GCF_004216555.1 - 29 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_SGWQ01000001.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	lanthipeptide-class-iii	163,023	185,614
Region 1.2	furan	287,952	308,950
Region 1.3	ectoine	665,965	676,399	High	ectoine	other:ectoine
Region 1.4	NRPS	863,984	919,612	Medium	coelibactin	NRPS:Type I
Region 1.5	RiPP-like	929,048	939,437
Region 1.6	RiPP-like	1,010,418	1,022,244

NZ_SGWQ01000002.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	terpene	1	17,891
Region 2.2	terpene-precursor	25,845	46,810
Region 2.3	NRP-metallophore,NRPS,terpene	79,897	155,161	High	coelichelin	NRPS:Type I
Region 2.4	terpene	343,819	364,934
Region 2.5	terpene	404,133	425,407
Region 2.6	RiPP-like	613,405	624,211

NZ_SGWQ01000003.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	t3nrps-iterative,NRPS-like,NI-siderophore	147,192	219,933

NZ_SGWQ01000004.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	lanthipeptide-class-iii	32,503	55,142	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide
Region 4.2	NAPAA	94,630	135,150	High	ε-Poly-L-lysine	NRPS:Type I
Region 4.3	terpene	138,363	161,827	Low	isorenieratene	terpene
Region 4.4	T1PKS,CDPS	405,603	451,686

NZ_SGWQ01000006.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	NRPS-like	125,389	168,874

NZ_SGWQ01000007.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	T1PKS	1	31,012	Low	microansamycin A/microansamycin B/microansamycin C/microansamycin D/microansamycin E/microansamycin F/microansamycin G/microansamycin H/microansamycin I	PKS
Region 7.2	butyrolactone	292,684	303,628

NZ_SGWQ01000010.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	terpene	91,943	116,388
Region 10.2	lassopeptide	116,961	139,463	Medium	SSV-2083	ribosomal:RiPP:Lanthipeptide
Region 10.3	hglE-KS	229,720	269,051

NZ_SGWQ01000011.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	T1PKS,t3nrps-iterative	48,419	174,017	Medium	sceliphrolactam	PKS
Region 11.2	hydrogen-cyanide	254,811	267,531

NZ_SGWQ01000013.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	NRPS-like	1	23,967	Low	ansaseomycin A/ansaseomycin B	PKS
Region 13.2	aminopolycarboxylic-acid	109,689	125,764	Low	Ethylenediaminesuccinic acid hydroxyarginine	other:other

NZ_SGWQ01000017.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	terpene	21,273	42,163

NZ_SGWQ01000025.1 (Herbihabitans rhizosphaerae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	T1PKS	1	2,289

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	lanthipeptide-class-iii	163,023	185,614
Region 1.2	furan	287,952	308,950
Region 1.3	ectoine	665,965	676,399	High	ectoine	other:ectoine
Region 1.4	NRPS	863,984	919,612	Medium	coelibactin	NRPS:Type I
Region 1.5	RiPP-like	929,048	939,437
Region 1.6	RiPP-like	1,010,418	1,022,244
Region 2.1	terpene	1	17,891
Region 2.2	terpene-precursor	25,845	46,810
Region 2.3	NRP-metallophore,NRPS,terpene	79,897	155,161	High	coelichelin	NRPS:Type I
Region 2.4	terpene	343,819	364,934
Region 2.5	terpene	404,133	425,407
Region 2.6	RiPP-like	613,405	624,211
Region 3.1	t3nrps-iterative,NRPS-like,NI-siderophore	147,192	219,933
Region 4.1	lanthipeptide-class-iii	32,503	55,142	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide
Region 4.2	NAPAA	94,630	135,150	High	ε-Poly-L-lysine	NRPS:Type I
Region 4.3	terpene	138,363	161,827	Low	isorenieratene	terpene
Region 4.4	T1PKS,CDPS	405,603	451,686
Region 6.1	NRPS-like	125,389	168,874
Region 7.1	T1PKS	1	31,012	Low	microansamycin A/microansamycin B/microansamycin C/microansamycin D/microansamycin E/microansamycin F/microansamycin G/microansamycin H/microansamycin I	PKS
Region 7.2	butyrolactone	292,684	303,628
Region 10.1	terpene	91,943	116,388
Region 10.2	lassopeptide	116,961	139,463	Medium	SSV-2083	ribosomal:RiPP:Lanthipeptide
Region 10.3	hglE-KS	229,720	269,051
Region 11.1	T1PKS,t3nrps-iterative	48,419	174,017	Medium	sceliphrolactam	PKS
Region 11.2	hydrogen-cyanide	254,811	267,531
Region 13.1	NRPS-like	1	23,967	Low	ansaseomycin A/ansaseomycin B	PKS
Region 13.2	aminopolycarboxylic-acid	109,689	125,764	Low	Ethylenediaminesuccinic acid hydroxyarginine	other:other
Region 17.1	terpene	21,273	42,163
Region 25.1	T1PKS	1	2,289

No secondary metabolite regions were found in these records:: NZ_SGWQ01000005.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000008.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000009.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000012.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000014.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000015.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000016.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000018.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000019.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000020.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000021.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000022.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000023.1 (Herbihabitans rhizosphaerae); NZ_SGWQ01000024.1 (Herbihabitans rhizosphaerae)

Compact view

NZ_SGWQ01000001.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 163,023 - 185,614 nt. (total: 22,592 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: hydratase

EV193_RS00865: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.58	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.55	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.53	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.52	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000496.5	0.50	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.50	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000554.4	0.46	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.58	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.55	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.53	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.52	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000496.5	0.50	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.50	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000554.4	0.46	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.83 out of 23.79

Confidence: medium

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.56 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.03 out of 30.22

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.31 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.65 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.25 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.61 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.06 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.43 out of 24.78

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_SGWQ01000001.1 - Region 2 - furan

Download region GenBank file

Download region SVG

Location: 287,952 - 308,950 nt. (total: 20,999 nt) Show pHMM detection rules used

furan: (mmyO or AvrD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EV193_RS01590: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase

EV193_RS01595: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002404.2	0.45	other (other)	falcarindiol	Solanum lycopersicum
BGC0002496.3	0.44	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001226.4	0.43	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.43	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001660.3	0.41	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.41	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001579.4	0.41	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000595.3	0.41	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002508.2	0.40	other (other)	8-azaguanine	Streptomyces pathocidini

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002404.2	0.45	other (other)	falcarindiol	Solanum lycopersicum
BGC0002496.3	0.44	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001226.4	0.43	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.43	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001660.3	0.41	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.41	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001579.4	0.41	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000595.3	0.41	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002508.2	0.40	other (other)	8-azaguanine	Streptomyces pathocidini

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.96 out of 32.93

Confidence: medium

Additional weak hits (2):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.54 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
RicR	Copper-responsive regulator

NZ_SGWQ01000001.1 - Region 3 - ectoine

Download region GenBank file

Download region SVG

Location: 665,965 - 676,399 nt. (total: 10,435 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

EV193_RS03440: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000855.3	0.72	other (other)	ectoine	Methylomicrobium kenyense
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000857.3	0.54	other (other)	ectoine	Methylophaga alcalica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000855.3	0.72	other (other)	ectoine	Methylomicrobium kenyense
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000857.3	0.54	other (other)	ectoine	Methylophaga alcalica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.95 out of 23.79

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (7):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 27.04

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.43 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.17 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.29 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.23 out of 33.14

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism

NZ_SGWQ01000001.1 - Region 4 - NRPS

Download region GenBank file

Download region SVG

Location: 863,984 - 919,612 nt. (total: 55,629 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

EV193_RS04560: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: esterase

EV193_RS04490: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase

EV193_RS04460: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase

EV193_RS04505: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EV193_RS04510: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EV193_RS04525: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001133.4	0.63	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001133.4	0.63	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.24 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.98 out of 24.78

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 25.31

Confidence: medium

Additional weak hits (15):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.35 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.02 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.94 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.42 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.71 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.37 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.49 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.72 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.79 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.14 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.22 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.19 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 863983 - 919612:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys - Cys - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EV193_RS04505: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (541..931): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLLSGDVGLGGATEASIWSIH
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

EV193_RS04510: Cys - Cys - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (561..926): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVYDGNTLVSGDIALGGATEAGIWSNA
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1555..1931): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVYDGNTLVSGDIALGGATEAGIWSNF
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2847..3217): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSLVSGDVALGGATEAAIWSNA
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

EV193_RS04525: X

AMP-binding (97..482): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHLTW-MMWNYSGVGSTGA---------SVQTAS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_SGWQ01000001.1 - Region 5 - RiPP-like

Download region GenBank file

Download region SVG

Location: 929,048 - 939,437 nt. (total: 10,390 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

EV193_RS04660: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000503.5	0.35	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000583.5	0.34	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.33	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001513.3	0.32	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0002064.2	0.31	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0000197.5	0.30	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000662.5	0.30	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000877.5	0.29	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001366.5	0.28	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000273.5	0.28	PKS, saccharide	steffimycin D	Streptomyces steffisburgensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000503.5	0.35	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000583.5	0.34	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.33	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001513.3	0.32	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0002064.2	0.31	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0000197.5	0.30	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000662.5	0.30	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000877.5	0.29	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001366.5	0.28	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000273.5	0.28	PKS, saccharide	steffimycin D	Streptomyces steffisburgensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

Additional weak hits (2):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.78 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_SGWQ01000001.1 - Region 6 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,010,418 - 1,022,244 nt. (total: 11,827 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

EV193_RS05100: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

EV193_RS05125: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

EV193_RS05130: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.41	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.41	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.40	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.38	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000598.5	0.33	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001410.3	0.32	saccharide	polysaccharide A	Bacteroides fragilis
BGC0001148.5	0.32	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0001753.3	0.31	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000765.3	0.31	saccharide	exopolysaccharide	Lactobacillus johnsonii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.41	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.41	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.40	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.38	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000598.5	0.33	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001410.3	0.32	saccharide	polysaccharide A	Bacteroides fragilis
BGC0001148.5	0.32	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0001753.3	0.31	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000765.3	0.31	saccharide	exopolysaccharide	Lactobacillus johnsonii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.61 out of 30.22

Confidence: medium

Additional weak hits (1):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.79 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator

NZ_SGWQ01000002.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 17,891 nt. (total: 17,891 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001364.3	0.30	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001379.5	0.26	NRPS	BD-12	Streptomyces luteocolor
BGC0001151.5	0.25	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0000197.5	0.23	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0002652.2	0.23	other (other), saccharide	cytosaminomycin F, cytosaminomycin G, streptcytosine P, plicacetin, 40551-F, 12F-plicacetin, streptcytosine D, streptcytosine E	Streptomyces sp. SHP22-7
BGC0002288.2	0.21	NRPS	ashimide A, ashimide B	Streptomyces sp. NA03103
BGC0000148.3	0.21	PKS	A83543A, Spinosyn D	Saccharopolyspora spinosa
BGC0001368.5	0.21	NRPS	JBIR-126	Streptomyces sp. NRRL F-4474
BGC0000953.5	0.21	saccharide	amicetin	Streptomyces vinaceusdrappus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001364.3	0.30	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001379.5	0.26	NRPS	BD-12	Streptomyces luteocolor
BGC0001151.5	0.25	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0000197.5	0.23	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0002652.2	0.23	other (other), saccharide	cytosaminomycin F, cytosaminomycin G, streptcytosine P, plicacetin, 40551-F, 12F-plicacetin, streptcytosine D, streptcytosine E	Streptomyces sp. SHP22-7
BGC0002288.2	0.21	NRPS	ashimide A, ashimide B	Streptomyces sp. NA03103
BGC0000148.3	0.21	PKS	A83543A, Spinosyn D	Saccharopolyspora spinosa
BGC0001368.5	0.21	NRPS	JBIR-126	Streptomyces sp. NRRL F-4474
BGC0000953.5	0.21	saccharide	amicetin	Streptomyces vinaceusdrappus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Chain length	Initial cyclisations	Functional groups
sesquiterpene	C15	C1-C6	none
diterpene	C20	C1-C6	none
diterpene	C20	C1-C7 + C6-C10	none
sesterterpene	C25	C1-C7 + C6-C10	none

Genes with terpene domains:

EV193_RS05590: TS_UbiA

Domain 1 (18 - 318): UbiA type terpene synthase

Reactions:: FPP → sesquiterpene_C1-C6; GGPP → diterpene_C1-C6; GGPP → diterpene_C1-C7/C6-C10; GFPP → sesterterpene_C1-C7/C6-C10

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

Additional weak hits (9):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.18 out of 27.04

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.64 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.58 out of 32.74

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.46 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.42 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.68 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.08 out of 29.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_SGWQ01000002.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 25,845 - 46,810 nt. (total: 20,966 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

EV193_RS05740: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

EV193_RS05790: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: protease

EV193_RS05770: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: synthetase

EV193_RS05745: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0001757.3	0.49	other (other)	rhabduscin	Xenorhabdus nematophila ATCC 19061
BGC0000923.3	0.49	other (other)	paerucumarin	Pseudomonas aeruginosa PAO1
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002245.2	0.44	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000595.3	0.41	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000597.4	0.40	ribosomal	SWA-2138	Streptomyces sp. e14

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0001757.3	0.49	other (other)	rhabduscin	Xenorhabdus nematophila ATCC 19061
BGC0000923.3	0.49	other (other)	paerucumarin	Pseudomonas aeruginosa PAO1
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002245.2	0.44	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000595.3	0.41	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000597.4	0.40	ribosomal	SWA-2138	Streptomyces sp. e14

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

EV193_RS05745: PT_FPPS_like

Domain 1 (40 - 317): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.36 out of 20.97

Confidence: medium

Additional weak hits (1):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.41 out of 27.18

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_SGWQ01000002.1 - Region 3 - NRP-metallophore,NRPS,terpene

Download region GenBank file

Download region SVG

Location: 79,897 - 155,161 nt. (total: 75,265 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

EV193_RS05960: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

EV193_RS05970: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

EV193_RS05995: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

EV193_RS06010: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

EV193_RS06080: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

EV193_RS06125: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

EV193_RS06210: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: formyltransferase methyltransferase

EV193_RS06020: methyltransferase

smcogs: SMCOG1089: methyltransferase

EV193_RS06075: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

EV193_RS06135: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase hydrolase peptidase

EV193_RS05965: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

EV193_RS06015: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

EV193_RS06100: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: cyclase dehydratase hydratase

EV193_RS05985: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

EV193_RS06000: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

EV193_RS06150: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthetase

EV193_RS05990: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EV193_RS06035: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EV193_RS06175: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	1.09	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.88	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000325.5	0.72	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.69	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.58	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.57	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000357.5	0.67	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0000325.5	0.66	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

EV193_RS06150: T1TS + T1TS

Domain 1 (2 - 328): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (334 - 693): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

EV193_RS06175: PT_FPPS_like

Domain 1 (62 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.96 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.71 out of 36.53

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (12):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.78 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.91 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.82 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.79 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.03 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.19 out of 29.38

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.25 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.71 out of 36.53

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.76 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.69 out of 26.06

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 79896 - 155161:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 79896 - 140057:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EV193_RS05990: X

AMP-binding (15..416): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CDSLHAAGLWDAMSYMGKS--TYTSTEAGIVTGS
Nearest Stachelhaus code(s):: Asp DVWMYGAIVK (26% 8Å match)
Stachelhaus code match:: 70% (weak)

EV193_RS06035: Fo-OH-Orn - Thr - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (139..537): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISINELYLWCGGEYHGYGPAETTIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1615..2024): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTHFDFAVWEGNQIFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3035..3435): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator

NZ_SGWQ01000002.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 343,819 - 364,934 nt. (total: 21,116 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EV193_RS07240: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002346.3	0.43	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001226.4	0.41	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000563.4	0.41	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002346.3	0.43	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001226.4	0.41	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000563.4	0.41	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

EV193_RS07220: Lycopene_cycl

Domain 1 (2 - 365): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.79 out of 20.97

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.61 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.16 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
NtrC	Nitrogen regulatory protein C

NZ_SGWQ01000002.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 404,133 - 425,407 nt. (total: 21,275 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase methyltransferase

EV193_RS07520: methyltransferase

smcogs: SMCOG1089: methyltransferase

EV193_RS07570: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: phosphatase

EV193_RS07540: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Lyases: cyclase

EV193_RS07525: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000659.3	0.70	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.61	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000626.3	0.40	ribosomal	thuricin	Bacillus thuringiensis
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002669.2	0.38	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001374.5	0.38	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002346.3	0.38	ribosomal	kyamicin	Saccharopolyspora sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000659.3	0.70	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.61	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000626.3	0.40	ribosomal	thuricin	Bacillus thuringiensis
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002669.2	0.38	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001374.5	0.38	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002346.3	0.38	ribosomal	kyamicin	Saccharopolyspora sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

EV193_RS07525: T1TS

Domain 1 (73 - 415): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.20 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.75 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.45 out of 28.19

Confidence: medium

Additional weak hits (8):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.64 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.96 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.51 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.02 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.03 out of 23.43

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
ZuR variant 1	Zinc-responsive repressor

NZ_SGWQ01000002.1 - Region 6 - RiPP-like

Download region GenBank file

Download region SVG

Location: 613,405 - 624,211 nt. (total: 10,807 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Isomerases: mutase

EV193_RS08510: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002788.2	0.21	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002040.3	0.20	other (other)	coformycin, formycin A	Streptomyces kaniharaensis
BGC0002356.3	0.18	PKS, other (other)	mediomycin A	Streptomyces blastmyceticus
BGC0001662.4	0.18	PKS	mediomycin A	Kitasatospora mediocidica
BGC0002357.3	0.18	PKS, other (other)	neomediomycin B	Streptomyces sp. RK95-74

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002788.2	0.21	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002040.3	0.20	other (other)	coformycin, formycin A	Streptomyces kaniharaensis
BGC0002356.3	0.18	PKS, other (other)	mediomycin A	Streptomyces blastmyceticus
BGC0001662.4	0.18	PKS	mediomycin A	Kitasatospora mediocidica
BGC0002357.3	0.18	PKS, other (other)	neomediomycin B	Streptomyces sp. RK95-74

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_SGWQ01000003.1 - Region 1 - NI-siderophore,NRPS-like,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 147,192 - 219,933 nt. (total: 72,742 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

EV193_RS10320: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

EV193_RS10370: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

EV193_RS10520: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

EV193_RS10590: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: aminotransferase methyltransferase

EV193_RS10385: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

EV193_RS10465: aminotransferase

smcogs: SMCOG1019: aminotransferase

EV193_RS10535: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: esterase

EV193_RS10420: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Lyases: decarboxylase

EV193_RS10450: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase

EV193_RS10410: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EV193_RS10525: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.98	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001833.4	0.90	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.89	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.88	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.86	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.86	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.84	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.81	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.78	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002527.2	0.77	other (other)	vibrioferrin	Azotobacter vinelandii CA

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002527.2	0.59	other (other)	vibrioferrin	Azotobacter vinelandii CA

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.71 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.86 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.91 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.90 out of 26.85

Confidence: medium

Additional weak hits (14):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.94 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.26 out of 39.62

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.56 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.85 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.94 out of 36.54

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.52 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.86 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.50 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.25 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.67 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.17 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.86 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.18 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

EV193_RS10410: Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (154..428): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAAAFDASVEEVDLIIGGEINSYRPTETTVVATT
Nearest Stachelhaus code(s):: Lys DAEDIGSVVK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

EV193_RS10525: X

AMP-binding (47..437): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LRSHFGLAMWGAAVLSGGAFNGYGASEVGIVAVA
Nearest Stachelhaus code(s):: Leu DAWFLGNIVK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_SGWQ01000004.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 32,503 - 55,142 nt. (total: 22,640 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

EV193_RS13485: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

EV193_RS13535: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: transketolase

EV193_RS13475: transketolase

smcogs: SMCOG1204: transketolase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.62	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.61	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.54	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.46	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000554.4	0.44	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002701.2	0.44	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.62	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.61	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.54	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.46	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000554.4	0.44	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002701.2	0.44	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for EV193_RS13495

EV193_RS13500

Leader:

MALLDLQGMDAAPQHGHGGGS

Core:

SASGHSCPSNLSVTLCGGTSGLSLLICH

Core with dehydrations:

DhaADhaGHDhaCysPDhaNLDhaVDhbLCysGGDhbDhaGLDhaLLICysH

antiSMASH-DB 4.0 matches for EV193_RS13500

100.0%

NZ_SGWQ01000004.1:

Lanthipeptides: EV193_RS13500_lanthipeptide

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

SASGHSCPSNLSVTLCGGTSGLSLLICH

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

92.9%

NZ_BNAU01000004.1:

Lanthipeptides: IE290_RS20710_lanthipeptide

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

SASG SCPSNLSVTLCGGTSGLS+LICH

1

SASGKSCPSNLSVTLCGGTSGLSVLICH

28

90.0%

NZ_FWXV01000003.1:

Lanthipeptides: B9C43_RS55710_lanthipeptide

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

S SGHSCPSNLSVTLCGGTSGLSLLICH

3

SNSGHSCPSNLSVTLCGGTSGLSLLICH

30

with 84 more sequence matches

Only the first 10 are displayed here.

89.3%

NZ_CP091196.1:

Lanthipeptides: L1857_RS00175_lanthipeptide

2

ASGHSCPSNLSVTLCGGTSGLSLLICH

28

ASG SCPSNLSVTLCGGTSGLS+LICH

1

ASGKSCPSNLSVTLCGGTSGLSVLICH

27

89.3%

NZ_KB903814.1:

Lanthipeptides: A3G1_RS40055_lanthipeptide

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

S SGHSCPSNLSVTLCGG+SGLS+LICH

1

STSGHSCPSNLSVTLCGGSSGLSVLICH

28

89.3%

NZ_RSEB01000004.1and 1 other:

NZ_WIAO01000001.1 Lanthipeptides: GFD30_RS00960_lanthipeptide

Lanthipeptides: EIW28_RS16895_lanthipeptide

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

SASGHSCPSNLS TLCGGTSGLS+L+CH

1

SASGHSCPSNLSATLCGGTSGLSVLLCH

28

86.7%

NZ_JAAATY010000001.1:

Lanthipeptides: GC106_RS02675_lanthipeptide

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

S SGHSCPSNLS+TLCGGTSGLSLLICH

3

SNSGHSCPSNLSLTLCGGTSGLSLLICH

30

80.6%

NZ_FNGF01000002.1:

Lanthipeptides: BLS99_RS06065_lanthipeptide

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

SASGHSCPSNLS TLCGGTSGLS+L+CH

4

SASGHSCPSNLSATLCGGTSGLSILLCH

31

80.0%

NZ_CDME01000008.1:

Lanthipeptides: BN1199_RS56280_lanthipeptide

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

S SGHSCPSNLS+TLC G+SGLSLLICH

3

SNSGHSCPSNLSLTLCDGSSGLSLLICH

30

80.0%

NZ_CP012752.1:

Lanthipeptides: AOZ06_RS57330_lanthipeptide

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

S SGHSCPSNLS+TLC G SGLSLLICH

3

SNSGHSCPSNLSLTLCNGGSGLSLLICH

30

78.6%

NZ_FNAD01000001.1:

Lanthipeptides: BLQ63_RS02575_lanthipeptide

2

ASGHSCPSNLSVTLCGGTSGLSLLICH

28

+SGHSCPSNLS LCGGTSGLS+L+CH

1

SSGHSCPSNLSAALCGGTSGLSILLCH

27

78.6%

NZ_JAGFNP010000002.1:

Lanthipeptides: J5V16_RS05050_lanthipeptide

3

SGHSCPSNLSVTLCGGTSGLSLLICH

28

SGHSCPSNLS TLCGGTS LS+L+CH

1

SGHSCPSNLSATLCGGTSSLSVLLCH

26

78.6%

NZ_JAPZVR010000008.1:

Lanthipeptides: O2L52_RS16615_lanthipeptide

3

SGHSCPSNLSVTLCGGTSGLSLLICH

28

SGHSCPSNLS TLCGGTS LS+L+CH

1

SGHSCPSNLSATLCGGTSSLSILLCH

26

MIBiG 4.0 matches for EV193_RS13500

21.4%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

9

SNLSVTLC

16

S+LSV LC

13

SSLSVVLC

20

17.9%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

20

SGLSLLICH

28

S +SLL+C

3

SQVSLLVCE

11

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 19.26

Confidence: medium

Additional weak hits (5):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.86 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.10 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.74 out of 26.85

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

EV193_RS13500 - Class III

Cleavage pHMM score: 7.40

RODEO score: 0

Monoisotopic mass: 2538.3 Da

Molecular weight: 2539.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2557.9 Da N = 1; 2575.9 Da N = 2; 2593.9 Da N = 3; 2611.9 Da N = 4; 2630.0 Da N = 5; 2648.0 Da N = 6

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_SGWQ01000004.1 - Region 2 - NAPAA

Download region GenBank file

Download region SVG

Location: 94,630 - 135,150 nt. (total: 40,521 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EV193_RS13935: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: acyltransferase glycosyltransferase

EV193_RS13835: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

EV193_RS13965: acyltransferase

smcogs: SMCOG1141: acyltransferase

Isomerases: mutase

EV193_RS13790: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase

EV193_RS13885: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.67	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002274.2	0.60	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.67	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002274.2	0.60	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 24.74 out of 26.33

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.96 out of 29.72

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.89 out of 29.72

Confidence: medium

Additional weak hits (12):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.09 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.63 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.61 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.42 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.35 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.61 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 94629 - 135150:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EV193_RS13845: X

AMP-binding (36..407): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

EV193_RS13885: X

AMP-binding (24..469): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: EADLFARAITCAVAVAYSEYTKLRAALGSRCVAA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
NtrC	Nitrogen regulatory protein C

NZ_SGWQ01000004.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 138,363 - 161,827 nt. (total: 23,465 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EV193_RS14055: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

EV193_RS14060: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.55	terpene	isorenieratene	Streptomyces argillaceus
BGC0000640.3	0.54	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.51	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000641.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000649.3	0.50	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.47	terpene	carotenoid	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.55	terpene	isorenieratene	Streptomyces argillaceus
BGC0000640.3	0.54	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.51	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000641.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000649.3	0.50	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.47	terpene	carotenoid	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

EV193_RS14050: PT_phytoene_like

Domain 1 (15 - 303): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

EV193_RS14060: PT_FPPS_like

Domain 1 (24 - 329): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 23.59 out of 24.78

Confidence: strong

Additional weak hits (6):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.83 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.33 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.42 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.56 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response

NZ_SGWQ01000004.1 - Region 4 - CDPS,T1PKS

Download region GenBank file

Download region SVG

Location: 405,603 - 451,686 nt. (total: 46,084 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

EV193_RS15440: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

EV193_RS15510: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

EV193_RS15520: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

EV193_RS15560: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: transferase

EV193_RS15500: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: esterase protease

EV193_RS15430: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

EV193_RS15505: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: ligase synthase

EV193_RS15490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EV193_RS15495: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.54	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.54	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.53	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002276.2	0.51	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001948.3	0.46	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001273.3	0.43	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.42	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.42	PKS	(-)-Mellein	Parastagonospora nodorum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (10):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.59 out of 30.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.74 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.78 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.38 out of 33.14

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 405602 - 451686:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 405700 - 426414:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EV193_RS15490: Acetyl-CoA

CAL_domain (55..491): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 43.1
fatty_acid: 17.3
NH2: 3.7
shikimic_acid: 2.4
AHBA: 2.1

EV193_RS15495: mmal

PKS_AT (603..881): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 70.8%; Propionyl-CoA: 66.7%; Malonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 95.9
Methoxymalonyl-CoA: 93.0
Malonyl-CoA: 83.4
Ethylmalonyl-CoA: 70.5
trans-1,2-CPDA: 64.9
fatty_acid: 61.1
Isobutyryl-CoA: 49.4
Propionyl-CoA: 45.8
Benzoyl-CoA: 31.2
2-Methylbutyryl-CoA: 31.0
Acetyl-CoA: 30.2
CHC-CoA: 30.0
inactive: 20.2
3-Methylbutyryl-CoA: 19.3

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_SGWQ01000006.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 125,389 - 168,874 nt. (total: 43,486 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EV193_RS19075: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: formyltransferase

EV193_RS19125: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Lyases: dehydratase

EV193_RS19105: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000494.5	0.41	ribosomal	uberolysin	Streptococcus uberis
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.40	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001627.4	0.40	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0002582.3	0.39	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000391.5	0.38	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001387.5	0.36	other (other)	nucleocidin	Streptomyces calvus
BGC0002218.2	0.36	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000494.5	0.41	ribosomal	uberolysin	Streptococcus uberis
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0001184.4	0.40	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001627.4	0.40	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0002582.3	0.39	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000391.5	0.38	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001387.5	0.36	other (other)	nucleocidin	Streptomyces calvus
BGC0002218.2	0.36	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 27.38 out of 29.65

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.52 out of 24.78

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.27 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.07 out of 24.78

Confidence: medium

Additional weak hits (14):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.81 out of 36.54

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.59 out of 29.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.05 out of 19.26

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.74 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.29 out of 30.98

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.59 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.42 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.58 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 125388 - 168874:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EV193_RS19105: X

AMP-binding (72..502): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MGMMHIAGRVAGMVMCGSAFNGYGATEAGGIVTI
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_SGWQ01000007.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 31,012 nt. (total: 31,012 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

EV193_RS20570: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

EV193_RS20590: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

EV193_RS20640: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acylase glycosyltransferase

EV193_RS20580: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

EV193_RS20610: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: dehydratase

EV193_RS20615: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

EV193_RS20575: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (8):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.86 out of 28.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.74 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.12 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.65 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.76 out of 29.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.83 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.80 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.07 out of 27.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 31012:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (ccmal)
Non-colinear ordering:: EV193_RS20580 + EV193_RS20575

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EV193_RS20575: mal

PKS_AT (523..803): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.5
inactive: 97.4
Methoxymalonyl-CoA: 83.4
Methylmalonyl-CoA: 69.2
Propionyl-CoA: 50.6
Isobutyryl-CoA: 33.5
Ethylmalonyl-CoA: 30.8
2-Methylbutyryl-CoA: 28.4
CHC-CoA: 19.2
Acetyl-CoA: 13.3
trans-1,2-CPDA: 12.2
Benzoyl-CoA: 10.6
fatty_acid: 10.2
3-Methylbutyryl-CoA: 0.0

EV193_RS20580: mal

PKS_AT (567..863): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; Ethylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.7
inactive: 90.4
Methoxymalonyl-CoA: 70.3
Methylmalonyl-CoA: 52.9
Propionyl-CoA: 29.9
Ethylmalonyl-CoA: 28.9
2-Methylbutyryl-CoA: 24.3
Acetyl-CoA: 19.7
Benzoyl-CoA: 16.6
trans-1,2-CPDA: 15.3
CHC-CoA: 15.1
Isobutyryl-CoA: 14.9
fatty_acid: 10.7
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_SGWQ01000007.1 - Region 2 - butyrolactone

Download region GenBank file

Download region SVG

Location: 292,684 - 303,628 nt. (total: 10,945 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

EV193_RS21855: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.68	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.48	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001779.5	0.42	ribosomal	siamycin	Streptomyces nodosus
BGC0002307.3	0.42	ribosomal	humidimycin	Streptomyces humidus
BGC0002015.4	0.42	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002073.3	0.40	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000521.3	0.40	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.68	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.48	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001779.5	0.42	ribosomal	siamycin	Streptomyces nodosus
BGC0002307.3	0.42	ribosomal	humidimycin	Streptomyces humidus
BGC0002015.4	0.42	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002073.3	0.40	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000521.3	0.40	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

Additional weak hits (5):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.91 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.58 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.21 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_SGWQ01000010.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 91,943 - 116,388 nt. (total: 24,446 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

EV193_RS25350: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

EV193_RS25415: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase

EV193_RS25390: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

EV193_RS25345: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthetase

EV193_RS25395: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

EV193_RS25400: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000659.3	0.59	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.54	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001911.3	0.54	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.53	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000286.3	0.51	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000677.5	0.50	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.49	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001948.3	0.48	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001197.5	0.48	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.48	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000659.3	0.59	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.54	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001911.3	0.54	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.53	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000286.3	0.51	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000677.5	0.50	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.49	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001948.3	0.48	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001197.5	0.48	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.48	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

EV193_RS25395: PT_FPPS_like

Domain 1 (45 - 337): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

EV193_RS25400: PT_FPPS_like

Domain 1 (47 - 310): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

EV193_RS25405: T2TS

Domain 1 (6 - 480): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

EV193_RS25410: T1TS

Domain 1 (27 - 232): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.89 out of 26.85

Confidence: medium

Additional weak hits (8):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.69 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.03 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.62 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.06 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_SGWQ01000010.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 116,961 - 139,463 nt. (total: 22,503 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

EV193_RS25545: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.72	ribosomal	ulleungdin	Streptomyces sp.
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0001779.5	0.69	ribosomal	siamycin	Streptomyces nodosus
BGC0001493.5	0.68	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0000579.4	0.67	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0001552.3	0.64	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001655.3	0.63	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002318.2	0.59	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0002074.2	0.59	ribosomal	huascopeptin	Streptomyces huasconensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.72	ribosomal	ulleungdin	Streptomyces sp.
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0001779.5	0.69	ribosomal	siamycin	Streptomyces nodosus
BGC0001493.5	0.68	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0000579.4	0.67	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0001552.3	0.64	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001655.3	0.63	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002318.2	0.59	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0002074.2	0.59	ribosomal	huascopeptin	Streptomyces huasconensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (2):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.72 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.98 out of 26.06

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 84; Score: 82.3

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_SGWQ01000010.1 - Region 3 - hglE-KS

Download region GenBank file

Download region SVG

Location: 229,720 - 269,051 nt. (total: 39,332 nt) Show pHMM detection rules used

Region on contig edge.

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

EV193_RS26105: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

EV193_RS26180: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase glycosyltransferase

EV193_RS26185: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

EV193_RS26190: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

EV193_RS26205: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: amidase hydrolase

EV193_RS26120: amidase

smcogs: SMCOG1105: amidase

EV193_RS26200: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

EV193_RS26220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000869.5	0.51	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0000863.3	0.50	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000056.3	0.50	PKS	esperamicin	Actinomadura verrucosospora
BGC0002648.2	0.49	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000869.5	0.51	other (other)	heterocyst glycolipids	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0000863.3	0.50	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0000056.3	0.50	PKS	esperamicin	Actinomadura verrucosospora
BGC0002648.2	0.49	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.49 out of 26.85

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.78 out of 30.22

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (17):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.10 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.97 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.30 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.45 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.74 out of 23.43

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.57 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.85 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.85 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.88 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.79 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.93 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.73 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 20.48 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 229719 - 269051:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EV193_RS26185: mal

PKS_AT (1198..1488): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 53.9
Methoxymalonyl-CoA: 25.7
inactive: 22.3
Propionyl-CoA: 17.1
Methylmalonyl-CoA: 16.1
trans-1,2-CPDA: 10.5
Ethylmalonyl-CoA: 7.7
CHC-CoA: 1.5
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

EV193_RS26190: mmal

PKS_AT (126..346): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 15.2
Isobutyryl-CoA: 9.8
Malonyl-CoA: 4.5
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

EV193_RS26220: X

AMP-binding (201..594): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AVLAWGLAALQMFAASSGSYNFYGSTEVSWATIA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ClgR	Caseinolytic protease gene regulator
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism

NZ_SGWQ01000011.1 - Region 1 - T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 48,419 - 174,017 nt. (total: 125,599 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EV193_RS26455: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase aminotransferase glycosyltransferase transferase

EV193_RS26525: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

EV193_RS26625: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

EV193_RS26630: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

EV193_RS26645: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

EV193_RS26640: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

EV193_RS26760: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

EV193_RS26805: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: decarboxylase

EV193_RS26665: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Isomerases: mutase

EV193_RS26815: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

EV193_RS26530: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

EV193_RS26535: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

EV193_RS26540: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

EV193_RS26655: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EV193_RS26660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EV193_RS26680: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

EV193_RS26780: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	1.28	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	1.24	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.88	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.88	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.85	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.84	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.84	PKS	ACT-Toxin II	Alternaria alternata
BGC0000041.3	0.83	PKS	oronofacic acid	Pseudomonas syringae
BGC0000037.4	0.79	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001051.5	0.68	NRPS, PKS	thuggacin A	Sorangium cellulosum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.00 out of 29.51

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.98 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.45 out of 26.33

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.24 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.98 out of 24.78

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (21):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.74 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.58 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.96 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.20 out of 26.06

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.74 out of 29.72

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.42 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.16 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.44 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.96 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.76 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.62 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.61 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.53 out of 26.06

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.74 out of 29.72

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.86 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 48418 - 174017:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (ccmal - ccmal) + (ohmal - mal) + (Me-ccmal - ccmal)
Non-colinear ordering:: EV193_RS26680 + EV193_RS26530 + EV193_RS26535 + EV193_RS26540

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EV193_RS26530: mal - mal

PKS_AT (562..842): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 226.6
inactive: 124.0
Methoxymalonyl-CoA: 64.8
Methylmalonyl-CoA: 60.1
Isobutyryl-CoA: 43.2
Propionyl-CoA: 27.2
Acetyl-CoA: 22.7
Benzoyl-CoA: 21.0
Ethylmalonyl-CoA: 19.2
2-Methylbutyryl-CoA: 11.2
fatty_acid: 9.1
CHC-CoA: 5.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2233..2530): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.3
inactive: 114.9
Methoxymalonyl-CoA: 70.6
Methylmalonyl-CoA: 58.7
Isobutyryl-CoA: 34.0
Propionyl-CoA: 32.4
Ethylmalonyl-CoA: 23.9
Acetyl-CoA: 20.0
2-Methylbutyryl-CoA: 17.4
fatty_acid: 17.2
Benzoyl-CoA: 16.4
CHC-CoA: 10.6
3-Methylbutyryl-CoA: 6.9
trans-1,2-CPDA: 2.4

EV193_RS26535: mal - mal

PKS_AT (544..833): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 207.9
inactive: 120.9
Methoxymalonyl-CoA: 68.8
Methylmalonyl-CoA: 61.1
Propionyl-CoA: 37.1
Ethylmalonyl-CoA: 33.1
Isobutyryl-CoA: 24.3
Acetyl-CoA: 23.6
trans-1,2-CPDA: 18.5
CHC-CoA: 16.3
2-Methylbutyryl-CoA: 16.3
fatty_acid: 11.3
3-Methylbutyryl-CoA: 0.0
Benzoyl-CoA: -1.7

PKS_AT (2025..2316): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.0
inactive: 117.0
Methoxymalonyl-CoA: 57.4
Methylmalonyl-CoA: 43.6
Isobutyryl-CoA: 25.1
Propionyl-CoA: 23.5
Acetyl-CoA: 22.5
Benzoyl-CoA: 20.7
CHC-CoA: 15.8
Ethylmalonyl-CoA: 15.5
2-Methylbutyryl-CoA: 14.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

EV193_RS26540: mmal - mal

PKS_AT (568..864): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 220.0
Ethylmalonyl-CoA: 205.9
Methoxymalonyl-CoA: 181.0
2-Methylbutyryl-CoA: 163.2
trans-1,2-CPDA: 133.7
Propionyl-CoA: 119.2
Malonyl-CoA: 108.5
CHC-CoA: 92.3
Isobutyryl-CoA: 91.1
Benzoyl-CoA: 72.3
3-Methylbutyryl-CoA: 58.4
Acetyl-CoA: 53.7
inactive: 41.9
fatty_acid: 32.4

PKS_AT (2263..2552): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 91.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.8
inactive: 126.3
Methoxymalonyl-CoA: 58.5
Methylmalonyl-CoA: 51.3
Propionyl-CoA: 31.2
Acetyl-CoA: 24.7
Isobutyryl-CoA: 22.7
Ethylmalonyl-CoA: 19.1
Benzoyl-CoA: 17.2
2-Methylbutyryl-CoA: 15.8
CHC-CoA: 10.8
trans-1,2-CPDA: 10.0
fatty_acid: 9.9
3-Methylbutyryl-CoA: 0.0

EV193_RS26645: pk

PKS_AT (34..282): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

EV193_RS26655: X

AMP-binding (17..417): X

nrpys: bMe-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YLLFFDCGWFDCFSFFAGEENLYGPTELTITVTG
Nearest Stachelhaus code(s):: bMe-Asp DCFFFALITK (91% 8Å match); Ala DCFFFALITK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

EV193_RS26660: X

AMP-binding (6..402): X

nrpys: 3S-Abu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAIFWDYGLYKMPLTNTGAVRQFGQTECKRITIM
Nearest Stachelhaus code(s):: 3S-Abu DYYPTTQRIK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

EV193_RS26680: mal - mal

PKS_AT (660..965): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.1
inactive: 107.0
Methoxymalonyl-CoA: 61.4
Methylmalonyl-CoA: 46.5
Propionyl-CoA: 24.9
Isobutyryl-CoA: 22.2
Acetyl-CoA: 20.0
Benzoyl-CoA: 19.0
fatty_acid: 14.8
Ethylmalonyl-CoA: 11.8
CHC-CoA: 10.0
2-Methylbutyryl-CoA: 6.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2367..2667): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.3
inactive: 105.9
Methylmalonyl-CoA: 64.6
Methoxymalonyl-CoA: 64.5
Propionyl-CoA: 37.3
Isobutyryl-CoA: 35.5
Acetyl-CoA: 22.7
Ethylmalonyl-CoA: 21.9
Benzoyl-CoA: 21.2
2-Methylbutyryl-CoA: 19.5
CHC-CoA: 15.0
trans-1,2-CPDA: 11.6
fatty_acid: 10.6
3-Methylbutyryl-CoA: 0.0

EV193_RS26780: X

AMP-binding (21..478): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SAFLHIARLISDLGLY-----------NGRHTIA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_SGWQ01000011.1 - Region 2 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 254,811 - 267,531 nt. (total: 12,721 nt) Show pHMM detection rules used

Region on contig edge.

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

EV193_RS27335: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

EV193_RS27345: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

EV193_RS27360: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Isomerases: racemase

EV193_RS27365: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002255.3	0.36	PKS	lijiquinone	Ascomycota sp. F53
BGC0001739.3	0.35	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0002285.2	0.34	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001386.5	0.33	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002083.3	0.32	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0000913.3	0.32	other (other)	MK-8	Enterobacter cloacae
BGC0000883.5	0.32	other (other)	arginomycin	Streptomyces arginensis
BGC0000651.5	0.31	terpene	KS-505a	Streptomyces argenteolus
BGC0001102.5	0.30	NRPS, PKS	malleilactone, bis-malleicyprol, malleicyprol	Burkholderia thailandensis E264; ATCC 700388

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002255.3	0.36	PKS	lijiquinone	Ascomycota sp. F53
BGC0001739.3	0.35	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0002285.2	0.34	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001386.5	0.33	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002083.3	0.32	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0000913.3	0.32	other (other)	MK-8	Enterobacter cloacae
BGC0000883.5	0.32	other (other)	arginomycin	Streptomyces arginensis
BGC0000651.5	0.31	terpene	KS-505a	Streptomyces argenteolus
BGC0001102.5	0.30	NRPS, PKS	malleilactone, bis-malleicyprol, malleicyprol	Burkholderia thailandensis E264; ATCC 700388

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.99 out of 21.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_SGWQ01000013.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 23,967 nt. (total: 23,967 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

EV193_RS28285: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: aminotransferase

EV193_RS28290: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: hydrolase

EV193_RS28280: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

EV193_RS28265: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

EV193_RS28275: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

EV193_RS28320: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000957.5	0.48	NRPS, PKS	mycotrienin I	Streptomyces sp. XZQH13
BGC0002518.3	0.45	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000597.4	0.44	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002128.3	0.43	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001168.5	0.42	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0000131.5	0.41	PKS	pyrrolomycin	Streptomyces sp. UC 11065

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000957.5	0.48	NRPS, PKS	mycotrienin I	Streptomyces sp. XZQH13
BGC0002518.3	0.45	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000597.4	0.44	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002128.3	0.43	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001168.5	0.42	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0000131.5	0.41	PKS	pyrrolomycin	Streptomyces sp. UC 11065

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.45 out of 26.33

Confidence: medium

Additional weak hits (14):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.10 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.24 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.60 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.17 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.78 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.96 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.17 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.83 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.80 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.06 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.24 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.42 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.28 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.71 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 23967:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EV193_RS28265: AHBA

CAL_domain (34..442): AHBA

minowa: AHBA

Prediction, score:

AHBA: 466.2
shikimic_acid: 293.6
Acetyl-CoA: 14.3
fatty_acid: 0.0
NH2: 0.0

EV193_RS28320: X

AMP-binding (78..334): X

nrpys: Asp, Asn

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: WVMHYGLFTGGGTCVFGAELDIYGLSEIIGGVAC
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator

NZ_SGWQ01000013.1 - Region 2 - aminopolycarboxylic-acid

Download region GenBank file

Download region SVG

Location: 109,689 - 125,764 nt. (total: 16,076 nt) Show pHMM detection rules used

aminopolycarboxylic-acid: (AesA and AesB and AesC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

EV193_RS28775: aminotransferase

smcogs: SMCOG1019: aminotransferase

EV193_RS28780: aminotransferase

smcogs: SMCOG1019: aminotransferase

EV193_RS28790: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deaminase

EV193_RS28800: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase

EV193_RS28805: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

EV193_RS28785: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.63	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.55	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.52	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0001206.5	0.41	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000943.5	0.40	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001896.4	0.40	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0002213.3	0.39	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001488.3	0.38	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0000188.5	0.38	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.63	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.55	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.52	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0001206.5	0.41	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000943.5	0.40	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001896.4	0.40	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0002213.3	0.39	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001488.3	0.38	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0000188.5	0.38	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

Additional weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.25 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.24 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.20 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.11 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.95 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.45 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.54 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.34 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.03 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.62 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_SGWQ01000017.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 21,273 - 42,163 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EV193_RS31260: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Hydrolases: protease

EV193_RS31290: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

EV193_RS34520: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0000597.4	0.48	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001972.4	0.42	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000595.3	0.39	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000842.5	0.33	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000843.5	0.32	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000625.5	0.30	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0001335.5	0.30	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0000847.4	0.30	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0000597.4	0.48	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001972.4	0.42	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000595.3	0.39	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000842.5	0.33	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000843.5	0.32	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0000625.5	0.30	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0001335.5	0.30	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0000847.4	0.30	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

EV193_RS31275: T1TS

Domain 1 (49 - 264): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein

NZ_SGWQ01000025.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 2,289 nt. (total: 2,289 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

EV193_RS33015: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002275.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002171.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002240.3	0.51	PKS	BAB, BAA	Metarhizium anisopliae
BGC0000393.5	0.50	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002275.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002171.2	0.55	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002240.3	0.51	PKS	BAB, BAA	Metarhizium anisopliae
BGC0000393.5	0.50	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

EV193_RS33015: mmal

PKS_AT (333..637): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.4
Ethylmalonyl-CoA: 198.5
Methoxymalonyl-CoA: 181.1
2-Methylbutyryl-CoA: 135.1
trans-1,2-CPDA: 121.7
Propionyl-CoA: 116.1
Malonyl-CoA: 96.0
CHC-CoA: 92.0
Isobutyryl-CoA: 89.7
Benzoyl-CoA: 74.2
Acetyl-CoA: 61.3
3-Methylbutyryl-CoA: 59.8
fatty_acid: 35.9
inactive: 33.5

Link to PARAS substrate predictor