GCF_003323735.1 - 34 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_QOIM01000024.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lanthipeptide-class-i	213,337	238,105

NZ_QOIM01000018.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	terpene,T2PKS,lanthipeptide-class-i	168,612	252,155	High	fredericamycin A	PKS:Type II

NZ_QOIM01000026.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	terpene	89,179	110,657

NZ_QOIM01000025.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	T1PKS	107,301	153,342	Low	SapB	ribosomal:RiPP:Lanthipeptide

NZ_QOIM01000057.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	T1PKS	1	24,704	Low	chlorothricin/deschlorothricin	PKS:Type I+saccharide:oligosaccharide
Region 8.2	NI-siderophore	136,018	169,328	Low	kinamycin	PKS

NZ_QOIM01000021.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRPS	77,047	120,871

NZ_QOIM01000042.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	azole-containing-RiPP	136,487	167,594
Region 11.2	terpene-precursor	553,779	575,038	Low	isorenieratene	terpene

NZ_QOIM01000046.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	T1PKS,NRPS	1	50,622

NZ_QOIM01000049.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	NRPS,NRPS-like	1	45,211

NZ_QOIM01000039.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	T1PKS	20,356	87,651	Low	ECO-02301	PKS

NZ_QOIM01000038.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	ectoine	57,783	68,187	High	ectoine	other:ectoine
Region 22.2	lanthipeptide-class-i,hydrogen-cyanide	212,311	243,385
Region 22.3	terpene	452,460	474,721

NZ_QOIM01000054.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	NRP-metallophore,NRPS	19,755	62,022	High	paenibactin	NRPS:Type I

NZ_QOIM01000050.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	T1PKS	1	22,456	Low	chlorothricin/deschlorothricin	PKS:Type I+saccharide:oligosaccharide

NZ_QOIM01000060.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	NI-siderophore	1	9,736	High	desferrioxamine E	other:other

NZ_QOIM01000062.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	T1PKS	1	8,542

NZ_QOIM01000063.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 30.1	T1PKS	1	7,635

NZ_QOIM01000065.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	T1PKS	1	5,190	High	tetrafibricin	PKS+other:other

NZ_QOIM01000040.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 33.1	T1PKS,PKS-like	1	32,539	Low	tiacumicin B	PKS:Type I
Region 33.2	RiPP-like	164,681	175,878
Region 33.3	lanthipeptide-class-iv	245,125	267,863
Region 33.4	NRPS-like,T1PKS	285,242	345,189	Low	formicamycin A/formicamycin B/formicamycin C/formicamycin D/formicamycin E/formicamycin F/formicamycin G/formicamycin H/formicamycin I/formicamycin J/formicamycin K/formicamycin L/formicamycin M/fasamycin C/fasamycin D/fasamycin E	PKS:Type II aromatic

NZ_QOIM01000069.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	T1PKS	1	4,693

NZ_QOIM01000051.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 37.1	T1PKS	1	4,596

NZ_QOIM01000036.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 53.1	terpene-precursor	42,316	63,374
Region 53.2	T3PKS,other,NRPS-like,terpene-precursor	135,598	203,660	High	furaquinocin B	terpene+PKS
Region 53.3	RRE-containing,NRPS,betalactone	282,693	344,697

NZ_QOIM01000041.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 54.1	terpene-precursor	90,296	111,375
Region 54.2	terpene	207,834	234,559	Medium	hopene	terpene

NZ_QOIM01000030.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 56.1	NRPS	194,231	238,403	Medium	dudomycin A	NRPS:Type I

NZ_QOIM01000028.1 (Streptomyces reniochalinae)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 57.1	terpene	90,865	112,058

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lanthipeptide-class-i	213,337	238,105
Region 4.1	terpene,T2PKS,lanthipeptide-class-i	168,612	252,155	High	fredericamycin A	PKS:Type II
Region 5.1	terpene	89,179	110,657
Region 6.1	T1PKS	107,301	153,342	Low	SapB	ribosomal:RiPP:Lanthipeptide
Region 8.1	T1PKS	1	24,704	Low	chlorothricin/deschlorothricin	PKS:Type I+saccharide:oligosaccharide
Region 8.2	NI-siderophore	136,018	169,328	Low	kinamycin	PKS
Region 9.1	NRPS	77,047	120,871
Region 11.1	azole-containing-RiPP	136,487	167,594
Region 11.2	terpene-precursor	553,779	575,038	Low	isorenieratene	terpene
Region 15.1	T1PKS,NRPS	1	50,622
Region 18.1	NRPS,NRPS-like	1	45,211
Region 19.1	T1PKS	20,356	87,651	Low	ECO-02301	PKS
Region 22.1	ectoine	57,783	68,187	High	ectoine	other:ectoine
Region 22.2	lanthipeptide-class-i,hydrogen-cyanide	212,311	243,385
Region 22.3	terpene	452,460	474,721
Region 23.1	NRP-metallophore,NRPS	19,755	62,022	High	paenibactin	NRPS:Type I
Region 27.1	T1PKS	1	22,456	Low	chlorothricin/deschlorothricin	PKS:Type I+saccharide:oligosaccharide
Region 28.1	NI-siderophore	1	9,736	High	desferrioxamine E	other:other
Region 29.1	T1PKS	1	8,542
Region 30.1	T1PKS	1	7,635
Region 32.1	T1PKS	1	5,190	High	tetrafibricin	PKS+other:other
Region 33.1	T1PKS,PKS-like	1	32,539	Low	tiacumicin B	PKS:Type I
Region 33.2	RiPP-like	164,681	175,878
Region 33.3	lanthipeptide-class-iv	245,125	267,863
Region 33.4	NRPS-like,T1PKS	285,242	345,189	Low	formicamycin A/formicamycin B/formicamycin C/formicamycin D/formicamycin E/formicamycin F/formicamycin G/formicamycin H/formicamycin I/formicamycin J/formicamycin K/formicamycin L/formicamycin M/fasamycin C/fasamycin D/fasamycin E	PKS:Type II aromatic
Region 36.1	T1PKS	1	4,693
Region 37.1	T1PKS	1	4,596
Region 53.1	terpene-precursor	42,316	63,374
Region 53.2	T3PKS,other,NRPS-like,terpene-precursor	135,598	203,660	High	furaquinocin B	terpene+PKS
Region 53.3	RRE-containing,NRPS,betalactone	282,693	344,697
Region 54.1	terpene-precursor	90,296	111,375
Region 54.2	terpene	207,834	234,559	Medium	hopene	terpene
Region 56.1	NRPS	194,231	238,403	Medium	dudomycin A	NRPS:Type I
Region 57.1	terpene	90,865	112,058

No secondary metabolite regions were found in these records:: NZ_QOIM01000033.1 (Streptomyces reniochalinae); NZ_QOIM01000032.1 (Streptomyces reniochalinae); NZ_QOIM01000023.1 (Streptomyces reniochalinae); NZ_QOIM01000020.1 (Streptomyces reniochalinae); NZ_QOIM01000022.1 (Streptomyces reniochalinae); NZ_QOIM01000045.1 (Streptomyces reniochalinae); NZ_QOIM01000017.1 (Streptomyces reniochalinae); NZ_QOIM01000047.1 (Streptomyces reniochalinae); NZ_QOIM01000027.1 (Streptomyces reniochalinae); NZ_QOIM01000043.1 (Streptomyces reniochalinae); NZ_QOIM01000052.1 (Streptomyces reniochalinae); NZ_QOIM01000055.1 (Streptomyces reniochalinae); NZ_QOIM01000056.1 (Streptomyces reniochalinae); NZ_QOIM01000058.1 (Streptomyces reniochalinae); NZ_QOIM01000064.1 (Streptomyces reniochalinae); NZ_QOIM01000066.1 (Streptomyces reniochalinae); NZ_QOIM01000067.1 (Streptomyces reniochalinae); NZ_QOIM01000019.1 (Streptomyces reniochalinae); NZ_QOIM01000029.1 (Streptomyces reniochalinae); NZ_QOIM01000061.1 (Streptomyces reniochalinae); NZ_QOIM01000044.1 (Streptomyces reniochalinae); NZ_QOIM01000068.1 (Streptomyces reniochalinae); NZ_QOIM01000070.1 (Streptomyces reniochalinae); NZ_QOIM01000037.1 (Streptomyces reniochalinae); NZ_QOIM01000048.1 (Streptomyces reniochalinae); NZ_QOIM01000035.1 (Streptomyces reniochalinae); NZ_QOIM01000031.1 (Streptomyces reniochalinae); NZ_QOIM01000016.1 (Streptomyces reniochalinae); NZ_QOIM01000015.1 (Streptomyces reniochalinae); NZ_QOIM01000014.1 (Streptomyces reniochalinae); NZ_QOIM01000013.1 (Streptomyces reniochalinae); NZ_QOIM01000012.1 (Streptomyces reniochalinae); NZ_QOIM01000034.1 (Streptomyces reniochalinae)

Compact view

NZ_QOIM01000024.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 213,337 - 238,105 nt. (total: 24,769 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

DQ392_RS06425: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

DQ392_RS06430: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0000544.4	0.49	ribosomal	planosporicin	Planomonospora alba
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.46	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000515.4	0.45	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001311.5	0.38	ribosomal	flavecins	Ruminococcus flavefaciens FD-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0000544.4	0.49	ribosomal	planosporicin	Planomonospora alba
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.46	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000515.4	0.45	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001311.5	0.38	ribosomal	flavecins	Ruminococcus flavefaciens FD-1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for DQ392_RS06425

DQ392_RS34305

Leader:

MSEDLLEDEFSLDLRVGHAEVSTSSAAAT

Core:

NNGGCATSRTSLCTDTLSGCC

Core with dehydrations:

NNGGCysADhbDhaRDhbDhaLCysDhbDDhbLDhaGCysCys

antiSMASH-DB 4.0 matches for DQ392_RS34305

100.0%

NZ_CP093846.1and 2 others:

NZ_QOIM01000024.1 Lanthipeptides: DQ392_RS34305_lanthipeptideNZ_QOIN01000048.1 Lanthipeptides: DTL70_RS33655_lanthipeptide

Lanthipeptides: MMF93_RS21475_lanthipeptide

1

NNGGCATSRTSLCTDTLSGCC

21

NNGGCATSRTSLCTDTLSGCC

1

NNGGCATSRTSLCTDTLSGCC

21

90.5%

NZ_FOGO01000009.1and 1 other:

NZ_LJGV01000022.1 Lanthipeptides: AN217_RS29645_lanthipeptide

Lanthipeptides: BMX65_RS32975_lanthipeptide

1

NNGGCATSRTSLCTDTLSGCC

21

NNGGC TSRTSLCTDTLS CC

1

NNGGCETSRTSLCTDTLSTCC

21

87.0%

NZ_PYGA01000041.1and 1 other:

NZ_PYGA01000041.1 Lanthipeptides: CLV63_RS33905_lanthipeptide

Lanthipeptides: CLV63_RS33905_lanthipeptide

1

NNGGCATSRTSLCTDTLSGCC

21

NNGGC TSRTSLCTDTLSGCC

3

NNGGCETSRTSLCTDTLSGCC

23

with 9 more sequence matches

81.0%

NZ_CP072467.1:

Lanthipeptides: J4H86_RS06495_lanthipeptide

1

NNGGCATSRTSLCTDTLSGCC

21

NN TSRTSLCTDTLSGCC

1

NNAASITSRTSLCTDTLSGCC

21

76.2%

NZ_CP050693.1:

Lanthipeptides: HC362_RS06015_lanthipeptide

4

GCATSRTSLCTDTLSGCC

21

GC TSRTS CTDTLSGCC

2

GCGTSRTSACTDTLSGCC

19

36.4%

NZ_KB903838.1:

Lanthipeptides: allorf_243851_244066_lanthipeptide

3

GGCATSRTSLCTDTLSGC

20

G A++RTS L+GC

1

GRSASTRTSRTPRQLAGC

18

34.6%

NZ_JH600294.1and 1 other:

NZ_JH600294.1 Lanthipeptides: GYU_RS0115740_lanthipeptide

Lanthipeptides: GYU_RS0115745_lanthipeptide

2

NGGCATSRTSLCTDTLSGC

20

+G C T+ T+ CT L GC

8

DGNCLTTITADCTPWLWGC

26

31.0%

NZ_CM000728.1and 3 others:

NZ_JH792121.1 Lanthipeptides: allorf_129150_129275_lanthipeptideNZ_NUQX01000026.1 Lanthipeptides: COE81_RS20180_lanthipeptideNZ_NVFD01000061.1 Lanthipeptides: COL35_RS24660_lanthipeptide

Lanthipeptides: BCERE0017_RS28130_lanthipeptide

2

NGGCATSRTSLCTDTLSGC

20

+G C S T+ CT L GC

8

DGNCLYSITADCTPWLLGC

26

30.8%

NZ_JABRUZ010000012.1:

Lanthipeptides: HRF55_RS15035_lanthipeptide

2

NGGCATSRTSLCTDTLSGC

20

+G C S T+ CT + GC

8

DGNCLASITADCTPWIWGC

26

29.6%

NZ_CM000728.1and 2 others:

NZ_JH792121.1 Lanthipeptides: IGO_RS26860_lanthipeptideNZ_NUQX01000026.1 Lanthipeptides: COE81_RS20170_lanthipeptide

Lanthipeptides: BCERE0017_RS28125_lanthipeptide

2

NGGCATSRTSLCTDTLSGC

20

+G C + T+ CTD L C

8

DGNCLATITADCTDWLPIC

26

26.9%

NZ_CP011686.1and 7 others:

NZ_CP011686.1 Lanthipeptides: ABH13_RS05745_lanthipeptideNZ_JALAKW010000008.1 Lanthipeptides: MOB93_RS17005_lanthipeptideNZ_JALAKW010000008.1 Lanthipeptides: MOB93_RS17000_lanthipeptideNZ_JALAME010000008.1 Lanthipeptides: MOC02_RS17820_lanthipeptideNZ_JALAME010000008.1 Lanthipeptides: MOC02_RS17815_lanthipeptideNZ_JALATF010000002.1 Lanthipeptides: MOD44_RS02115_lanthipeptideNZ_JALAYD010000020.1 Lanthipeptides: MOF39_RS20940_lanthipeptide

Lanthipeptides: ABH13_RS05750_lanthipeptide

2

NGGCATSRTSLCTDTLSGC

20

+G C + T+ CT + GC

8

DGNCLATITADCTPWIWGC

26

17.1%

NZ_JAABOK010000018.1:

Lanthipeptides: GWG06_RS26540_lanthipeptide

3

GGCATSRTSLCTDT

16

GG + TS+C DT

7

GGFIVTVTSMCEDT

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.78 out of 29.72

Confidence: medium

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.92 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.10 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.40 out of 25.88

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.72 out of 26.85

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.66 out of 27.04

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

DQ392_RS34305 - Class I

Cleavage pHMM score: -2.70

RODEO score: 25

Monoisotopic mass: 1936.8 Da

Molecular weight: 1938.1 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1956.1 Da N = 1; 1974.2 Da N = 2; 1992.2 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 204 - 269; Score: 38.4

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence

NZ_QOIM01000018.1 - Region 1 - T2PKS,lanthipeptide-class-i,terpene

Download region GenBank file

Download region SVG

Location: 168,612 - 252,155 nt. (total: 83,544 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
T2PKS: (t2ks and t2clf)
lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS01615: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

DQ392_RS01650: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

DQ392_RS01770: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DQ392_RS01840: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase acylase methyltransferase transferase

DQ392_RS01670: methyltransferase

smcogs: SMCOG1089: methyltransferase

DQ392_RS01775: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

DQ392_RS01850: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

DQ392_RS01855: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

DQ392_RS35930: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase protease

DQ392_RS01700: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

DQ392_RS01735: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase dehydratase

DQ392_RS01805: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

DQ392_RS01830: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

DQ392_RS01920: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

DQ392_RS01925: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Ligases: synthase

DQ392_RS01755: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

DQ392_RS01815: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

DQ392_RS01820: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.89	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000664.5	0.89	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.73	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.69	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.62	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.62	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000190.5	0.56	PKS	A-74528	Streptomyces sp. SANK 61196
BGC0000224.4	0.53	PKS	fredericamycin A	Streptomyces griseus
BGC0000648.3	0.36	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.33	terpene	β-carotein	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000190.5	0.82	PKS	A-74528	Streptomyces sp. SANK 61196
BGC0000224.4	0.80	PKS	fredericamycin A	Streptomyces griseus
BGC0000664.5	0.76	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000649.3	0.70	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.68	terpene	isorenieratene	Streptomyces argillaceus
BGC0000275.4	0.67	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000633.3	0.66	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.65	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000231.5	0.64	PKS	griseusin A, griseusin B	Streptomyces griseus

Similar known clusters from MIBiG 4.0

Similar subclusters

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

DQ392_RS01655: PT_phytoene_like

Domain 1 (16 - 327): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

DQ392_RS01675: Lycopene_cycl

Domain 1 (12 - 389): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.60 out of 23.79

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.12 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.04 out of 23.79

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.49 out of 29.65

Confidence: medium

Additional weak hits (20):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.04 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.47 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.60 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.59 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.09 out of 30.98

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.21 out of 32.93

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.32 out of 20.97

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.57 out of 30.11

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.31 out of 27.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.57 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.29 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.79 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.83 out of 30.25

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.25 out of 20.01

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS substrates

RREFinder

Type II PKS

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

NRPS/PKS substrate predictions

DQ392_RS01850: mal

PKS_AT (11..301): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 62.5
Methylmalonyl-CoA: 42.3
Methoxymalonyl-CoA: 38.9
fatty_acid: 31.2
inactive: 25.7
Ethylmalonyl-CoA: 25.3
Propionyl-CoA: 13.2
Benzoyl-CoA: 10.8
trans-1,2-CPDA: 9.3
3-Methylbutyryl-CoA: 6.1
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
2-Methylbutyryl-CoA: -2.2

Link to PARAS substrate predictor

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 121 - 214; Score: 60.7

Type II PKS gene cluster prediction details

Cluster section:: 176364 to 248925
Starter unit(s):: hexadienyl-CoA (Score: 1001.0; E-value: 0)
malonamyl-CoA (Score: 565.0; E-value: 0)
Malonyl elongations:: 11|12 (Score: 719.0; E-value: 2.9e-219)
Product class(es):: pentangular polyphenol
Product molecular weight(s):: hexadienyl-CoA_11: 527 Da
hexadienyl-CoA_12: 569 Da
malonamyl-CoA_11: 518 Da
malonamyl-CoA_12: 560 Da

DQ392_RS01670: MET (Score: 23.5; E-value: 6.1e-08)
DQ392_RS01735: AMID (Score: 787.8; E-value: 1.3e-239); AMID ELQ83270.1_Oxytetracycline_malonamyl-CoA (Score: 565.0; E-value: 0.0)
DQ392_RS01755: KSIII (Score: 408.3; E-value: 5.8e-125); KSIII AAQ08929.1_Fredericamycin_hexadienyl-CoA (Score: 550.0; E-value: 0.0)
DQ392_RS01770: KR C19 (Score: 424.7; E-value: 2.7e-130)
DQ392_RS01775: MET C11O (Score: 539.4; E-value: 6.6e-165)
DQ392_RS01805: CYC C9-C14 (Score: 252.7; E-value: 2.2e-78)
DQ392_RS01810: ACP (Score: 98.7; E-value: 3.3e-31)
DQ392_RS01815: CLF 11|12 (Score: 719.0; E-value: 2.9e-219)
DQ392_RS01820: KS (Score: 731.9; E-value: 4.8e-223)
DQ392_RS01825: CYC C5-C18 (Score: 203.2; E-value: 2.8e-63)
DQ392_RS01830: CYC C4-C21/C2-C23|C2-C19 (Score: 175.5; E-value: 5.6e-55)
DQ392_RS01840: KR (Score: 225.4; E-value: 2.2e-69)
DQ392_RS01850: AT (Score: 412.8; E-value: 2.5e-126); AT AAQ08910.1_Fredericamycin_hexadienyl-CoA (Score: 451.0; E-value: 3.17e-163)

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_QOIM01000026.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 89,179 - 110,657 nt. (total: 21,479 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

DQ392_RS08180: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

DQ392_RS08160: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: cyclase hydratase

DQ392_RS08150: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

DQ392_RS08185: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

DQ392_RS08145: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.85	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0002277.2	0.55	NRPS	atromentin	Suillus grevillei
BGC0000657.5	0.55	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000597.4	0.42	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000922.5	0.40	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0001736.3	0.39	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001909.3	0.39	PKS	strobilurin A	Strobilurus tenacellus
BGC0000595.3	0.39	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002711.2	0.39	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.85	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0002277.2	0.55	NRPS	atromentin	Suillus grevillei
BGC0000657.5	0.55	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000597.4	0.42	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000922.5	0.40	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0001736.3	0.39	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001909.3	0.39	PKS	strobilurin A	Strobilurus tenacellus
BGC0000595.3	0.39	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002711.2	0.39	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

DQ392_RS08185: T1TS

Domain 1 (50 - 486): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (3):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.42 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.14 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_QOIM01000025.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 107,301 - 153,342 nt. (total: 46,042 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

DQ392_RS07215: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

DQ392_RS07310: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acylase

DQ392_RS07260: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase

DQ392_RS07225: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

DQ392_RS07255: thioesterase

smcogs: SMCOG1004: thioesterase

DQ392_RS07270: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

DQ392_RS07275: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

DQ392_RS07335: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.94 out of 23.43

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.09 out of 26.85

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.70 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.51 out of 32.74

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.86 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.45 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 107300 - 153342:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS07260: mal

PKS_AT (573..863): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 165.0
inactive: 92.1
Methoxymalonyl-CoA: 70.6
Methylmalonyl-CoA: 61.0
Propionyl-CoA: 39.1
Ethylmalonyl-CoA: 37.1
2-Methylbutyryl-CoA: 24.5
Isobutyryl-CoA: 22.6
CHC-CoA: 19.3
fatty_acid: 16.2
trans-1,2-CPDA: 11.6
Benzoyl-CoA: 11.6
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_QOIM01000057.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 24,704 nt. (total: 24,704 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

DQ392_RS32820: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

DQ392_RS32860: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

DQ392_RS32880: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase transferase

DQ392_RS32810: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

DQ392_RS32830: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

DQ392_RS32835: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: esterase

DQ392_RS32840: thioesterase

smcogs: SMCOG1004: thioesterase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (1):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.87 out of 27.18

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_QOIM01000057.1 - Region 2 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 136,018 - 169,328 nt. (total: 33,311 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

DQ392_RS33345: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Isomerases: mutase

DQ392_RS33340: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001478.5	0.53	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001498.5	0.50	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000942.4	0.48	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001478.5	0.53	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001498.5	0.50	other (other)	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000942.4	0.48	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.44 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (2):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_QOIM01000021.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 77,047 - 120,871 nt. (total: 43,825 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

DQ392_RS03245: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Lyases: lyase

DQ392_RS03235: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

DQ392_RS03255: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (17):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.70 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.12 out of 23.43

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.59 out of 27.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.53 out of 32.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.16 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.06 out of 24.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.84 out of 32.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.20 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.57 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.91 out of 36.54

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 77046 - 120871:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS03255: X

AMP-binding (467..861): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGAGFDVAVLETKLVVGGDTASYGPTECTVLATV
Nearest Stachelhaus code(s):: Glu DVLKVGAVNK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

DQ392_RS03260: X

AMP-binding (74..473): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LASTVDSSMHDMEIITGGSANGYGPTEASVAATW
Nearest Stachelhaus code(s):: Lys DVFESGGVAK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_QOIM01000042.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 136,487 - 167,594 nt. (total: 31,108 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

DQ392_RS26090: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.52	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001472.5	0.47	ribosomal	berninamycin A	Streptomyces bernensis
BGC0000565.5	0.46	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001173.5	0.45	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000569.5	0.45	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0002363.3	0.44	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0000605.5	0.43	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0002635.2	0.43	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000564.5	0.42	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0001170.5	0.42	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.52	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001472.5	0.47	ribosomal	berninamycin A	Streptomyces bernensis
BGC0000565.5	0.46	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001173.5	0.45	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000569.5	0.45	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0002363.3	0.44	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0000605.5	0.43	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0002635.2	0.43	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000564.5	0.42	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0001170.5	0.42	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.79 out of 30.25

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (13):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.91 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.18 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.72 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.08 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.17 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 39.62

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.22 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.67 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.52 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.06 out of 24.78

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ColR	Phenol-responsive regulator

Core peptide predictions

No core peptides found.

NZ_QOIM01000042.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 553,779 - 575,038 nt. (total: 21,260 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS27940: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Lyases: dehydratase

DQ392_RS27885: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

DQ392_RS27900: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.49	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.47	terpene	carotenoid	Streptomyces avermitilis
BGC0001456.3	0.47	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.46	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000644.3	0.38	terpene	carotenoid	Dietzia sp. CQ4
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0001605.3	0.37	terpene	gibberellin	Sinorhizobium fredii NGR234

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.49	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.47	terpene	carotenoid	Streptomyces avermitilis
BGC0001456.3	0.47	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.46	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000644.3	0.38	terpene	carotenoid	Dietzia sp. CQ4
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0001605.3	0.37	terpene	gibberellin	Sinorhizobium fredii NGR234

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

DQ392_RS27900: PT_FPPS_like

Domain 1 (89 - 398): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.11 out of 25.88

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.27 out of 20.01

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.97 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.65 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_QOIM01000046.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 50,622 nt. (total: 50,622 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

DQ392_RS30250: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

DQ392_RS30255: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

DQ392_RS30265: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

DQ392_RS30295: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Ligases: ligase synthase

DQ392_RS30175: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DQ392_RS30180: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DQ392_RS35570: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.84	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.83	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.65	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.95 out of 20.97

Confidence: medium

Additional weak hits (9):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.82 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.24 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.41 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.62 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.02 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.38 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 50622:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ohmal - ccmal - ccmal) + (Gly) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS30175: mal

PKS_AT (1430..1727): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.6
inactive: 101.5
Methoxymalonyl-CoA: 60.3
Methylmalonyl-CoA: 49.6
Propionyl-CoA: 31.1
Acetyl-CoA: 25.8
trans-1,2-CPDA: 21.3
Ethylmalonyl-CoA: 19.0
Benzoyl-CoA: 18.8
2-Methylbutyryl-CoA: 18.3
Isobutyryl-CoA: 17.7
fatty_acid: 11.5
CHC-CoA: 10.7
3-Methylbutyryl-CoA: 0.0

DQ392_RS30180: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (467..848): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LHFTFDMSTLELSAIIGGEFNLYGPTEATVWSTG
Nearest Stachelhaus code(s):: Gly DMLQIGTVWK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

DQ392_RS35570: mal - mal - mal - mal

PKS_AT (537..823): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.7
inactive: 112.4
Methoxymalonyl-CoA: 68.5
Methylmalonyl-CoA: 52.4
Isobutyryl-CoA: 29.0
Propionyl-CoA: 27.9
Acetyl-CoA: 17.0
Benzoyl-CoA: 9.4
Ethylmalonyl-CoA: 6.5
2-Methylbutyryl-CoA: 5.9
CHC-CoA: 5.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1542..1836): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.7
inactive: 96.8
Methoxymalonyl-CoA: 66.8
Methylmalonyl-CoA: 57.8
Isobutyryl-CoA: 32.8
Ethylmalonyl-CoA: 28.8
Propionyl-CoA: 26.6
2-Methylbutyryl-CoA: 22.5
Acetyl-CoA: 22.4
Benzoyl-CoA: 21.3
fatty_acid: 18.8
CHC-CoA: 17.4
trans-1,2-CPDA: 7.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (3017..3311): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 184.6
inactive: 79.0
Methoxymalonyl-CoA: 58.0
Methylmalonyl-CoA: 33.2
Propionyl-CoA: 28.7
Acetyl-CoA: 22.1
Isobutyryl-CoA: 15.8
Benzoyl-CoA: 12.2
CHC-CoA: 11.7
fatty_acid: 8.8
Ethylmalonyl-CoA: 8.8
2-Methylbutyryl-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4764..5047): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.6
inactive: 68.8
Methoxymalonyl-CoA: 54.7
Methylmalonyl-CoA: 45.8
Propionyl-CoA: 29.9
Ethylmalonyl-CoA: 15.9
Isobutyryl-CoA: 15.8
2-Methylbutyryl-CoA: 14.3
Acetyl-CoA: 12.9
Benzoyl-CoA: 10.7
fatty_acid: 9.6
CHC-CoA: 9.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_QOIM01000049.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 45,211 nt. (total: 45,211 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS31415: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

DQ392_RS31335: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

DQ392_RS31350: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

DQ392_RS31375: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

DQ392_RS31435: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

DQ392_RS31480: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: ligase

DQ392_RS31380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DQ392_RS31385: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

DQ392_RS31390: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.85	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.84	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.82	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.81	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.79	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.79	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.77	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.25 out of 20.97

Confidence: medium

Additional weak hits (8):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.91 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.33 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.91 out of 27.04

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.46 out of 35.63

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.32 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.17 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.23 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 45211:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - X) + (Ser - D-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 29923:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - X) + (Ser - D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS31380: X

AMP-binding (13..411): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RTMAFDASFEQPELVLGGEINTYGPTEATITATA
Nearest Stachelhaus code(s):: Lys DAESVGTIIK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

DQ392_RS31385: X - X

AMP-binding (518..918): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNNCFDVFTFEGWLMYGGEINGYGPTEATVFAAT
Nearest Stachelhaus code(s):: Ala DVFWLGGTFK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1578..1981): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTSWDALTLEPWLMYGGEFHAYGPTETTVFAST
Nearest Stachelhaus code(s):: Ile or Val DALWMGGVFK (68% 8Å match); Val DALWMGGVFK (53% 8Å match)
Stachelhaus code match:: 90% (moderate)

DQ392_RS31390: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (37..448): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEASIDVSS
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1118..1521): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YSCSFDMIVPNTKMAVGADLNEYGPTEASVANSF
Nearest Stachelhaus code(s):: Asn DMTKVGEVGK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_QOIM01000039.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 20,356 - 87,651 nt. (total: 67,296 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

DQ392_RS21855: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DQ392_RS21865: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

DQ392_RS21880: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DQ392_RS21905: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase acyltransferase aminotransferase methyltransferase transferase

DQ392_RS21765: aminotransferase

smcogs: SMCOG1019: aminotransferase

DQ392_RS21840: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

DQ392_RS21850: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

DQ392_RS21885: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

DQ392_RS21895: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: esterase hydrolase

DQ392_RS21775: isochorismatase

smcogs: SMCOG1027: isochorismatase

DQ392_RS21830: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

DQ392_RS21820: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

DQ392_RS21825: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DQ392_RS21845: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

DQ392_RS21890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (15):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.42 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.91 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.17 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.42 out of 18.57

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.22 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.15 out of 29.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.54 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.33 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.73 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.59 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 20355 - 87651:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (ohmal - redmal) + (ccemal - mal)
Non-colinear ordering:: DQ392_RS21905 + DQ392_RS21840 + DQ392_RS21845

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS21825: X

AMP-binding (11..402): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NTMLFGQICS-TMGYSGGSYEGYGMTETSTSLTY
Nearest Stachelhaus code(s):: nLev GFCMYGGCSK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

DQ392_RS21840: mal - mal

PKS_AT (553..845): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.9
inactive: 84.0
Methoxymalonyl-CoA: 58.6
Methylmalonyl-CoA: 48.1
Acetyl-CoA: 23.5
Ethylmalonyl-CoA: 20.4
Propionyl-CoA: 15.6
Benzoyl-CoA: 15.3
Isobutyryl-CoA: 14.3
2-Methylbutyryl-CoA: 11.5
fatty_acid: 9.2
CHC-CoA: 7.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2072..2355): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.4
inactive: 97.6
Methoxymalonyl-CoA: 67.5
Methylmalonyl-CoA: 53.6
Ethylmalonyl-CoA: 30.0
Isobutyryl-CoA: 29.3
Propionyl-CoA: 28.2
Acetyl-CoA: 23.6
Benzoyl-CoA: 22.6
CHC-CoA: 18.1
2-Methylbutyryl-CoA: 15.6
trans-1,2-CPDA: 14.7
fatty_acid: 13.2
3-Methylbutyryl-CoA: 0.0

DQ392_RS21845: emal - mal

PKS_AT (562..860): emal

ATSignature: Ethylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%; Methylmalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 198.7
Methylmalonyl-CoA: 178.4
Methoxymalonyl-CoA: 155.0
2-Methylbutyryl-CoA: 112.2
trans-1,2-CPDA: 111.1
Propionyl-CoA: 89.2
CHC-CoA: 80.1
Malonyl-CoA: 73.3
Isobutyryl-CoA: 62.5
Benzoyl-CoA: 50.7
Acetyl-CoA: 35.1
fatty_acid: 33.6
inactive: 25.1
3-Methylbutyryl-CoA: 11.1

PKS_AT (2306..2599): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.5
inactive: 102.6
Methoxymalonyl-CoA: 61.6
Methylmalonyl-CoA: 49.6
Propionyl-CoA: 36.5
Isobutyryl-CoA: 26.9
Acetyl-CoA: 19.6
2-Methylbutyryl-CoA: 15.6
CHC-CoA: 15.5
Benzoyl-CoA: 13.8
Ethylmalonyl-CoA: 11.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

DQ392_RS21890: X

AMP-binding (22..421): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TITTHTVGPMAAFMVYSGSLQAYGTSEGGRVTLL
Nearest Stachelhaus code(s):: Ala DVMFVAAVYK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

DQ392_RS21905: mal - mal

PKS_AT (561..856): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.6
inactive: 99.1
Methoxymalonyl-CoA: 60.7
Methylmalonyl-CoA: 47.4
Ethylmalonyl-CoA: 26.6
Propionyl-CoA: 25.2
Isobutyryl-CoA: 21.4
Acetyl-CoA: 20.1
2-Methylbutyryl-CoA: 18.3
Benzoyl-CoA: 16.0
fatty_acid: 12.1
trans-1,2-CPDA: 7.6
CHC-CoA: 6.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (2285..2579): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 180.3
inactive: 84.7
Methoxymalonyl-CoA: 58.2
Methylmalonyl-CoA: 47.0
Propionyl-CoA: 33.1
2-Methylbutyryl-CoA: 23.7
Ethylmalonyl-CoA: 21.9
Acetyl-CoA: 20.0
Isobutyryl-CoA: 17.1
Benzoyl-CoA: 14.2
trans-1,2-CPDA: 11.6
CHC-CoA: 11.2
fatty_acid: 10.9
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_QOIM01000038.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 57,783 - 68,187 nt. (total: 10,405 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS19815: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase

DQ392_RS19795: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

DQ392_RS19810: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.86	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.86	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.15 out of 23.79

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (4):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.04 out of 27.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.08 out of 32.38

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.99 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_QOIM01000038.1 - Region 2 - hydrogen-cyanide,lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 212,311 - 243,385 nt. (total: 31,075 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))
hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

DQ392_RS20435: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

DQ392_RS20510: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

DQ392_RS20550: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

DQ392_RS20445: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: deaminase

DQ392_RS20455: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: cyclase

DQ392_RS20465: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Translocases: permease transporter

DQ392_RS20440: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

DQ392_RS20495: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002635.2	0.27	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000903.3	0.21	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002425.3	0.20	ribosomal	stlassin	Streptomyces sp.
BGC0001386.5	0.20	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000883.5	0.19	other (other)	arginomycin	Streptomyces arginensis
BGC0001964.2	0.18	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001395.5	0.18	other (other)	teichomycin A1	Actinoplanes teichomyceticus
BGC0002712.2	0.17	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis
BGC0000324.5	0.17	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0002556.2	0.17	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002635.2	0.47	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0001548.4	0.44	ribosomal	citrulassin A	Streptomyces albulus
BGC0002343.3	0.43	other (other), ribosomal	ammosester A, ammosester B, ammosester C, ammosamaic acid cogener	Streptomyces uncialis
BGC0002496.3	0.43	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000883.5	0.41	other (other)	arginomycin	Streptomyces arginensis
BGC0002285.2	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000218.5	0.40	PKS	doxorubicin	Streptomyces peucetius
BGC0001386.5	0.40	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000903.3	0.40	other (other)	fluorometabolite	Streptomyces cattleya

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.09 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.81 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.26 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.60 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.33 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 35.63

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 384 - 445; Score: 27.7

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_QOIM01000038.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 452,460 - 474,721 nt. (total: 22,262 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS21485: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DQ392_RS21500: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Lyases: cyclase dehydratase

DQ392_RS21495: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

DQ392_RS21515: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002073.3	0.48	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002115.3	0.44	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001870.3	0.43	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002476.2	0.41	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002073.3	0.48	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002115.3	0.44	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001870.3	0.43	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002476.2	0.41	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

DQ392_RS21515: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (341 - 710): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (3):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.34 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.32 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_QOIM01000054.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 19,755 - 62,022 nt. (total: 42,268 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

DQ392_RS32205: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DQ392_RS32280: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

DQ392_RS32340: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DQ392_RS32375: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DQ392_RS32385: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: esterase hydrolase

DQ392_RS32310: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

DQ392_RS32325: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

DQ392_RS32335: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

DQ392_RS32330: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000343.5	0.78	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001185.5	0.77	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000401.5	0.67	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002474.2	0.63	NRPS	agrobactin	Agrobacterium tumefaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000343.5	0.71	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001185.5	0.71	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000401.5	0.66	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002474.2	0.65	NRPS	agrobactin	Agrobacterium tumefaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.36 out of 29.51

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.73 out of 36.53

Confidence: medium

Additional weak hits (13):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.41 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.71 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.95 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.23 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.65 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.69 out of 30.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.19 out of 27.04

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.89 out of 32.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.74 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.91 out of 18.57

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 19754 - 62022:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS32315: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (449..852): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVSH
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match); Ala or Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

DQ392_RS32330: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (36..444): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SGSLFPMSSPGGGLLVGGAMQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
DosR	Hypoxia stress response regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_QOIM01000050.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 22,456 nt. (total: 22,456 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

DQ392_RS31795: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

DQ392_RS31830: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

DQ392_RS31840: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

DQ392_RS31835: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: phosphatase

DQ392_RS31820: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: synthase

DQ392_RS31825: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.54	PKS	oronofacic acid	Pseudomonas syringae
BGC0002171.2	0.53	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.53	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001876.2	0.46	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0000140.5	0.46	PKS	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	Streptomyces sp. 88-682
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001298.4	0.46	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.54	PKS	oronofacic acid	Pseudomonas syringae
BGC0002171.2	0.53	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.53	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001876.2	0.46	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0000140.5	0.46	PKS	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	Streptomyces sp. 88-682
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001298.4	0.46	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 22456:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS31835: mal

PKS_AT (615..915): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.7
inactive: 96.6
Methoxymalonyl-CoA: 58.5
Methylmalonyl-CoA: 36.7
Isobutyryl-CoA: 28.5
Propionyl-CoA: 24.5
Ethylmalonyl-CoA: 23.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_QOIM01000060.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1 - 9,736 nt. (total: 9,736 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

DQ392_RS33845: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Lyases: decarboxylase

DQ392_RS33850: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.77	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.70	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.66	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.63	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.63	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002464.3	0.58	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0001531.5	0.53	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002620.2	0.52	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002690.2	0.52	other (other)	FW0622	Verrucosispora sp. FIM060022

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.77	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.70	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.66	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.63	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.63	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002464.3	0.58	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0001531.5	0.53	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002620.2	0.52	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002690.2	0.52	other (other)	FW0622	Verrucosispora sp. FIM060022

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.62 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.60 out of 36.53

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DmdR1	Iron(II)-dependent repressor

NZ_QOIM01000062.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 8,542 nt. (total: 8,542 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

DQ392_RS33880: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DQ392_RS33885: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Ligases: synthase

DQ392_RS33875: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001219.3	0.52	PKS	shanorellin	Chaetomium globosum CBS 148.51
BGC0002171.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000041.3	0.48	PKS	oronofacic acid	Pseudomonas syringae
BGC0000138.5	0.47	PKS	rimocidin	Streptomyces diastaticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001219.3	0.52	PKS	shanorellin	Chaetomium globosum CBS 148.51
BGC0002171.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000041.3	0.48	PKS	oronofacic acid	Pseudomonas syringae
BGC0000138.5	0.47	PKS	rimocidin	Streptomyces diastaticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

DQ392_RS33875: mal

PKS_AT (568..867): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 165.0
inactive: 83.8
Methoxymalonyl-CoA: 54.7
Methylmalonyl-CoA: 50.9
Isobutyryl-CoA: 35.6
Propionyl-CoA: 34.6
2-Methylbutyryl-CoA: 25.2
Ethylmalonyl-CoA: 24.9
fatty_acid: 20.0
Acetyl-CoA: 14.2
trans-1,2-CPDA: 12.5
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

NZ_QOIM01000063.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 7,635 nt. (total: 7,635 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

DQ392_RS34730: mmal

PKS_AT (1826..2122): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.2
Ethylmalonyl-CoA: 201.4
Methoxymalonyl-CoA: 177.4
2-Methylbutyryl-CoA: 149.4
trans-1,2-CPDA: 141.9
Propionyl-CoA: 114.1
Malonyl-CoA: 99.8
CHC-CoA: 98.0
Isobutyryl-CoA: 73.3
Benzoyl-CoA: 61.2
Acetyl-CoA: 51.6
fatty_acid: 35.4
3-Methylbutyryl-CoA: 32.3
inactive: 30.5

Link to PARAS substrate predictor

NZ_QOIM01000065.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 5,190 nt. (total: 5,190 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS33900: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

DQ392_RS33905: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0000041.3	0.52	PKS	oronofacic acid	Pseudomonas syringae
BGC0001876.2	0.50	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0001051.5	0.50	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0002171.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000143.5	0.50	PKS	salinomycin	Streptomyces albus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0000041.3	0.52	PKS	oronofacic acid	Pseudomonas syringae
BGC0001876.2	0.50	NRPS	thalassospiramide A	Thalassospira sp. CNJ-328
BGC0001051.5	0.50	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0002171.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000143.5	0.50	PKS	salinomycin	Streptomyces albus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.27 out of 23.43

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

DQ392_RS33905: mal

PKS_AT (569..758): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.7
inactive: 39.2
Methylmalonyl-CoA: 36.0
Methoxymalonyl-CoA: 34.4
Isobutyryl-CoA: 28.3
Ethylmalonyl-CoA: 21.7
Propionyl-CoA: 16.7
fatty_acid: 15.4
Acetyl-CoA: 13.7
trans-1,2-CPDA: 12.1
2-Methylbutyryl-CoA: 11.4
CHC-CoA: 9.4
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_QOIM01000040.1 - Region 1 - PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 32,539 nt. (total: 32,539 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

DQ392_RS21920: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase

DQ392_RS21965: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: cyclase dehydratase

DQ392_RS21915: Diels-Alderase cyclase

extras: DA_cyclase: Diels-Alderase cyclase

DQ392_RS21940: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

DQ392_RS21980: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

DQ392_RS21910: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DQ392_RS21930: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

DQ392_RS21935: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.90	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.89	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.88	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.69 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.95 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.78 out of 26.12

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.20 out of 30.22

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.07 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 32539:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS21910: mal

PKS_AT (558..858): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 170.1
inactive: 93.3
Methoxymalonyl-CoA: 56.9
Methylmalonyl-CoA: 54.8
Isobutyryl-CoA: 35.7
Propionyl-CoA: 35.6
fatty_acid: 23.9
Ethylmalonyl-CoA: 23.8
2-Methylbutyryl-CoA: 19.4
Acetyl-CoA: 14.8
trans-1,2-CPDA: 13.1
CHC-CoA: 9.8
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

DQ392_RS21935: pk

PKS_AT (556..848): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 75.0%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 119.9
Methoxymalonyl-CoA: 100.4
Ethylmalonyl-CoA: 94.6
Malonyl-CoA: 90.3
trans-1,2-CPDA: 61.3
Propionyl-CoA: 58.9
Isobutyryl-CoA: 51.7
fatty_acid: 51.2
2-Methylbutyryl-CoA: 45.4
inactive: 43.5
Acetyl-CoA: 41.8
Benzoyl-CoA: 38.2
CHC-CoA: 33.2
3-Methylbutyryl-CoA: 31.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_QOIM01000040.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 164,681 - 175,878 nt. (total: 11,198 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0002553.2	0.30	other (other)	tunicamycin	Rathayibacter iranicus
BGC0002387.2	0.30	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001426.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001427.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001423.4	0.29	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001421.4	0.29	NRPS, PKS	myxochromide B	Myxococcus sp.
BGC0001425.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622
BGC0001428.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001424.4	0.29	NRPS, PKS	myxochromide C	Myxococcus virescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0002553.2	0.30	other (other)	tunicamycin	Rathayibacter iranicus
BGC0002387.2	0.30	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001426.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001427.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001423.4	0.29	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001421.4	0.29	NRPS, PKS	myxochromide B	Myxococcus sp.
BGC0001425.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622
BGC0001428.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001424.4	0.29	NRPS, PKS	myxochromide C	Myxococcus virescens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.17 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.41 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.47 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_QOIM01000040.1 - Region 3 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 245,125 - 267,863 nt. (total: 22,739 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

DQ392_RS23000: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

DQ392_RS23005: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Lyases: cyclase

DQ392_RS22995: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase

DQ392_RS22980: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.58	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0002538.3	0.38	PKS	chaetolivacine A, chaetolivacine B, chaetolivacine C	Chaetomium olivaceum
BGC0001521.3	0.37	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002348.2	0.37	NRPS	aspulvinone E	Aspergillus terreus NIH2624
BGC0001841.2	0.37	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0001972.4	0.37	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0001909.3	0.35	PKS	strobilurin A	Strobilurus tenacellus
BGC0000597.4	0.35	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001267.3	0.34	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001573.3	0.34	other (other)	dihydrolysergic acid	Claviceps africana

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.58	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0002538.3	0.38	PKS	chaetolivacine A, chaetolivacine B, chaetolivacine C	Chaetomium olivaceum
BGC0001521.3	0.37	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002348.2	0.37	NRPS	aspulvinone E	Aspergillus terreus NIH2624
BGC0001841.2	0.37	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0001972.4	0.37	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0001909.3	0.35	PKS	strobilurin A	Strobilurus tenacellus
BGC0000597.4	0.35	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001267.3	0.34	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001573.3	0.34	other (other)	dihydrolysergic acid	Claviceps africana

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.87 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.05 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.75 out of 28.19

Confidence: medium

Additional weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.55 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.25 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.55 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.59 out of 28.19

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
ZuR variant 1	Zinc-responsive repressor

NZ_QOIM01000040.1 - Region 4 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 285,242 - 345,189 nt. (total: 59,948 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

DQ392_RS23165: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DQ392_RS35390: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase kinase

DQ392_RS23155: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

DQ392_RS23250: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase esterase hydrolase peptidase

DQ392_RS23205: thioesterase

smcogs: SMCOG1004: thioesterase

DQ392_RS23295: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

DQ392_RS23345: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

DQ392_RS23350: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

DQ392_RS23365: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: ligase

DQ392_RS23230: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.84	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000041.3	0.77	PKS	oronofacic acid	Pseudomonas syringae
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.68	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000041.3	0.71	PKS	oronofacic acid	Pseudomonas syringae
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (16):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.91 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.02 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.62 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.83 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.32 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.96 out of 36.53

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.22 out of 27.04

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.39 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.98 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.58 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.87 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.15 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.73 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 285241 - 345189:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (Me-mal - Me-ohmal) + (ohmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 285241 - 327005:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (Me-mal - Me-ohmal) + (ohmal - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 290615 - 345189:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (Me-mal - Me-ohmal) + (ohmal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS23230: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (11..414): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YYASFDMAVTTAKVVVGGEVNEYGPTEAAVGCCV
Nearest Stachelhaus code(s):: Asn DMTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

DQ392_RS23250: mmal - mmal

PKS_AT (106..402): mmal

ATSignature: Isobutyryl-CoA

Top 3 matches:: Isobutyryl-CoA: 87.5%; 2-Methylbutyryl-CoA: 70.8%; Propionyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 173.3
Ethylmalonyl-CoA: 171.4
2-Methylbutyryl-CoA: 158.9
Methoxymalonyl-CoA: 140.4
Propionyl-CoA: 130.2
CHC-CoA: 124.8
Malonyl-CoA: 106.2
trans-1,2-CPDA: 99.9
Isobutyryl-CoA: 74.4
Benzoyl-CoA: 54.7
Acetyl-CoA: 36.2
inactive: 32.3
fatty_acid: 25.8
3-Methylbutyryl-CoA: 10.2

PKS_AT (1130..1432): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.2
Ethylmalonyl-CoA: 206.1
Methoxymalonyl-CoA: 171.1
2-Methylbutyryl-CoA: 136.5
trans-1,2-CPDA: 116.9
Malonyl-CoA: 100.9
Propionyl-CoA: 98.3
CHC-CoA: 83.9
Benzoyl-CoA: 77.5
Isobutyryl-CoA: 76.1
Acetyl-CoA: 45.9
inactive: 42.2
3-Methylbutyryl-CoA: 35.5
fatty_acid: 21.9

DQ392_RS35390: mal - mal

PKS_AT (569..865): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.9
inactive: 114.7
Methoxymalonyl-CoA: 60.3
Methylmalonyl-CoA: 55.8
Propionyl-CoA: 36.0
Isobutyryl-CoA: 26.0
2-Methylbutyryl-CoA: 23.1
Ethylmalonyl-CoA: 20.7
Benzoyl-CoA: 17.6
Acetyl-CoA: 17.2
CHC-CoA: 13.0
fatty_acid: 9.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2105..2401): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.1
inactive: 95.1
Methoxymalonyl-CoA: 70.0
Methylmalonyl-CoA: 60.0
Isobutyryl-CoA: 43.8
Ethylmalonyl-CoA: 32.8
Acetyl-CoA: 28.5
Benzoyl-CoA: 27.8
Propionyl-CoA: 22.2
trans-1,2-CPDA: 20.9
fatty_acid: 15.7
2-Methylbutyryl-CoA: 14.3
CHC-CoA: 12.3
3-Methylbutyryl-CoA: 0.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_QOIM01000069.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 4,693 nt. (total: 4,693 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS35920: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000393.5	0.52	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002749.2	0.52	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.51	PKS	curacin A	Moorea producens 19L

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000393.5	0.52	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002749.2	0.52	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.51	PKS	curacin A	Moorea producens 19L

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NZ_QOIM01000051.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 4,596 nt. (total: 4,596 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS31845: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002749.2	0.52	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.51	PKS	curacin A	Moorea producens 19L
BGC0000156.5	0.51	PKS	TAN-1612, 1-(2,3,5,10-tetrahydroxy-7-methoxy-4-oxo-1,2,3,4-tetrahydroanthracen-2-yl)pentane-2,4-dione, desmethyl TAN-1612	Aspergillus niger
BGC0000122.5	0.49	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000041.3	0.48	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002749.2	0.52	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.51	PKS	curacin A	Moorea producens 19L
BGC0000156.5	0.51	PKS	TAN-1612, 1-(2,3,5,10-tetrahydroxy-7-methoxy-4-oxo-1,2,3,4-tetrahydroanthracen-2-yl)pentane-2,4-dione, desmethyl TAN-1612	Aspergillus niger
BGC0000122.5	0.49	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0000041.3	0.48	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NZ_QOIM01000036.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 42,316 - 63,374 nt. (total: 21,059 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

DQ392_RS16365: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: methyltransferase

DQ392_RS16370: methyltransferase

smcogs: SMCOG1089: methyltransferase

DQ392_RS16380: Methylation

MITE: MITE0000031Methylation (identity: 61.80%)
smcogs: SMCOG1042: O-methyltransferase

Lyases: dehydratase

DQ392_RS16360: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

DQ392_RS16390: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000840.5	0.43	other (other)	xanthomonadin I	Xanthomonas oryzae pv. oryzae
BGC0000249.5	0.42	PKS	nogalamycin	Streptomyces nogalater
BGC0000918.3	0.41	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.39	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000821.5	0.38	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0002319.3	0.38	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0000582.4	0.38	ribosomal	cypemycin	Streptomyces sp. OH-4156

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000840.5	0.43	other (other)	xanthomonadin I	Xanthomonas oryzae pv. oryzae
BGC0000249.5	0.42	PKS	nogalamycin	Streptomyces nogalater
BGC0000918.3	0.41	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001456.3	0.40	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.39	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.39	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000821.5	0.38	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0002319.3	0.38	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0000582.4	0.38	ribosomal	cypemycin	Streptomyces sp. OH-4156

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

DQ392_RS16390: PT_FPPS_like

Domain 1 (57 - 335): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.99 out of 29.51

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.41 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.82 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_QOIM01000036.1 - Region 2 - NRPS-like,T3PKS,other,terpene-precursor

Download region GenBank file

Download region SVG

Location: 135,598 - 203,660 nt. (total: 68,063 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: Oxidation oxygenase

DQ392_RS16890: Oxidation

MITE: MITE0000084Oxidation (identity: 72.30%)

DQ392_RS16915: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: aminotransferase methyltransferase

DQ392_RS16795: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

DQ392_RS16895: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

DQ392_RS16900: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

DQ392_RS16965: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: hydrolase

DQ392_RS16855: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: decarboxylase lyase

DQ392_RS16815: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

DQ392_RS17000: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase synthetase

DQ392_RS16885: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

DQ392_RS16905: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DQ392_RS16945: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

DQ392_RS16960: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

DQ392_RS16995: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

DQ392_RS17065: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001078.5	1.24	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000286.3	1.02	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000934.4	0.90	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0002561.3	0.89	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0001080.5	0.86	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0000673.3	0.85	terpene	pimara-8(14),15-diene	Aspergillus nidulans FGSC A4
BGC0000677.5	0.79	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002397.2	0.77	terpene	astallatene	Arabidopsis thaliana
BGC0001249.5	0.76	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000679.5	0.74	terpene	diazepinomicin	Micromonospora sp. M42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001078.5	0.71	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0001249.5	0.70	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002127.3	0.63	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001310.5	0.62	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000902.4	0.62	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002075.3	0.61	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

DQ392_RS16960: PT_FPPS_like

Domain 1 (62 - 333): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

Additional weak hits (7):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.89 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.85 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.62 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 135597 - 203660:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 135597 - 190370:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 159649 - 203660:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS16905: X

AMP-binding (44..432): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RPQIHSRNVAALEASSTFDFQIYGQSEVGPAVGR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

DQ392_RS16990: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (16..430): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWLTFDAAQWEAQCFSGGEVNLYGPTECTINTSA
Nearest Stachelhaus code(s):: Gln DAWQFGLINK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

DQ392_RS17065: X

AMP-binding (26..446): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SDVSFGLYSGGPIGVTMGAFNGYGTTEA-FWNTF
Nearest Stachelhaus code(s):: Ala DLGIVGGMIK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_QOIM01000036.1 - Region 3 - NRPS,RRE-containing,betalactone

Download region GenBank file

Download region SVG

Location: 282,693 - 344,697 nt. (total: 62,005 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS17490: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: acyltransferase aminotransferase

DQ392_RS17565: aminotransferase

smcogs: SMCOG1019: aminotransferase

DQ392_RS17585: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: esterase protease

DQ392_RS17575: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

DQ392_RS17630: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase synthase

DQ392_RS17560: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

DQ392_RS17580: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

DQ392_RS17670: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.87	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.82	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.78	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.75	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000465.4	0.72	NRPS	xenortide A, xenortide B, xenortide C, xenortide D	Xenorhabdus nematophila ATCC 19061
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000465.4	0.69	NRPS	xenortide A, xenortide B, xenortide C, xenortide D	Xenorhabdus nematophila ATCC 19061
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (19):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.89 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.98 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.60 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.72 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.71 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.27 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.37 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.72 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.99 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.23 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.22 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.74 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.17 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.59 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 282692 - 344697:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Cys - Val) + (X - Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 289075 - 344697:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Cys - Val) + (X - Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS17580: X - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (775..1167): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWIAFDFSVWEMNFVVGGEFNVYGPTESTVFATG
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1835..2236): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFMCSGEHNLYGPTEASVDVSF
Nearest Stachelhaus code(s):: Ser DVWHMSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

DQ392_RS17585: Cys - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (460..890): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWVTFDLSVYDGDSFMSGDVGLGGATEATVWSNF
Nearest Stachelhaus code(s):: Cys DLFDFSLVWK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1984..2378): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSSFDASTYEVWLWTGGDVDGYGPTETTTFATA
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_QOIM01000041.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 90,296 - 111,375 nt. (total: 21,080 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

DQ392_RS24275: flavodoxin

smcogs: SMCOG1134: flavodoxin

Ligases: synthetase

DQ392_RS24285: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: permease

DQ392_RS24295: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000678.5	0.32	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.31	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000663.5	0.30	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000706.3	0.29	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000666.5	0.28	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000653.5	0.26	terpene	pentalenolactone	Streptomyces arenae
BGC0001395.5	0.26	other (other)	teichomycin A1	Actinoplanes teichomyceticus
BGC0001156.5	0.25	terpene	platencin	Streptomyces platensis
BGC0002671.2	0.23	PKS	kendomycin B	Verrucosispora sp.
BGC0001140.5	0.22	terpene	platensimycin, platencin, thioplatensimycin, thioplatencin, platensilin, thioplatensilin	Streptomyces platensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000678.5	0.32	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.31	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000663.5	0.30	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000706.3	0.29	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000666.5	0.28	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000653.5	0.26	terpene	pentalenolactone	Streptomyces arenae
BGC0001395.5	0.26	other (other)	teichomycin A1	Actinoplanes teichomyceticus
BGC0001156.5	0.25	terpene	platencin	Streptomyces platensis
BGC0002671.2	0.23	PKS	kendomycin B	Verrucosispora sp.
BGC0001140.5	0.22	terpene	platensimycin, platencin, thioplatensimycin, thioplatencin, platensilin, thioplatensilin	Streptomyces platensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

DQ392_RS24285: PT_FPPS_like

Domain 1 (90 - 338): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.85 out of 27.04

Confidence: medium

Additional weak hits (3):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.43 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.82 out of 25.88

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.46 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor

NZ_QOIM01000041.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 207,834 - 234,559 nt. (total: 26,726 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS24755: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

DQ392_RS24750: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

DQ392_RS24825: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase

DQ392_RS24850: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: synthetase

DQ392_RS24805: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transport

DQ392_RS24780: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.65	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.58	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.50	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000630.3	0.47	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000639.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.65	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.58	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.50	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000630.3	0.47	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000639.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

DQ392_RS24790: PT_phytoene_like

Domain 1 (14 - 295): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

DQ392_RS24795: PT_phytoene_like

Domain 1 (2 - 293): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

DQ392_RS24805: PT_FPPS_like

Domain 1 (68 - 368): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

DQ392_RS24810: T2TS

Domain 1 (29 - 656): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (3):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.63 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.19 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_QOIM01000030.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 194,231 - 238,403 nt. (total: 44,173 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DQ392_RS11850: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

DQ392_RS11870: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

DQ392_RS11875: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase methyltransferase

DQ392_RS11790: methyltransferase

smcogs: SMCOG1089: methyltransferase

DQ392_RS11860: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

DQ392_RS11720: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

DQ392_RS11855: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: ligase

DQ392_RS11775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002359.3	0.64	NRPS	dudomycin A	Streptomyces albus subsp. chlorinus
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002359.3	0.64	NRPS	dudomycin A	Streptomyces albus subsp. chlorinus
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.56 out of 20.97

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (5):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.52 out of 31.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.95 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.92 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 194230 - 238403:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Lys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DQ392_RS11775: Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (502..948): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDTSWEALDLMVGGELNYYGPTECTVDAVW
Nearest Stachelhaus code(s):: Lys DTEDMGYVDK (97% 8Å match); Orn DTEDMGYVDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A

NZ_QOIM01000028.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 90,865 - 112,058 nt. (total: 21,194 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

DQ392_RS09865: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DQ392_RS09875: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

DQ392_RS09900: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

DQ392_RS09905: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DQ392_RS09910: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

DQ392_RS09920: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

DQ392_RS09870: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001483.4	0.45	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001267.3	0.44	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0001317.3	0.42	terpene	lupeol	Lotus japonicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001483.4	0.45	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001267.3	0.44	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0001317.3	0.42	terpene	lupeol	Lotus japonicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

DQ392_RS09870: T1TS

Domain 1 (8 - 311): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

Additional weak hits (2):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.76 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems