GCF_004138485.1 - 17 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_ML142848.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	thioamitides	334,150	355,897

NZ_RYEV01000003.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	arylpolyene	209,275	254,949	Low	APE Vf	other:other
Region 2.2	lassopeptide	1,044,469	1,067,111
Region 2.3	hydrogen-cyanide	1,075,308	1,088,597
Region 2.4	lassopeptide	1,386,173	1,408,777

NZ_RYEV01000004.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NRPS	20,978	63,842
Region 3.2	redox-cofactor	475,802	497,896

NZ_RYEV01000005.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	terpene	493,886	514,719
Region 4.2	NRP-metallophore,NRPS	1,151,863	1,252,049	Low	delftibactin A/delftibactin B	NRPS:Type I+PKS

NZ_RYEV01000006.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	terpene-precursor	112,338	133,288

NZ_RYEV01000007.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	RiPP-like	308,787	319,614

NZ_RYEV01000008.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	RiPP-like	39,540	50,391

NZ_RYEV01000010.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRPS-like	1	26,712	High	rhizomide A/rhizomide B/rhizomide C	NRPS:Type I
Region 9.2	betalactone	195,126	237,780

NZ_RYEV01000011.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NRPS-like	1	38,367
Region 10.2	betalactone	248,810	275,795

NZ_RYEV01000013.1 (Peristeroidobacter soli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	NRPS	1	44,543	Low	nostopeptolide A2	NRPS:Type I+PKS

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	thioamitides	334,150	355,897
Region 2.1	arylpolyene	209,275	254,949	Low	APE Vf	other:other
Region 2.2	lassopeptide	1,044,469	1,067,111
Region 2.3	hydrogen-cyanide	1,075,308	1,088,597
Region 2.4	lassopeptide	1,386,173	1,408,777
Region 3.1	NRPS	20,978	63,842
Region 3.2	redox-cofactor	475,802	497,896
Region 4.1	terpene	493,886	514,719
Region 4.2	NRP-metallophore,NRPS	1,151,863	1,252,049	Low	delftibactin A/delftibactin B	NRPS:Type I+PKS
Region 5.1	terpene-precursor	112,338	133,288
Region 6.1	RiPP-like	308,787	319,614
Region 7.1	RiPP-like	39,540	50,391
Region 9.1	NRPS-like	1	26,712	High	rhizomide A/rhizomide B/rhizomide C	NRPS:Type I
Region 9.2	betalactone	195,126	237,780
Region 10.1	NRPS-like	1	38,367
Region 10.2	betalactone	248,810	275,795
Region 12.1	NRPS	1	44,543	Low	nostopeptolide A2	NRPS:Type I+PKS

No secondary metabolite regions were found in these records:: NZ_RYEV01000009.1 (Peristeroidobacter soli); NZ_RYEV01000012.1 (Peristeroidobacter soli); NZ_RYEV01000014.1 (Peristeroidobacter soli); NZ_RYEV01000015.1 (Peristeroidobacter soli); NZ_RYEV01000016.1 (Peristeroidobacter soli); NZ_RYEV01000017.1 (Peristeroidobacter soli); NZ_RYEV01000018.1 (Peristeroidobacter soli)

Compact view

NZ_ML142848.1 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 334,150 - 355,897 nt. (total: 21,748 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

EKO19_RS01290: isochorismatase

smcogs: SMCOG1027: isochorismatase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.48	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0000577.3	0.43	ribosomal	sphingonodin II	Sphingobium japonicum UT26S
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000625.5	0.38	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001157.6	0.37	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000469.6	0.35	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001860.4	0.30	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000193.3	0.30	PKS	aclacinomycin	Streptomyces galilaeus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.48	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0000577.3	0.43	ribosomal	sphingonodin II	Sphingobium japonicum UT26S
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000625.5	0.38	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001157.6	0.37	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000469.6	0.35	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001860.4	0.30	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000193.3	0.30	PKS	aclacinomycin	Streptomyces galilaeus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (7):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.47 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.43 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.06 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.95 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.66 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.12 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_RYEV01000003.1 - Region 1 - arylpolyene

Download region GenBank file

Download region SVG

Location: 209,275 - 254,949 nt. (total: 45,675 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EKO19_RS09825: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acyltransferase formyltransferase halogenase

EKO19_RS09730: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

EKO19_RS09795: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

EKO19_RS09800: acyltransferase

smcogs: SMCOG1141: acyltransferase

EKO19_RS09820: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

EKO19_RS09865: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

Hydrolases: deformylase

EKO19_RS09725: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: ligase synthase

EKO19_RS09810: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

EKO19_RS09830: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

EKO19_RS09835: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EKO19_RS09855: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.55	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000840.5	0.54	other (other)	xanthomonadin I	Xanthomonas oryzae pv. oryzae
BGC0002510.2	0.49	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001197.5	0.48	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001987.2	0.48	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000231.5	0.47	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002547.2	0.46	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces youssoufiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001258.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.55	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000840.5	0.54	other (other)	xanthomonadin I	Xanthomonas oryzae pv. oryzae
BGC0002510.2	0.49	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001197.5	0.48	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001987.2	0.48	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000231.5	0.47	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002547.2	0.46	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces youssoufiensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

EKO19_RS09835: X

AMP-binding (93..287): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ADKHMEMSVL-LISVSATAVEMFGSTETCVFASR
Nearest Stachelhaus code(s):: S-bohPhe or Phe DALIVAAVCK (24% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_RYEV01000003.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1,044,469 - 1,067,111 nt. (total: 22,643 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

EKO19_RS13400: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: hydrolase

EKO19_RS13430: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000580.3	0.63	ribosomal	xanthomonin II, xanthomonin I	Xanthomonas gardneri ATCC 19865
BGC0000576.3	0.61	ribosomal	rubrivinodin	Rubrivivax gelatinosus IL144
BGC0000573.3	0.58	ribosomal	caulonodin I, caulonodin II	Caulobacter sp. K31
BGC0000577.3	0.54	ribosomal	sphingonodin II	Sphingobium japonicum UT26S
BGC0001786.3	0.53	ribosomal	subterisin	Novosphingobium subterraneum
BGC0000595.3	0.38	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001810.3	0.38	PKS	trehangelin	Polymorphospora rubra
BGC0001424.4	0.33	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001423.4	0.33	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001428.4	0.33	NRPS, PKS	myxochromide A	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000580.3	0.63	ribosomal	xanthomonin II, xanthomonin I	Xanthomonas gardneri ATCC 19865
BGC0000576.3	0.61	ribosomal	rubrivinodin	Rubrivivax gelatinosus IL144
BGC0000573.3	0.58	ribosomal	caulonodin I, caulonodin II	Caulobacter sp. K31
BGC0000577.3	0.54	ribosomal	sphingonodin II	Sphingobium japonicum UT26S
BGC0001786.3	0.53	ribosomal	subterisin	Novosphingobium subterraneum
BGC0000595.3	0.38	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001810.3	0.38	PKS	trehangelin	Polymorphospora rubra
BGC0001424.4	0.33	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001423.4	0.33	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001428.4	0.33	NRPS, PKS	myxochromide A	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for allorf_1057207_1057299

allorf_1057207_1057299

Leader:

MIKLGKVSQETR

Full core:

DTKFLTDPETDGLPQIFF

Putative macrolactam:

DTKFLTDPE

antiSMASH-DB 4.0 matches for allorf_1057207_1057299

100.0%

NZ_RYEV01000003.1:

Lassopeptides: allorf_1057207_1057299_lassopeptide

1

DTKFLTDPETDGLPQIFF

18

DTKFLTDPETDGLPQIFF

1

DTKFLTDPETDGLPQIFF

18

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.27 out of 25.88

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.25 out of 20.01

Confidence: medium

Additional weak hits (2):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.01 out of 39.62

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

allorf_1057207_1057299 - Class II: Cleavage pHMM score: 9.30; RODEO score: 20; Monoisotopic mass: 2065.0 Da; Molecular weight: 2066.3 Da; Number of bridges: 0

RRE predictions

: RRE type: Lasso_Fused_RRE; Location: 5 - 74; Score: 45.7

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
PsrA	Oleic acid responsive regulator

NZ_RYEV01000003.1 - Region 3 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 1,075,308 - 1,088,597 nt. (total: 13,290 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

EKO19_RS13520: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002343.3	0.32	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0000997.4	0.29	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0002044.2	0.29	NRPS	empedopeptin	Massilia sp. YMA4
BGC0002083.3	0.28	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0002087.3	0.27	NRPS, PKS	gladiostatin A	Burkholderia gladioli 238
BGC0000966.5	0.25	NRPS, PKS	caerulomycin A	Actinoalloteichus sp. WH1-2216-6
BGC0002021.3	0.23	PKS	fogacin, fogacin B, fogacin C	Actinoplanes missouriensis 431
BGC0000466.5	0.23	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0000291.5	0.23	NRPS	A54145	Streptomyces fradiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002343.3	0.32	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0000997.4	0.29	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0002044.2	0.29	NRPS	empedopeptin	Massilia sp. YMA4
BGC0002083.3	0.28	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0002087.3	0.27	NRPS, PKS	gladiostatin A	Burkholderia gladioli 238
BGC0000966.5	0.25	NRPS, PKS	caerulomycin A	Actinoalloteichus sp. WH1-2216-6
BGC0002021.3	0.23	PKS	fogacin, fogacin B, fogacin C	Actinoplanes missouriensis 431
BGC0000466.5	0.23	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0000291.5	0.23	NRPS	A54145	Streptomyces fradiae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.30 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.06 out of 28.19

Confidence: medium

Additional weak hits (4):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.47 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.46 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.78 out of 29.38

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.33 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ZuR variant 1	Zinc-responsive repressor

NZ_RYEV01000003.1 - Region 4 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1,386,173 - 1,408,777 nt. (total: 22,605 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EKO19_RS14805: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

EKO19_RS14815: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Hydrolases: hydrolase

EKO19_RS14775: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000576.3	0.61	ribosomal	rubrivinodin	Rubrivivax gelatinosus IL144
BGC0000577.3	0.52	ribosomal	sphingonodin II	Sphingobium japonicum UT26S
BGC0000573.3	0.52	ribosomal	caulonodin I, caulonodin II	Caulobacter sp. K31
BGC0001786.3	0.52	ribosomal	subterisin	Novosphingobium subterraneum
BGC0000580.3	0.51	ribosomal	xanthomonin II, xanthomonin I	Xanthomonas gardneri ATCC 19865
BGC0001549.3	0.45	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000575.5	0.45	ribosomal	lariatin	Rhodococcus jostii
BGC0001645.3	0.44	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000576.3	0.61	ribosomal	rubrivinodin	Rubrivivax gelatinosus IL144
BGC0000577.3	0.52	ribosomal	sphingonodin II	Sphingobium japonicum UT26S
BGC0000573.3	0.52	ribosomal	caulonodin I, caulonodin II	Caulobacter sp. K31
BGC0001786.3	0.52	ribosomal	subterisin	Novosphingobium subterraneum
BGC0000580.3	0.51	ribosomal	xanthomonin II, xanthomonin I	Xanthomonas gardneri ATCC 19865
BGC0001549.3	0.45	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000575.5	0.45	ribosomal	lariatin	Rhodococcus jostii
BGC0001645.3	0.44	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for EKO19_RS39500

EKO19_RS39500

Leader:

MTELEEGMDIELLDLGDAMLETR

Full core:

ESGMYPIVFDSYYLLGERVP

Putative macrolactam:

antiSMASH-DB 4.0 matches for EKO19_RS39500

100.0%

NZ_RYEV01000003.1:

Lassopeptides: allorf_1398879_1399046_lassopeptide

1

ESGMYPIVFDSYYLLGERVP

20

ESGMYPIVFDSYYLLGERVP

1

ESGMYPIVFDSYYLLGERVP

20

70.0%

NZ_BLJO01000009.1:

Lassopeptides: GYH35_RS35205_lassopeptide

1

ESGMYPIVFDSYYLLGERVP

20

+ G YPI+FDS YLLGER P

1

QYGTYPIMFDSIYLLGERHP

20

21.4%

NZ_CP026498.1:

Lanthipeptides: allorf_09403111_09403221_lanthipeptide

1

ESGMYPIVF

9

ESG+YP F

13

ESGLYPSFF

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

Additional weak hits (5):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.37 out of 18.57

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.99 out of 36.53

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.46 out of 32.74

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.87 out of 30.98

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.99 out of 28.14

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

EKO19_RS39500 - Class II: Cleavage pHMM score: 9.10; RODEO score: 21; Monoisotopic mass: 2316.1 Da; Molecular weight: 2317.6 Da; Number of bridges: 0

RRE predictions

: RRE type: Lasso_Fused_RRE; Location: 5 - 85; Score: 39.9

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_RYEV01000004.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 20,978 - 63,842 nt. (total: 42,865 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

EKO19_RS15895: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: glucosidase

EKO19_RS15870: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: ligase synthase

EKO19_RS15900: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

EKO19_RS15925: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0000188.5	0.44	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001844.4	0.44	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0000800.5	0.44	saccharide	xanthan	Xanthomonas campestris
BGC0001488.3	0.42	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0000393.5	0.40	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0000188.5	0.44	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001844.4	0.44	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0000800.5	0.44	saccharide	xanthan	Xanthomonas campestris
BGC0001488.3	0.42	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0000393.5	0.40	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

Additional weak hits (8):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.93 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.19 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.15 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.44 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.37 out of 30.22

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.30 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.47 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

EKO19_RS15925: X

AMP-binding (470..861): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MALHSHVALIEGNLILSGGCGHRGITVASALSTI
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis

NZ_RYEV01000004.1 - Region 2 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 475,802 - 497,896 nt. (total: 22,095 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

EKO19_RS17895: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001733.3	0.43	ribosomal	PcpA	Pleurocapsa sp. PCC 7327
BGC0002346.3	0.42	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.40	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000516.4	0.39	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0001149.5	0.36	NRPS, saccharide	brabantamide A	Pseudomonas sp. SHC52
BGC0000451.5	0.36	NRPS	turnerbactin	Teredinibacter turnerae T7901
BGC0001346.4	0.36	NRPS	bananamide 1, bananamide 2, bananamide 3	Pseudomonas fluorescens
BGC0000411.5	0.35	NRPS	putisolvin	Pseudomonas putida
BGC0002548.2	0.35	NRPS	bananamide F, bananamide D, bananamide G, bananamide E	Pseudomonas sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001733.3	0.43	ribosomal	PcpA	Pleurocapsa sp. PCC 7327
BGC0002346.3	0.42	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.40	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000516.4	0.39	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0001149.5	0.36	NRPS, saccharide	brabantamide A	Pseudomonas sp. SHC52
BGC0000451.5	0.36	NRPS	turnerbactin	Teredinibacter turnerae T7901
BGC0001346.4	0.36	NRPS	bananamide 1, bananamide 2, bananamide 3	Pseudomonas fluorescens
BGC0000411.5	0.35	NRPS	putisolvin	Pseudomonas putida
BGC0002548.2	0.35	NRPS	bananamide F, bananamide D, bananamide G, bananamide E	Pseudomonas sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (8):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.11 out of 25.88

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.24 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.86 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 23.43

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 1 - 86; Score: 92.8

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_RYEV01000005.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 493,886 - 514,719 nt. (total: 20,834 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EKO19_RS23765: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

EKO19_RS23800: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: methyltransferase

EKO19_RS23780: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthase

EKO19_RS23755: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002404.2	0.41	other (other)	falcarindiol	Solanum lycopersicum
BGC0000633.3	0.39	terpene	carotenoid	Streptomyces avermitilis
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000393.5	0.37	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002218.2	0.36	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000204.5	0.35	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002237.3	0.35	PKS	dichlorodiaporthin	Aspergillus oryzae RIB40
BGC0001723.5	0.35	PKS	oviedomycin	Streptomyces antibioticus
BGC0002000.4	0.33	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002404.2	0.41	other (other)	falcarindiol	Solanum lycopersicum
BGC0000633.3	0.39	terpene	carotenoid	Streptomyces avermitilis
BGC0000234.5	0.38	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000393.5	0.37	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002218.2	0.36	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000204.5	0.35	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002237.3	0.35	PKS	dichlorodiaporthin	Aspergillus oryzae RIB40
BGC0001723.5	0.35	PKS	oviedomycin	Streptomyces antibioticus
BGC0002000.4	0.33	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

EKO19_RS23770: PT_phytoene_like

Domain 1 (20 - 274): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.33 out of 27.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

Additional weak hits (5):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.75 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.15 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.15 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator

NZ_RYEV01000005.1 - Region 2 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 1,151,863 - 1,252,049 nt. (total: 100,187 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

EKO19_RS26350: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

EKO19_RS26420: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

EKO19_RS26435: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

EKO19_RS26470: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

EKO19_RS26485: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

EKO19_RS26515: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acyltransferase aminotransferase methyltransferase

EKO19_RS26425: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

EKO19_RS26430: methyltransferase

smcogs: SMCOG1089: methyltransferase

EKO19_RS26445: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

EKO19_RS26455: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase hydrolase phosphatase

EKO19_RS26300: thioesterase

smcogs: SMCOG1004: thioesterase

EKO19_RS26370: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

EKO19_RS26415: thioesterase

smcogs: SMCOG1004: thioesterase

EKO19_RS26490: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Isomerases: racemase

EKO19_RS26345: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

EKO19_RS26290: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

EKO19_RS26385: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EKO19_RS26440: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	1.01	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.99	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.98	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.94	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.94	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.93	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000342.4	0.92	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.92	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.91	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.88	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.79	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.78	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.77	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.77	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.76	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000342.4	0.76	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.30 out of 25.88

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.63 out of 25.88

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.19 out of 30.22

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

Additional weak hits (20):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.98 out of 32.74

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.34 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.00 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.48 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.19 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.05 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.22 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.30 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.68 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.04 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.28 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.13 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.76 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.44 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.80 out of 26.12

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.57 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.28 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.99 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.71 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 1151862 - 1252049:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Glu) + (Phe - Pro) + (NH2 - X - Gly - X - Thr - NMe-Asn) + (Asp - NMe-X) + (His) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EKO19_RS26370: Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (1163..1565): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASVKQMDCLVGGEFNVYGPTESTVDTTY
Nearest Stachelhaus code(s):: Glu DAKDLGVVDK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

EKO19_RS26385: Phe - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (512..909): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDAFTWESILLAGGDLNGYGPTEISVCASV
Nearest Stachelhaus code(s):: Leu DAWLLGAVCK (71% 8Å match); Leu or Phe DAWTIGGVCK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1592..1999): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDVAFQESFIITAGEHNHYGPTETHVVTAL
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

EKO19_RS26425: NH2 - X - Gly - X - Thr - Asn

Search NORINE for peptide: strict or relaxed

CAL_domain (44..481): NH2

minowa: NH2

Prediction, score:

NH2: 186.9
fatty_acid: 25.0
AHBA: 17.3
Acetyl-CoA: 4.5
shikimic_acid: -3.2

AMP-binding (1139..1537): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWRTFDVSVWEWHFFVGGQYNLYGPTEAAIDVSF
Nearest Stachelhaus code(s):: Ser DVWHFSLIDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2204..2593): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIAALEVQS-CGGEWNMYGPTETTIWSST
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3264..3670): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NSKAFDISVWQGESMATGEVNAYGPAECADDVTL
Nearest Stachelhaus code(s):: Dpr DIWEMTADDK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4350..4754): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5437..5833): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSVKLIVGGEYNEYGPTESTVGCVI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

EKO19_RS26430: Asp - X

Search NORINE for peptide: strict or relaxed

AMP-binding (516..912): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVSADLGHTVGKIILGGALNHYGPTETTVGILT
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1568..1966): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAIAFDAAGEQLYMIAGGEVNAYGPTETVITPTA
Nearest Stachelhaus code(s):: Arg DAEDIGAITK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

EKO19_RS26440: His

Search NORINE for peptide: strict or relaxed

AMP-binding (446..839): His

nrpys: His

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SSRSFDSSVAGWLAIVAGEVNEYGPTEGTVWSNA
Nearest Stachelhaus code(s):: His DSALIAEVWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

EKO19_RS26445: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (499..901): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HVASFDAFVEQPDLQATGELNTYGPTETVVTAMA
Nearest Stachelhaus code(s):: Ser DGEDQTTVTK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis

NZ_RYEV01000006.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 112,338 - 133,288 nt. (total: 20,951 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase synthetase

EKO19_RS27065: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

EKO19_RS27070: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000635.3	0.37	terpene	carotenoid	Paracoccus sp. N81106

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000635.3	0.37	terpene	carotenoid	Paracoccus sp. N81106

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

EKO19_RS27070: PT_FPPS_like

Domain 1 (49 - 315): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 25.31

Confidence: strong

Additional weak hits (3):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.81 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor

NZ_RYEV01000007.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 308,787 - 319,614 nt. (total: 10,828 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001992.3	0.35	other (other)	thioguanine	Erwinia amylovora CFBP1430
BGC0000255.5	0.26	PKS	pederin	Uncultured bacterium
BGC0002046.3	0.23	NRPS, PKS	lobatamide A	Gynuella sunshinyii YC6258

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001992.3	0.35	other (other)	thioguanine	Erwinia amylovora CFBP1430
BGC0000255.5	0.26	PKS	pederin	Uncultured bacterium
BGC0002046.3	0.23	NRPS, PKS	lobatamide A	Gynuella sunshinyii YC6258

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 22.84 out of 23.43

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.04 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.91 out of 19.26

Confidence: medium

Additional weak hits (6):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.06 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.31 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.61 out of 26.33

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
RpoN	Regulator of nitrogen assimilation and virulence

NZ_RYEV01000008.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 39,540 - 50,391 nt. (total: 10,852 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase sulfotransferase

EKO19_RS31420: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

EKO19_RS31430: glutathione S-transferase

smcogs: SMCOG1193: glutathione S-transferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.36	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002746.3	0.34	ribosomal	dendrothelin A	Dendrothele bispora CBS 962.96
BGC0002747.3	0.30	ribosomal	lentinulin A	Lentinula edodes
BGC0002448.2	0.29	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000874.5	0.28	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000518.3	0.27	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001650.4	0.27	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0002307.3	0.27	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.27	ribosomal	MS-271	Streptomyces mirabilis
BGC0002015.4	0.27	ribosomal	aborycin	Streptomyces sp. ZS0098

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.36	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002746.3	0.34	ribosomal	dendrothelin A	Dendrothele bispora CBS 962.96
BGC0002747.3	0.30	ribosomal	lentinulin A	Lentinula edodes
BGC0002448.2	0.29	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000874.5	0.28	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000518.3	0.27	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001650.4	0.27	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0002307.3	0.27	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.27	ribosomal	MS-271	Streptomyces mirabilis
BGC0002015.4	0.27	ribosomal	aborycin	Streptomyces sp. ZS0098

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.50 out of 26.85

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.41 out of 29.72

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

Additional weak hits (2):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.13 out of 25.88

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.34 out of 30.97

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
NtrC	Nitrogen regulatory protein C
RutR	Regulator of the pyrimidine and purine metabolism

NZ_RYEV01000010.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 26,712 nt. (total: 26,712 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: sulfotransferase

EKO19_RS34695: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

Lyases: hydratase

EKO19_RS34760: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

EKO19_RS34700: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EKO19_RS34705: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.25 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.78 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.71 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.89 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.56 out of 26.06

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.33 out of 36.53

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.21 out of 26.06

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.81 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 26712:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EKO19_RS34700: X

AMP-binding (47..448): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNSAFDATTWEAFLLTGGDINVYGPTETTTFATA
Nearest Stachelhaus code(s):: Ile DAWFLGMTFK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_RYEV01000010.1 - Region 2 - betalactone

Download region GenBank file

Download region SVG

Location: 195,126 - 237,780 nt. (total: 42,655 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

EKO19_RS35550: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

EKO19_RS35570: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

EKO19_RS35580: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

EKO19_RS35615: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: formyltransferase

EKO19_RS35525: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: hydrolase

EKO19_RS38990: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase hydratase

EKO19_RS35495: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

EKO19_RS35545: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

EKO19_RS35560: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

EKO19_RS35515: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EKO19_RS35555: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

EKO19_RS35600: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000867.3	0.48	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000706.3	0.48	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000343.5	0.44	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001187.4	0.44	NRPS, PKS	xenolozoyenone	Glarea lozoyensis
BGC0001965.4	0.43	other (other)	nybomycin	Streptomyces albus subsp. chlorinus
BGC0000041.3	0.43	PKS	oronofacic acid	Pseudomonas syringae
BGC0002228.3	0.43	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum
BGC0002571.2	0.42	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000662.5	0.42	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000867.3	0.48	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000706.3	0.48	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000343.5	0.44	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001187.4	0.44	NRPS, PKS	xenolozoyenone	Glarea lozoyensis
BGC0001965.4	0.43	other (other)	nybomycin	Streptomyces albus subsp. chlorinus
BGC0000041.3	0.43	PKS	oronofacic acid	Pseudomonas syringae
BGC0002228.3	0.43	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum
BGC0002571.2	0.42	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000662.5	0.42	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

Additional weak hits (6):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.72 out of 26.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.86 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.53 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.68 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.20 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.35 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_RYEV01000011.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 38,367 nt. (total: 38,367 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucosidase

EKO19_RS36215: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: ligase

EKO19_RS36165: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001831.3	0.46	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000343.5	0.46	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001137.5	0.46	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000595.3	0.44	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001458.4	0.42	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0000393.5	0.42	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002348.2	0.41	NRPS	aspulvinone E	Aspergillus terreus NIH2624
BGC0000934.4	0.41	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001831.3	0.46	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000343.5	0.46	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001137.5	0.46	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000595.3	0.44	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001458.4	0.42	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0000393.5	0.42	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002348.2	0.41	NRPS	aspulvinone E	Aspergillus terreus NIH2624
BGC0000934.4	0.41	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.20 out of 29.65

Confidence: medium

Additional weak hits (6):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.90 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.87 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.39 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.52 out of 18.57

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.09 out of 30.98

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

EKO19_RS36165: NH2

CAL_domain (144..583): NH2

minowa: NH2

Prediction, score:

NH2: 68.4
fatty_acid: 64.0
Acetyl-CoA: 14.9
shikimic_acid: 9.8
AHBA: 9.3

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response
MexT	Global virulence regulator

NZ_RYEV01000011.1 - Region 2 - betalactone

Download region GenBank file

Download region SVG

Location: 248,810 - 275,795 nt. (total: 26,986 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

EKO19_RS37095: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

EKO19_RS37105: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

EKO19_RS37110: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

EKO19_RS37135: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

EKO19_RS37170: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: dehydratase hydratase

EKO19_RS37090: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

EKO19_RS37140: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

EKO19_RS37120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

EKO19_RS37145: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000894.4	0.50	other (other)	citrinin	Monascus aurantiacus
BGC0000207.5	0.44	PKS	chartreusin	Streptomyces chartreusis
BGC0001633.3	0.44	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002246.3	0.43	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0000041.3	0.43	PKS	oronofacic acid	Pseudomonas syringae
BGC0001909.3	0.42	PKS	strobilurin A	Strobilurus tenacellus
BGC0001463.4	0.42	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida
BGC0000597.4	0.42	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000373.5	0.41	NRPS	holomycin	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000894.4	0.50	other (other)	citrinin	Monascus aurantiacus
BGC0000207.5	0.44	PKS	chartreusin	Streptomyces chartreusis
BGC0001633.3	0.44	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002246.3	0.43	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0000041.3	0.43	PKS	oronofacic acid	Pseudomonas syringae
BGC0001909.3	0.42	PKS	strobilurin A	Strobilurus tenacellus
BGC0001463.4	0.42	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida
BGC0000597.4	0.42	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000373.5	0.41	NRPS	holomycin	Streptomyces clavuligerus ATCC 27064

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.89 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.31 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.36 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.04 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.39 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.88 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_RYEV01000013.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 44,543 nt. (total: 44,543 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

EKO19_RS37795: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: glycosyltransferase

EKO19_RS37875: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: ligase

EKO19_RS37815: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EKO19_RS37820: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EKO19_RS37825: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

EKO19_RS37830: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.20 out of 30.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.17 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.71 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.28 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 44543:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - NMe-Thr) + (Pro) + (Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

EKO19_RS37820: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (512..920): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHSFDVAFQESFLITAGEHNHYGPTESHVVTAL
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

EKO19_RS37825: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (510..918): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHSFDVAFQESFLITAGEHNHYGPTESHVVTAL
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

EKO19_RS37830: X - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (58..462): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RAQTFVDAIFEGITTFSGEVNIYGSSEVAADATY
Nearest Stachelhaus code(s):: bAla VDWVTSLADK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1145..1554): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description