GCF_005146945.1 - 21 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_SWMS01000001.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRP-metallophore,NRPS	632,292	688,157	Low	peucechelin	NRPS:Type I
Region 1.2	lassopeptide	770,090	796,724

NZ_SWMS01000011.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	terpene	25,728	49,239	Low	isorenieratene	terpene

NZ_SWMS01000013.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	HR-T2PKS	114,241	156,435

NZ_SWMS01000016.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	thioamitides	91,965	113,832

NZ_SWMS01000018.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	terpene	25,412	47,628	High	geosmin	terpene:Sesquiterpene

NZ_SWMS01000023.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	triceptide	39,495	63,598

NZ_SWMS01000025.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	arylpolyene	67,340	98,716

NZ_SWMS01000027.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	lanthipeptide-class-i	1	15,974

NZ_SWMS01000029.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	redox-cofactor	58,933	79,922

NZ_SWMS01000003.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	terpene	1	15,412

NZ_SWMS01000032.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	NI-siderophore	1	28,474	Low	5-dimethylallylindole-3-acetonitrile	other:other
Region 26.2	ectoine	47,283	57,675	High	ectoine	other:ectoine

NZ_SWMS01000036.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 30.1	t3nrps-iterative,T1PKS,PKS-like	2,314	44,571	Low	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	PKS

NZ_SWMS01000004.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	RiPP-like	30,574	42,013	Low	streptamidine	ribosomal:unmodified
Region 34.2	terpene	188,450	210,009
Region 34.3	ranthipeptide	221,733	243,216

NZ_SWMS01000041.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	NAPAA	1	23,292	High	ε-Poly-L-lysine	NRPS:Type I

NZ_SWMS01000006.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 56.1	terpene	117,910	143,869	Low	hopene	terpene
Region 56.2	terpene-precursor	190,261	211,295

NZ_SWMS01000009.1 (Prauserella endophytica)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 81.1	redox-cofactor	108,383	130,396	Low	lankacidin C	NRPS:Type I+PKS

No secondary metabolite regions were found in these records:: NZ_SWMS01000010.1 (Prauserella endophytica); NZ_SWMS01000012.1 (Prauserella endophytica); NZ_SWMS01000014.1 (Prauserella endophytica); NZ_SWMS01000015.1 (Prauserella endophytica); NZ_SWMS01000017.1 (Prauserella endophytica); NZ_SWMS01000019.1 (Prauserella endophytica); NZ_SWMS01000002.1 (Prauserella endophytica); NZ_SWMS01000020.1 (Prauserella endophytica); NZ_SWMS01000021.1 (Prauserella endophytica); NZ_SWMS01000022.1 (Prauserella endophytica); NZ_SWMS01000024.1 (Prauserella endophytica); NZ_SWMS01000026.1 (Prauserella endophytica); NZ_SWMS01000028.1 (Prauserella endophytica); NZ_SWMS01000030.1 (Prauserella endophytica); NZ_SWMS01000031.1 (Prauserella endophytica); NZ_SWMS01000033.1 (Prauserella endophytica); NZ_SWMS01000034.1 (Prauserella endophytica); NZ_SWMS01000035.1 (Prauserella endophytica); NZ_SWMS01000037.1 (Prauserella endophytica); NZ_SWMS01000038.1 (Prauserella endophytica); NZ_SWMS01000039.1 (Prauserella endophytica); NZ_SWMS01000040.1 (Prauserella endophytica); NZ_SWMS01000042.1 (Prauserella endophytica); NZ_SWMS01000043.1 (Prauserella endophytica); NZ_SWMS01000044.1 (Prauserella endophytica); NZ_SWMS01000045.1 (Prauserella endophytica); NZ_SWMS01000046.1 (Prauserella endophytica); NZ_SWMS01000047.1 (Prauserella endophytica); NZ_SWMS01000048.1 (Prauserella endophytica); NZ_SWMS01000049.1 (Prauserella endophytica); NZ_SWMS01000005.1 (Prauserella endophytica); NZ_SWMS01000050.1 (Prauserella endophytica); NZ_SWMS01000051.1 (Prauserella endophytica); NZ_SWMS01000052.1 (Prauserella endophytica); NZ_SWMS01000053.1 (Prauserella endophytica); NZ_SWMS01000054.1 (Prauserella endophytica); NZ_SWMS01000055.1 (Prauserella endophytica); NZ_SWMS01000056.1 (Prauserella endophytica); NZ_SWMS01000057.1 (Prauserella endophytica); NZ_SWMS01000058.1 (Prauserella endophytica); NZ_SWMS01000059.1 (Prauserella endophytica); NZ_SWMS01000060.1 (Prauserella endophytica); NZ_SWMS01000061.1 (Prauserella endophytica); NZ_SWMS01000062.1 (Prauserella endophytica); NZ_SWMS01000063.1 (Prauserella endophytica); NZ_SWMS01000064.1 (Prauserella endophytica); NZ_SWMS01000065.1 (Prauserella endophytica); NZ_SWMS01000066.1 (Prauserella endophytica); NZ_SWMS01000067.1 (Prauserella endophytica); NZ_SWMS01000068.1 (Prauserella endophytica); NZ_SWMS01000069.1 (Prauserella endophytica); NZ_SWMS01000007.1 (Prauserella endophytica); NZ_SWMS01000070.1 (Prauserella endophytica); NZ_SWMS01000071.1 (Prauserella endophytica); NZ_SWMS01000072.1 (Prauserella endophytica); NZ_SWMS01000073.1 (Prauserella endophytica); NZ_SWMS01000074.1 (Prauserella endophytica); NZ_SWMS01000075.1 (Prauserella endophytica); NZ_SWMS01000076.1 (Prauserella endophytica); NZ_SWMS01000077.1 (Prauserella endophytica); NZ_SWMS01000078.1 (Prauserella endophytica); NZ_SWMS01000079.1 (Prauserella endophytica); NZ_SWMS01000008.1 (Prauserella endophytica); NZ_SWMS01000080.1 (Prauserella endophytica); NZ_SWMS01000081.1 (Prauserella endophytica)

Compact view

NZ_SWMS01000001.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 632,292 - 688,157 nt. (total: 55,866 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FCN18_RS03355: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FCN18_RS03365: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

FCN18_RS03455: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase aminotransferase formyltransferase glycosyltransferase

FCN18_RS03265: aminotransferase

smcogs: SMCOG1019: aminotransferase

FCN18_RS03275: aminotransferase

smcogs: SMCOG1019: aminotransferase

FCN18_RS03360: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

FCN18_RS03415: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

FCN18_RS03430: acyltransferase

smcogs: SMCOG1141: acyltransferase

FCN18_RS03470: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase peptidase

FCN18_RS03305: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

FCN18_RS03465: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: racemase

FCN18_RS03300: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

FCN18_RS03375: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002424.3	0.98	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0002135.2	0.87	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.81	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.76	NRPS	HC-toxin	Alternaria jesenskae
BGC0000349.5	0.74	NRPS	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002424.3	0.78	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0000349.5	0.70	NRPS	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.33 out of 26.85

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

Additional weak hits (11):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.06 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.09 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.39 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.08 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.16 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.73 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.38 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.82 out of 27.55

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 632291 - 688157:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Fo-OH-Orn - Ser - OH-Orn - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FCN18_RS03375: Fo-OH-Orn - Ser - OH-Orn - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (445..820): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAAFDVAVWDMILVVGTEVAAYGLTEATVNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWIIGAVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1413..1804): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFSSGEHNLYGPTEAAVDVTW
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2449..2875): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3512..3901): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAAFDVFVFEMILLVGTEIAAYGLTEATVNSTL
Nearest Stachelhaus code(s):: OH-Orn DVFILGAVNK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
RutR	Regulator of the pyrimidine and purine metabolism

NZ_SWMS01000001.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 770,090 - 796,724 nt. (total: 26,635 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase glycosyltransferase transferase

FCN18_RS03890: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

FCN18_RS03925: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

FCN18_RS04000: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Lyases: dehydratase

FCN18_RS03900: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.50	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.49	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002450.2	0.45	other (other)	sarasinoside	uncultured bacterium
BGC0000578.3	0.45	ribosomal	SRO15-2005	Streptomyces filamentosus NRRL 15998
BGC0000737.3	0.44	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0002425.3	0.43	ribosomal	stlassin	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001552.3	0.53	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.52	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.5	0.52	ribosomal	lariatin	Rhodococcus jostii
BGC0001549.3	0.52	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.50	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.49	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002450.2	0.45	other (other)	sarasinoside	uncultured bacterium
BGC0000578.3	0.45	ribosomal	SRO15-2005	Streptomyces filamentosus NRRL 15998
BGC0000737.3	0.44	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0002425.3	0.43	ribosomal	stlassin	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (7):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.38 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.72 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.39 out of 35.63

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 4 - 83; Score: 67.8

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_SWMS01000011.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 25,728 - 49,239 nt. (total: 23,512 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FCN18_RS20135: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FCN18_RS20145: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Ligases: synthetase

FCN18_RS20130: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.63	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000664.5	0.59	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.58	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.56	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.55	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.54	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.63	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000664.5	0.59	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.58	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.56	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.55	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.54	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

FCN18_RS20130: PT_FPPS_like

Domain 1 (45 - 358): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

FCN18_RS20140: PT_phytoene_like

Domain 1 (5 - 289): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 27.38 out of 29.65

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 24.78 out of 24.78

Confidence: strong

Additional weak hits (10):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.91 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.95 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.28 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.49 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.90 out of 30.11

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.09 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.26 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.97 out of 26.06

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.15 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
RpoN	Regulator of nitrogen assimilation and virulence

NZ_SWMS01000013.1 - Region 1 - HR-T2PKS

Download region GenBank file

Download region SVG

Location: 114,241 - 156,435 nt. (total: 42,195 nt) Show pHMM detection rules used

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FCN18_RS23140: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: kinase transferase

FCN18_RS23150: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

FCN18_RS23170: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: hydrolase protease

FCN18_RS23040: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

FCN18_RS23160: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

FCN18_RS23115: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FCN18_RS23175: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0000595.3	0.54	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002510.2	0.48	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0000595.3	0.54	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002510.2	0.48	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.61 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.06 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.16 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.75 out of 27.55

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

FCN18_RS23175: X

AMP-binding (6..384): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TALLHGLILG-GFGVSGSAVERYGMSETLMNTSV
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_SWMS01000016.1 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 91,965 - 113,832 nt. (total: 21,868 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002560.3	0.45	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001849.4	0.45	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002328.3	0.40	ribosomal	Rc-AIP1	Ruminiclostridium cellulolyticum H10
BGC0001802.5	0.39	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.39	ribosomal	neothioviridamide	Streptomyces sp.
BGC0000625.5	0.37	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002669.2	0.34	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0002120.3	0.32	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000604.4	0.27	ribosomal	GE2270A	Nonomuraea sp. WU8817
BGC0001155.5	0.27	ribosomal	GE2270	Planobispora rosea

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002560.3	0.45	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001849.4	0.45	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002328.3	0.40	ribosomal	Rc-AIP1	Ruminiclostridium cellulolyticum H10
BGC0001802.5	0.39	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0001696.5	0.39	ribosomal	neothioviridamide	Streptomyces sp.
BGC0000625.5	0.37	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002669.2	0.34	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0002120.3	0.32	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000604.4	0.27	ribosomal	GE2270A	Nonomuraea sp. WU8817
BGC0001155.5	0.27	ribosomal	GE2270	Planobispora rosea

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.04 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.33 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.30 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.40 out of 30.98

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.76 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_SWMS01000018.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 25,412 - 47,628 nt. (total: 22,217 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

FCN18_RS27100: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: hydrolase

FCN18_RS27105: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

FCN18_RS27120: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: mutase

FCN18_RS27155: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

FCN18_RS27165: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001535.3	0.53	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001736.3	0.39	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002582.3	0.37	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0001768.4	0.36	NRPS	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0001972.4	0.35	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000111.5	0.33	PKS	neocarzilin A, neocarzilin B	Streptomyces carzinostaticus
BGC0001637.3	0.33	NRPS	kleboxymycin	Klebsiella oxytoca
BGC0001782.3	0.32	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001535.3	0.53	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002284.3	0.40	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001736.3	0.39	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002582.3	0.37	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0001768.4	0.36	NRPS	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0001972.4	0.35	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000111.5	0.33	PKS	neocarzilin A, neocarzilin B	Streptomyces carzinostaticus
BGC0001637.3	0.33	NRPS	kleboxymycin	Klebsiella oxytoca
BGC0001782.3	0.32	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

FCN18_RS27120: T1TS + T1TS

Domain 1 (1 - 329): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (338 - 700): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (3):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.96 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.60 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_SWMS01000023.1 - Region 1 - triceptide

Download region GenBank file

Download region SVG

Location: 39,495 - 63,598 nt. (total: 24,104 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

FCN18_RS30140: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase

FCN18_RS30205: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Isomerases: racemase

FCN18_RS30145: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000600.3	0.42	ribosomal	thurincin H	Bacillus thuringiensis
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000916.5	0.40	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002667.2	0.40	ribosomal	estericin A	Clostridium estertheticum
BGC0000772.5	0.38	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000340.5	0.35	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000932.5	0.34	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000600.3	0.42	ribosomal	thurincin H	Bacillus thuringiensis
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000916.5	0.40	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0002667.2	0.40	ribosomal	estericin A	Clostridium estertheticum
BGC0000772.5	0.38	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000340.5	0.35	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000932.5	0.34	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.73 out of 27.18

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.78 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 30.11

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_SWMS01000025.1 - Region 1 - arylpolyene

Download region GenBank file

Download region SVG

Location: 67,340 - 98,716 nt. (total: 31,377 nt) Show pHMM detection rules used

Region on contig edge.

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer

FCN18_RS31355: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FCN18_RS31425: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: kinase

FCN18_RS31365: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Lyases: cyclase

FCN18_RS31395: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Isomerases: racemase

FCN18_RS31445: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase

FCN18_RS31400: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0002704.2	0.41	ribosomal	archalan β	Halorussus salinus
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0000584.5	0.40	ribosomal	colicin V	Escherichia coli
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001184.4	0.40	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002407.3	0.39	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus
BGC0000528.5	0.39	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002294.3	0.39	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0002704.2	0.41	ribosomal	archalan β	Halorussus salinus
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0000584.5	0.40	ribosomal	colicin V	Escherichia coli
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001184.4	0.40	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002407.3	0.39	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus
BGC0000528.5	0.39	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002294.3	0.39	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

Additional weak hits (6):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.10 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.44 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 26.62 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.92 out of 36.54

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.61 out of 23.43

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_SWMS01000027.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 15,974 nt. (total: 15,974 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

FCN18_RS31960: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Lyases: cyclase dehydratase

FCN18_RS31935: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

FCN18_RS31940: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000514.5	0.39	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001151.5	0.29	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0001556.5	0.28	NRPS, PKS	combamide	Streptomyces sp.
BGC0000796.3	0.27	saccharide	S-layer glycan	Paenibacillus alvei
BGC0002081.3	0.27	PKS	streptoketide A, streptoketide B, streptoketide C, S2502, S2507, UWM5	Streptomyces sp. Tue6314

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000514.5	0.39	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0001151.5	0.29	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0001556.5	0.28	NRPS, PKS	combamide	Streptomyces sp.
BGC0000796.3	0.27	saccharide	S-layer glycan	Paenibacillus alvei
BGC0002081.3	0.27	PKS	streptoketide A, streptoketide B, streptoketide C, S2502, S2507, UWM5	Streptomyces sp. Tue6314

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 147 - 239; Score: 65.9

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_SWMS01000029.1 - Region 1 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 58,933 - 79,922 nt. (total: 20,990 nt) Show pHMM detection rules used

Region on contig edge.

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: hydratase

FCN18_RS33070: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.49	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002289.2	0.49	ribosomal	Leepeptin	Streptomyces leeuwenhoekii
BGC0001496.3	0.47	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0000501.3	0.47	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001645.3	0.46	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001779.5	0.45	ribosomal	siamycin	Streptomyces nodosus
BGC0001550.3	0.45	ribosomal	citrulassin D	Streptomyces katrae
BGC0002575.2	0.44	ribosomal	cochonodin I	Streptococcus suis
BGC0001176.4	0.44	ribosomal	streptomonomicin	Streptomonospora alba
BGC0001634.3	0.44	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.49	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002289.2	0.49	ribosomal	Leepeptin	Streptomyces leeuwenhoekii
BGC0001496.3	0.47	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0000501.3	0.47	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001645.3	0.46	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001779.5	0.45	ribosomal	siamycin	Streptomyces nodosus
BGC0001550.3	0.45	ribosomal	citrulassin D	Streptomyces katrae
BGC0002575.2	0.44	ribosomal	cochonodin I	Streptococcus suis
BGC0001176.4	0.44	ribosomal	streptomonomicin	Streptomonospora alba
BGC0001634.3	0.44	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.27 out of 23.79

Confidence: medium

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.84 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.31 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.51 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.03 out of 36.53

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.17 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.19 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.68 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.40 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 14 - 99; Score: 65.0

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_SWMS01000003.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 15,412 nt. (total: 15,412 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FCN18_RS07095: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FCN18_RS07125: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FCN18_RS07130: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: methyltransferase

FCN18_RS07100: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.49	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.49	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.48	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.47	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.47	terpene	carotenoid	Streptomyces avermitilis
BGC0000636.3	0.47	terpene	carotenoid	Brevibacterium linens
BGC0000706.3	0.45	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002675.2	0.38	PKS	prodigiosin	Pseudoalteromonas rubra
BGC0002147.2	0.37	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0001485.4	0.36	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.49	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.49	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.48	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.47	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.47	terpene	carotenoid	Streptomyces avermitilis
BGC0000636.3	0.47	terpene	carotenoid	Brevibacterium linens
BGC0000706.3	0.45	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002675.2	0.38	PKS	prodigiosin	Pseudoalteromonas rubra
BGC0002147.2	0.37	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0001485.4	0.36	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

FCN18_RS07105: Lycopene_cycl

Domain 1 (6 - 97): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

FCN18_RS07110: Lycopene_cycl

Domain 1 (8 - 94): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.19 out of 30.22

Confidence: medium

Additional weak hits (5):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.45 out of 23.43

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator

NZ_SWMS01000032.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1 - 28,474 nt. (total: 28,474 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FCN18_RS34055: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FCN18_RS34075: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FCN18_RS34080: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: deaminase protease

FCN18_RS33980: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

FCN18_RS34025: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase

FCN18_RS34005: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

FCN18_RS34030: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

FCN18_RS34045: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.59	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000943.5	0.57	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002527.2	0.56	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001499.5	0.53	other (other)	aerobactin	Pantoea ananatis
BGC0000946.5	0.53	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002471.3	0.53	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0001201.3	0.52	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001408.5	0.49	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002128.3	0.49	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.59	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000943.5	0.57	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002527.2	0.56	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001499.5	0.53	other (other)	aerobactin	Pantoea ananatis
BGC0000946.5	0.53	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002471.3	0.53	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0001201.3	0.52	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001408.5	0.49	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002128.3	0.49	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.40 out of 29.65

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.85 out of 25.88

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.25 out of 36.53

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.29 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.88 out of 36.54

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_SWMS01000032.1 - Region 2 - ectoine

Download region GenBank file

Download region SVG

Location: 47,283 - 57,675 nt. (total: 10,393 nt) Show pHMM detection rules used

Region on contig edge.

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

FCN18_RS34225: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000852.5	0.57	other (other)	ectoine	Sporosarcina pasteurii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000852.5	0.57	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.04 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.79 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_SWMS01000036.1 - Region 1 - PKS-like,T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 2,314 - 44,571 nt. (total: 42,258 nt) Show pHMM detection rules used

Region on contig edge.

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FCN18_RS35125: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

FCN18_RS35130: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FCN18_RS35150: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

FCN18_RS35160: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

FCN18_RS35210: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FCN18_RS35215: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase kinase

FCN18_RS35120: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

FCN18_RS35175: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase phosphatase

FCN18_RS35165: thioesterase

smcogs: SMCOG1004: thioesterase

FCN18_RS35190: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Lyases: decarboxylase

FCN18_RS35230: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

FCN18_RS35195: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

FCN18_RS35200: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FCN18_RS35220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FCN18_RS35235: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FCN18_RS35240: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.97	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.97	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.96	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.95	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001641.4	0.91	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.91	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.91	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.90	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001257.3	0.90	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001128.4	0.89	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (8):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.28 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.87 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.31 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.94 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.59 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 2313 - 44571:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 17944 - 44571:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FCN18_RS35200: mal

PKS_AT (517..799): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 135.5
inactive: 82.8
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 59.1
2-Methylbutyryl-CoA: 43.9
Propionyl-CoA: 39.0
Ethylmalonyl-CoA: 23.1
Isobutyryl-CoA: 18.2
fatty_acid: 14.3
CHC-CoA: 12.9
Acetyl-CoA: 12.6
trans-1,2-CPDA: 7.0
3-Methylbutyryl-CoA: 3.5
Benzoyl-CoA: 0.0

FCN18_RS35220: NH2

CAL_domain (26..461): NH2

minowa: NH2

Prediction, score:

NH2: 120.5
fatty_acid: 32.8
AHBA: 9.3
Acetyl-CoA: 4.6
shikimic_acid: 0.1

FCN18_RS35235: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (15..401): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAISFDYGLYQLPTTNTGAVSMYGITECKRVTIA
Nearest Stachelhaus code(s):: Asp DYYPTTMRVK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_SWMS01000004.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 30,574 - 42,013 nt. (total: 11,440 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.51	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001222.3	0.39	ribosomal	acidocin B	Lactobacillus acidophilus
BGC0000491.5	0.39	ribosomal	gassericin A	Lactobacillus gasseri
BGC0000571.3	0.36	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002322.3	0.36	ribosomal	citrocin	Citrobacter pasteurii
BGC0000539.5	0.36	ribosomal	nukacin ISK-1	Staphylococcus warneri

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.51	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001222.3	0.39	ribosomal	acidocin B	Lactobacillus acidophilus
BGC0000491.5	0.39	ribosomal	gassericin A	Lactobacillus gasseri
BGC0000571.3	0.36	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002322.3	0.36	ribosomal	citrocin	Citrobacter pasteurii
BGC0000539.5	0.36	ribosomal	nukacin ISK-1	Staphylococcus warneri

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.65 out of 28.19

Confidence: medium

Additional weak hits (8):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.12 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.01 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.36 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.74 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.68 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.72 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.79 out of 20.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.55 out of 32.74

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
ZuR variant 1	Zinc-responsive repressor

NZ_SWMS01000004.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 188,450 - 210,009 nt. (total: 21,560 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase

FCN18_RS10125: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

FCN18_RS10140: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: methyltransferase

FCN18_RS10175: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

FCN18_RS10170: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: decarboxylase

FCN18_RS10165: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001453.5	0.46	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.46	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0000286.3	0.43	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002690.2	0.43	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001483.4	0.43	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000495.5	0.42	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001478.5	0.42	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.41	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001453.5	0.46	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000940.5	0.46	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0000286.3	0.43	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002690.2	0.43	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001483.4	0.43	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000495.5	0.42	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001478.5	0.42	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.41	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

FCN18_RS10145: T2TS

Domain 1 (12 - 501): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.96 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.67 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_SWMS01000004.1 - Region 3 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 221,733 - 243,216 nt. (total: 21,484 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FCN18_RS10250: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FCN18_RS10275: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

FCN18_RS10280: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

FCN18_RS10335: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: halogenase

FCN18_RS10265: halogenase

smcogs: SMCOG1119: halogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0000906.3	0.42	other (other)	heme D1	Heliophilum fasciatum
BGC0002493.3	0.41	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000252.5	0.40	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0001687.3	0.40	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0000880.4	0.39	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002553.2	0.39	other (other)	tunicamycin	Rathayibacter iranicus
BGC0000243.4	0.38	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001850.4	0.37	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001475.4	0.43	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0000906.3	0.42	other (other)	heme D1	Heliophilum fasciatum
BGC0002493.3	0.41	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000252.5	0.40	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0001687.3	0.40	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0000880.4	0.39	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002553.2	0.39	other (other)	tunicamycin	Rathayibacter iranicus
BGC0000243.4	0.38	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001850.4	0.37	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.13 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.21 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.26 out of 33.14

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Mycofactocin_RRE; Location: 8 - 88; Score: 91.5

TFBS definitions

Regulator	Description

NZ_SWMS01000041.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 1 - 23,292 nt. (total: 23,292 nt) Show pHMM detection rules used

Region on contig edge.

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

FCN18_RS36065: acyltransferase

smcogs: SMCOG1141: acyltransferase

Ligases: ligase synthase

FCN18_RS36055: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FCN18_RS36120: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002535.2	0.48	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001873.3	0.44	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0002555.3	0.40	NRPS, PKS	emerimicin V, emerimicin VI, emerimicin VII, emerimicin VIII, emerimicin IX, emerimicin X	Acremonium sp.
BGC0002660.2	0.40	NRPS	pentacitidin A, pentacitidin B	Chitinophaga eiseniae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002535.2	0.48	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001873.3	0.44	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0002555.3	0.40	NRPS, PKS	emerimicin V, emerimicin VI, emerimicin VII, emerimicin VIII, emerimicin IX, emerimicin X	Acremonium sp.
BGC0002660.2	0.40	NRPS	pentacitidin A, pentacitidin B	Chitinophaga eiseniae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 23292:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

FCN18_RS36055: X

AMP-binding (37..409): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

NZ_SWMS01000006.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 117,910 - 143,869 nt. (total: 25,960 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FCN18_RS13470: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

FCN18_RS13495: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FCN18_RS13520: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthetase

FCN18_RS13500: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.60	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000644.3	0.52	terpene	carotenoid	Dietzia sp. CQ4
BGC0002397.2	0.52	terpene	astallatene	Arabidopsis thaliana
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.60	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000644.3	0.52	terpene	carotenoid	Dietzia sp. CQ4
BGC0002397.2	0.52	terpene	astallatene	Arabidopsis thaliana
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

FCN18_RS13485: PT_phytoene_like

Domain 1 (17 - 278): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

FCN18_RS13490: PT_phytoene_like

Domain 1 (5 - 282): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

FCN18_RS13500: PT_FPPS_like

Domain 1 (53 - 329): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

FCN18_RS13505: T2TS

Domain 1 (7 - 630): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.58 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 25.32 out of 29.51

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (8):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.16 out of 20.01

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.32 out of 20.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.28 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.96 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.46 out of 24.78

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.38 out of 27.18

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_SWMS01000006.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 190,261 - 211,295 nt. (total: 21,035 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FCN18_RS13845: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

FCN18_RS13850: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthetase

FCN18_RS13810: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000664.5	0.37	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000516.4	0.37	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000664.5	0.37	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000516.4	0.37	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

FCN18_RS13810: PT_FPPS_like

Domain 1 (60 - 341): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.44 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

Additional weak hits (5):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.30 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.57 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.02 out of 32.74

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.65 out of 29.51

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator

NZ_SWMS01000009.1 - Region 1 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 108,383 - 130,396 nt. (total: 22,014 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

FCN18_RS17935: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

FCN18_RS18000: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002667.2	0.40	ribosomal	estericin A	Clostridium estertheticum
BGC0001100.5	0.37	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000844.5	0.35	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000495.5	0.31	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002362.3	0.28	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000270.5	0.28	PKS	simocyclinone D8	Streptomyces antibioticus
BGC0000845.5	0.27	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001165.5	0.25	NRPS, PKS	curacin A	Lyngbya majuscula
BGC0001053.5	0.25	NRPS, PKS	tubulysin A	Archangium disciforme
BGC0000986.5	0.24	NRPS, PKS	dkxanthene 530, dkxanthene 556, dkxanthene, dkxanthene 504, dkxanthene 508, dkxanthene 518, dkxanthene 520, dkxanthene 534, dkxanthene 544, dkxanthene 548, dkxanthene 560, dkxanthene 574, dkxanthene 586	Stigmatella aurantiaca DW4/3-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002667.2	0.40	ribosomal	estericin A	Clostridium estertheticum
BGC0001100.5	0.37	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000844.5	0.35	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000495.5	0.31	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002362.3	0.28	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000270.5	0.28	PKS	simocyclinone D8	Streptomyces antibioticus
BGC0000845.5	0.27	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001165.5	0.25	NRPS, PKS	curacin A	Lyngbya majuscula
BGC0001053.5	0.25	NRPS, PKS	tubulysin A	Archangium disciforme
BGC0000986.5	0.24	NRPS, PKS	dkxanthene 530, dkxanthene 556, dkxanthene, dkxanthene 504, dkxanthene 508, dkxanthene 518, dkxanthene 520, dkxanthene 534, dkxanthene 544, dkxanthene 548, dkxanthene 560, dkxanthene 574, dkxanthene 586	Stigmatella aurantiaca DW4/3-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.72 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.34 out of 20.97

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.33 out of 27.04

Confidence: medium

Additional weak hits (10):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.95 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.56 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.34 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.95 out of 32.74

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.43 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.48 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.12 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.04 out of 35.63

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 1 - 81; Score: 73.4

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor