (total: 38,901 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

FS693_RS15925: hydroxymethylglutaryl-CoA reductase

smcogs: SMCOG1187: hydroxymethylglutaryl-CoA reductase

FS693_RS15940: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: back translocase

FS693_RS15955: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Ligases: synthase

FS693_RS15920: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

FS693_RS16020: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.43	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002707.2	0.42	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000867.3	0.41	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002561.3	0.40	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0000255.5	0.40	PKS	pederin	Uncultured bacterium
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000205.3	0.40	PKS	bryostatin	Candidatus Endobugula sertula
BGC0000548.4	0.37	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000934.4	0.37	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0001080.5	0.37	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.43	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002707.2	0.42	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000867.3	0.41	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002561.3	0.40	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0000255.5	0.40	PKS	pederin	Uncultured bacterium
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000205.3	0.40	PKS	bryostatin	Candidatus Endobugula sertula
BGC0000548.4	0.37	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000934.4	0.37	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0001080.5	0.37	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.25 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.87 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 26.40 out of 27.78

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.05 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.94 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.95 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.34 out of 26.06

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.62 out of 23.79

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.86 out of 25.88

Confidence: medium

Additional weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.86 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.75 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.82 out of 26.06

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.08 out of 20.47

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.05 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.68 out of 28.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.00 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis