GCF_003148865.1 - 35 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_QGHB01000001.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	redox-cofactor	1,474,900	1,496,942	Low	lankacidin C	NRPS:Type I+PKS

NZ_QGHB01000002.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	azole-containing-RiPP	230,097	256,868
Region 2.2	T1PKS	875,049	920,736	Medium	esperamicin	PKS

NZ_QGHB01000003.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	lassopeptide	18,417	40,888	High	citrulassin B	ribosomal:RiPP
Region 3.2	terpene-precursor	159,303	180,307
Region 3.3	terpene	195,493	220,070
Region 3.4	terpene	375,528	403,104	Medium	isorenieratene	terpene
Region 3.5	azole-containing-RiPP	542,417	570,342

NZ_QGHB01000004.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	T3PKS	104,350	146,464
Region 4.2	betalactone	228,427	259,808

NZ_QGHB01000005.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	NI-siderophore,NRPS	297,161	363,940	Low	enduracididine	other:other
Region 5.2	terpene	607,642	626,399

NZ_QGHB01000006.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	hglE-KS	35,736	85,892
Region 6.2	terpene	156,351	177,415	Low	2-methylisoborneol	terpene:Monoterpene
Region 6.3	NRPS	419,092	445,113

NZ_QGHB01000007.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	indole,NRPS,T1PKS	176,721	232,526
Region 7.2	lanthipeptide-class-ii	394,045	416,639

NZ_QGHB01000008.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	T3PKS,terpene	108,625	149,794	Low	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid/5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid/endophenazine A1/endophenazine F/endophenazine G	other:phenazine
Region 8.2	deazapurine	226,478	273,151	Low	toyocamycin	other:other

NZ_QGHB01000010.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	T3PKS	128,545	169,594	Low	loseolamycin A1/loseolamycin A2	PKS

NZ_QGHB01000011.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	lassopeptide,NRP-metallophore,NRPS	77,995	162,938	Medium	amychelin	NRPS:Type I
Region 11.2	terpene	231,781	253,958	High	geosmin	terpene:Sesquiterpene

NZ_QGHB01000013.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	terpene	164,341	187,920
Region 13.2	T2PKS,PKS-like,RiPP-like	204,037	276,516	Low	trioxacarcin A	PKS

NZ_QGHB01000015.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	lanthipeptide-class-i	54,497	79,985

NZ_QGHB01000016.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	lanthipeptide-class-iii	156,868	179,435	Medium	Ery-9/Ery-6/Ery-8/Ery-7/Ery-5/Ery-4/Ery-3	ribosomal:RiPP:Lanthipeptide

NZ_QGHB01000017.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	NRPS-like	43,667	86,066

NZ_QGHB01000018.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	NRPS	1	48,000

NZ_QGHB01000021.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	NAPAA	3,896	37,633	High	ε-Poly-L-lysine	NRPS:Type I

NZ_QGHB01000023.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	NRPS,T1PKS,2dos	11,279	70,732

NZ_QGHB01000025.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	RiPP-like	34,662	45,480

NZ_QGHB01000026.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	terpene	1	44,380

NZ_QGHB01000028.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	T1PKS	1	29,055

NZ_QGHB01000030.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 30.1	terpene	389	16,987	Low	allylmalonyl-CoA	other:other

NZ_QGHB01000032.1 (Lentzea atacamensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	NRPS	1	8,371

No secondary metabolite regions were found in these records:: NZ_QGHB01000009.1 (Lentzea atacamensis); NZ_QGHB01000012.1 (Lentzea atacamensis); NZ_QGHB01000014.1 (Lentzea atacamensis); NZ_QGHB01000019.1 (Lentzea atacamensis); NZ_QGHB01000020.1 (Lentzea atacamensis); NZ_QGHB01000022.1 (Lentzea atacamensis); NZ_QGHB01000024.1 (Lentzea atacamensis); NZ_QGHB01000027.1 (Lentzea atacamensis); NZ_QGHB01000029.1 (Lentzea atacamensis); NZ_QGHB01000031.1 (Lentzea atacamensis); NZ_QGHB01000033.1 (Lentzea atacamensis); NZ_QGHB01000034.1 (Lentzea atacamensis); NZ_QGHB01000035.1 (Lentzea atacamensis); NZ_QGHB01000036.1 (Lentzea atacamensis); NZ_QGHB01000037.1 (Lentzea atacamensis); NZ_QGHB01000038.1 (Lentzea atacamensis); NZ_QGHB01000039.1 (Lentzea atacamensis); NZ_QGHB01000040.1 (Lentzea atacamensis); NZ_QGHB01000041.1 (Lentzea atacamensis)

Compact view

NZ_QGHB01000001.1 - Region 1 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 1,474,900 - 1,496,942 nt. (total: 22,043 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase glycosyltransferase

C8D88_RS07695: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

C8D88_RS07715: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

C8D88_RS07805: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.42	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000906.3	0.42	other (other)	heme D1	Heliophilum fasciatum
BGC0000786.3	0.41	saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000867.3	0.41	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000763.5	0.38	saccharide	stewartan	Pantoea stewartii subsp. stewartii DC283
BGC0001100.5	0.35	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000761.5	0.33	saccharide	exopolysaccharide	Methylobacillus sp. 12S
BGC0001589.3	0.33	saccharide	exopolysaccharides	Burkholderia cenocepacia J2315
BGC0001380.3	0.33	saccharide	salecan	Agrobacterium sp. ZX09
BGC0000799.5	0.32	saccharide	colanic acid	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.42	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000906.3	0.42	other (other)	heme D1	Heliophilum fasciatum
BGC0000786.3	0.41	saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000867.3	0.41	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000763.5	0.38	saccharide	stewartan	Pantoea stewartii subsp. stewartii DC283
BGC0001100.5	0.35	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000761.5	0.33	saccharide	exopolysaccharide	Methylobacillus sp. 12S
BGC0001589.3	0.33	saccharide	exopolysaccharides	Burkholderia cenocepacia J2315
BGC0001380.3	0.33	saccharide	salecan	Agrobacterium sp. ZX09
BGC0000799.5	0.32	saccharide	colanic acid	Escherichia coli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.84 out of 21.55

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 3 - 89; Score: 66.9

TFBS definitions

Regulator	Description

NZ_QGHB01000002.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 230,097 - 256,868 nt. (total: 26,772 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

C8D88_RS10475: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acyltransferase methyltransferase

C8D88_RS10570: acyltransferase

smcogs: SMCOG1141: acyltransferase

C8D88_RS10590: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

C8D88_RS10580: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0001224.5	0.44	other (other)	reductasporine	uncultured bacterium
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002103.2	0.42	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001223.5	0.41	other (other)	hydroxysporine	uncultured bacterium
BGC0001336.5	0.41	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002363.3	0.41	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0001224.5	0.44	other (other)	reductasporine	uncultured bacterium
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002103.2	0.42	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001223.5	0.41	other (other)	hydroxysporine	uncultured bacterium
BGC0001336.5	0.41	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002363.3	0.41	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.62 out of 29.72

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.01 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.74 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.52 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.28 out of 32.93

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
NtrC	Nitrogen regulatory protein C

Core peptide predictions

No core peptides found.

NZ_QGHB01000002.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 875,049 - 920,736 nt. (total: 45,688 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

C8D88_RS13805: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acylase glycosyltransferase

C8D88_RS13670: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

C8D88_RS13690: sugar transferase

smcogs: SMCOG1146: sugar transferase

C8D88_RS13745: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: protease

C8D88_RS13795: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: dehydratase

C8D88_RS13660: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

C8D88_RS13665: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.56	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000107.3	0.56	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 25.31

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.92 out of 23.79

Confidence: medium

Additional weak hits (14):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.69 out of 26.85

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.59 out of 30.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.29 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.64 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.46 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.59 out of 18.57

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.01 out of 32.93

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.43 out of 26.06

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

C8D88_RS13745: mal

PKS_AT (624..849): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.4
Methoxymalonyl-CoA: 55.1
Methylmalonyl-CoA: 49.3
inactive: 20.7
fatty_acid: 20.5
Acetyl-CoA: 20.5
Ethylmalonyl-CoA: 19.4
Isobutyryl-CoA: 18.4
Propionyl-CoA: 17.1
2-Methylbutyryl-CoA: 13.0
Benzoyl-CoA: 12.7
trans-1,2-CPDA: 10.5
CHC-CoA: 10.1
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_QGHB01000003.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 18,417 - 40,888 nt. (total: 22,472 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase kinase

C8D88_RS14110: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

C8D88_RS14125: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: hydrolase

C8D88_RS14085: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

C8D88_RS14095: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001549.3	0.81	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001552.3	0.81	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001550.3	0.75	ribosomal	citrulassin D	Streptomyces katrae
BGC0001551.4	0.75	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.74	ribosomal	citrulassin A	Streptomyces albulus
BGC0001889.2	0.73	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001539.4	0.73	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002074.2	0.72	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0001493.5	0.69	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001549.3	0.81	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001552.3	0.81	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001550.3	0.75	ribosomal	citrulassin D	Streptomyces katrae
BGC0001551.4	0.75	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.74	ribosomal	citrulassin A	Streptomyces albulus
BGC0001889.2	0.73	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001539.4	0.73	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002074.2	0.72	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0001493.5	0.69	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.03 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.25 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.47 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.55 out of 26.12

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.45 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.93 out of 28.19

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 82; Score: 94.7

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_QGHB01000003.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 159,303 - 180,307 nt. (total: 21,005 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

C8D88_RS14745: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

C8D88_RS14770: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

C8D88_RS14780: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: transferase

C8D88_RS14795: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

C8D88_RS14755: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

C8D88_RS14785: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

C8D88_RS14790: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

C8D88_RS14750: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000916.5	0.49	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000278.3	0.46	PKS	urdamycin	Streptomyces fradiae
BGC0001651.3	0.43	other (other)	legionaminic acid	Tannerella forsythia 92A2
BGC0000898.5	0.42	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002400.2	0.42	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000880.4	0.41	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0001224.5	0.41	other (other)	reductasporine	uncultured bacterium
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000916.5	0.49	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000278.3	0.46	PKS	urdamycin	Streptomyces fradiae
BGC0001651.3	0.43	other (other)	legionaminic acid	Tannerella forsythia 92A2
BGC0000898.5	0.42	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002400.2	0.42	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000880.4	0.41	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0001224.5	0.41	other (other)	reductasporine	uncultured bacterium
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

C8D88_RS14750: PT_FPPS_like

Domain 1 (65 - 305): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

Additional weak hits (8):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.69 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.76 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.44 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.13 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000003.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 195,493 - 220,070 nt. (total: 24,578 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

C8D88_RS14945: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: protease

C8D88_RS14965: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

C8D88_RS14925: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

C8D88_RS14930: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase synthetase

C8D88_RS14905: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

C8D88_RS14915: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002397.2	0.59	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.58	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.55	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.55	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002162.3	0.54	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002283.2	0.53	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.53	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002309.2	0.52	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002397.2	0.59	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.58	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.55	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.55	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002162.3	0.54	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002283.2	0.53	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.53	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002309.2	0.52	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH

Genes with terpene domains:

C8D88_RS14915: PT_FPPS_like

Domain 1 (55 - 342): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

C8D88_RS14925: T1TS

Domain 1 (3 - 309): Type 1 terpene synthase

Subtype: unknown

C8D88_RS14930: T1TS

Domain 1 (2 - 324): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.10 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.93 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.38 out of 36.53

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.29 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.98 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.46 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.19 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_QGHB01000003.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 375,528 - 403,104 nt. (total: 27,577 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

C8D88_RS15820: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

C8D88_RS15825: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

C8D88_RS15850: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

C8D88_RS15775: methyltransferase

smcogs: SMCOG1248: methyltransferase

C8D88_RS15815: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: glucosidase hydrolase

C8D88_RS15800: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

C8D88_RS15895: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthetase

C8D88_RS15845: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.68	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.63	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.60	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.59	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.59	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.56	terpene	carotenoid	Myxococcus xanthus
BGC0000636.3	0.54	terpene	carotenoid	Brevibacterium linens
BGC0000645.3	0.49	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000644.3	0.49	terpene	carotenoid	Dietzia sp. CQ4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.68	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.63	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.60	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.59	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.59	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.56	terpene	carotenoid	Myxococcus xanthus
BGC0000636.3	0.54	terpene	carotenoid	Brevibacterium linens
BGC0000645.3	0.49	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000644.3	0.49	terpene	carotenoid	Dietzia sp. CQ4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

C8D88_RS15805: Lycopene_cycl

Domain 1 (5 - 94): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

C8D88_RS15810: Lycopene_cycl

Domain 1 (4 - 95): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

C8D88_RS15840: PT_phytoene_like

Domain 1 (17 - 306): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

C8D88_RS15845: PT_FPPS_like

Domain 1 (41 - 350): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (4):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 25.17 out of 33.73

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.63 out of 29.51

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.01 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.41 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000003.1 - Region 5 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 542,417 - 570,342 nt. (total: 27,926 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer

C8D88_RS16615: flavodoxin

smcogs: SMCOG1134: flavodoxin

C8D88_RS16630: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

C8D88_RS16635: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Lyases: dehydratase

C8D88_RS16655: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000606.5	0.59	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001146.5	0.52	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0002311.3	0.51	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001640.3	0.47	ribosomal	kocurin	Kocuria rosea
BGC0001174.4	0.47	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001145.5	0.46	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000613.5	0.45	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0000605.5	0.44	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0001753.3	0.44	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000610.5	0.43	ribosomal	nosiheptide	Streptomyces actuosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000606.5	0.59	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001146.5	0.52	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0002311.3	0.51	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001640.3	0.47	ribosomal	kocurin	Kocuria rosea
BGC0001174.4	0.47	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001145.5	0.46	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000613.5	0.45	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0000605.5	0.44	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0001753.3	0.44	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000610.5	0.43	ribosomal	nosiheptide	Streptomyces actuosus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.06 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.85 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.92 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 27.47 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.13 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.22 out of 32.74

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.03 out of 25.88

Confidence: weak

(Thi)azol(in)e containing peptide predictions

(Thi)azol(in)e containing peptide(s)

C8D88_RS16660

Leader:

MKDLSFDLDDLELGDLAVTSMRDSVALPESGASGGPS

Core:

SCSCSSGSCSSCHQPQLPALTA

Core with dehydrations:

DhaCysDhaCysDhaDhaGDhaCysDhaDhaCysHQPQLPALDhbA

antiSMASH-DB 4.0 matches for C8D88_RS16660

100.0%

NZ_QGHB01000003.1:

Thiopeptides: C8D88_RS16660_thiopeptide

1

SCSCSSGSCSSCHQPQLPALTA

22

SCSCSSGSCSSCHQPQLPALTA

1

SCSCSSGSCSSCHQPQLPALTA

22

28.6%

NZ_CP033068.1:

Lanthipeptides: EAG11_RS21865_lanthipeptide

3

SCSSGSCSSCH

13

SC +GS SSCH

2

SCKTGSSSSCH

12

25.0%

NC_014976.1and 6 others:

NZ_CP029461.1 Lanthipeptides: DJ572_RS00745_lanthipeptideNZ_CP031675.1 Lanthipeptides: DYS67_RS00910_lanthipeptideNZ_CP045824.1 Lanthipeptides: GII78_RS01205_lanthipeptideNZ_CP046591.1 Lanthipeptides: GO004_RS12840_lanthipeptideNZ_CP049924.1 Lanthipeptides: G4G26_RS01205_lanthipeptideNZ_CP095736.1 Lanthipeptides: MX663_RS01330_lanthipeptide

Lanthipeptides: BSN5_RS12800_lanthipeptide

1

SCSCSSGSCSSCH

13

+C CS GSCS+C+

20

TCGCSLGSCSNCN

32

with 4 more sequence matches

25.0%

NZ_BDDH01000005.1and 2 others:

NZ_CP073265.1 Lanthipeptides: KCX77_RS01160_lanthipeptideNZ_JALAUD010000002.1 Lanthipeptides: MOE28_RS05435_lanthipeptide

Lanthipeptides: A7P71_RS15855_lanthipeptide

1

SCSCSSGSCSSCH

13

+C CS GSCS+C

20

TCGCSLGSCSNCK

32

25.0%

NZ_JALBFU010000003.1:

Lanthipeptides: allorf_294763_294888_lanthipeptide

5

SSGSCSSCHQPQLP

18

G C C P+LP

1

ERGRCRVCQNPRLP

14

22.9%

NZ_JANCLX010000058.1:

Lanthipeptides: allorf_14361_14558_lanthipeptide

5

SSGSCSSCHQPQLPA

19

+SGS S+ H+ Q PA

12

ASGSASTGHRTQAPA

26

12.5%

NZ_FMXH01000021.1and 1 other:

NZ_FOTH01000039.1 Lanthipeptides: allorf_45964_46194_lanthipeptide

Lanthipeptides: allorf_000112_000342_lanthipeptide

4

CSSGSCSSCHQPQLPAL

20

C G+CS Q PA+

11

CGEGACSRWRAKQAPAV

27

MIBiG 4.0 matches for C8D88_RS16660

31.8%

BGC0001155.5 (AGY49587.1):

Thiopeptide: GE2270

1

SCSCSSGSCSSC

12

SC+C G C SC

1

SCNCVCGFCCSC

12

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Types:

Type I: Featuring genes encoding indolic acid side ring (series e)
Type II: Featuring the gene coding for quinaldic acid moiety formation (series a, b, and c)
Type III: No genes for synthesizing L-Trp derivatives (series d)

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 0 - 83; Score: 44.5

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

Core peptide predictions

C8D88_RS16660

Putative Type III

Cleavage pHMM score: 2.60

RODEO score: 22

Monoisotopic mass: 2152.9 Da

Molecular weight: 2154.4 Da

Predicted peptide features:
Central ring: pyridine trisubstituted

Macrocycle: 29-member

Alternative weights: (assuming N unmodified Ser/Thr residues); 2172.4 Da N = 1; 2190.4 Da N = 2; 2208.4 Da N = 3; 2226.5 Da N = 4; 2244.5 Da N = 5; 2262.5 Da N = 6; 2280.5 Da N = 7; 2298.5 Da N = 8

NZ_QGHB01000004.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 104,350 - 146,464 nt. (total: 42,115 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase

C8D88_RS17720: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

C8D88_RS17760: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: transferase

C8D88_RS17775: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: deaminase dehalogenase hydrolase

C8D88_RS17725: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

C8D88_RS17805: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

C8D88_RS17835: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

C8D88_RS17855: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: synthase synthetase

C8D88_RS17695: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

C8D88_RS17730: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

C8D88_RS17860: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

C8D88_RS49450: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.70	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000902.4	0.62	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002127.3	0.59	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000285.5	0.56	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001224.5	0.48	other (other)	reductasporine	uncultured bacterium
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000280.5	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000665.5	0.46	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.70	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000902.4	0.62	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002127.3	0.59	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000285.5	0.56	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001224.5	0.48	other (other)	reductasporine	uncultured bacterium
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000280.5	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000665.5	0.46	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (10):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.71 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.56 out of 31.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.27 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.92 out of 28.14

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.61 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.43 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production

NZ_QGHB01000004.1 - Region 2 - betalactone

Download region GenBank file

Download region SVG

Location: 228,427 - 259,808 nt. (total: 31,382 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

C8D88_RS18325: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

C8D88_RS18340: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

C8D88_RS18360: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

C8D88_RS18365: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

C8D88_RS18370: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

C8D88_RS18385: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

C8D88_RS18390: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

C8D88_RS18425: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

C8D88_RS18430: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase methyltransferase

C8D88_RS18345: methyltransferase

smcogs: SMCOG1089: methyltransferase

C8D88_RS18400: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Hydrolases: hydrolase

C8D88_RS18330: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: hydratase

C8D88_RS18375: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

C8D88_RS18420: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

C8D88_RS18320: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

C8D88_RS18380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002274.2	0.56	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0000867.3	0.55	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000866.5	0.53	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0000671.3	0.45	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001983.3	0.45	other (other)	triacsin C	Kitasatospora aureofaciens
BGC0001987.2	0.45	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000218.5	0.44	PKS	doxorubicin	Streptomyces peucetius
BGC0002474.2	0.44	NRPS	agrobactin	Agrobacterium tumefaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002274.2	0.56	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0000867.3	0.55	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000866.5	0.53	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0000671.3	0.45	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001983.3	0.45	other (other)	triacsin C	Kitasatospora aureofaciens
BGC0001987.2	0.45	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000218.5	0.44	PKS	doxorubicin	Streptomyces peucetius
BGC0002474.2	0.44	NRPS	agrobactin	Agrobacterium tumefaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.03 out of 20.97

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (2):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.34 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.56 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000005.1 - Region 1 - NI-siderophore,NRPS

Download region GenBank file

Download region SVG

Location: 297,161 - 363,940 nt. (total: 66,780 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

C8D88_RS22110: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

C8D88_RS22130: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

C8D88_RS22140: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: aminotransferase methyltransferase

C8D88_RS22045: aminotransferase

smcogs: SMCOG1019: aminotransferase

C8D88_RS22050: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

C8D88_RS22075: aminotransferase

smcogs: SMCOG1019: aminotransferase

C8D88_RS22080: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

C8D88_RS22065: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

C8D88_RS22135: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: ligase

C8D88_RS22055: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

C8D88_RS22060: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.41	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.40	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.39	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.39	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.38	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.37	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.37	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.36	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.36	NRPS	enniatin	Fusarium equiseti
BGC0001240.4	0.36	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001240.4	0.69	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.91 out of 20.97

Confidence: medium

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.94 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.45 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.05 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.89 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.29 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.48 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.00 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.88 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 297160 - 363940:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - D-Leu - X) + (D-Orn - Thr - D-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 302402 - 363940:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - D-Leu - X) + (D-Orn - Thr - D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS22055: Val - Leu - X

Search NORINE for peptide: strict or relaxed

AMP-binding (8..397): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LGQAFDASTFEAWLLAGGDVNGYGPTEGTTFTAC
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1044..1441): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWYVFDPVALEPVVIAGGDVNHYGPTEATVLATG
Nearest Stachelhaus code(s):: Phe DPLVMGAVIK (68% 8Å match); aIle DALVFGVVLK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2519..2909): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VAICFDGGVQDSSLGTGGDVNIYGPTESTLAVTL
Nearest Stachelhaus code(s):: Phe DGWTGAILSK (56% 8Å match); dclTrp DVCSAGIAAK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

C8D88_RS22060: Orn - Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (508..907): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: TAWSVDLFVGDLATAVGSEVNAYGVTEATVDSTA
Nearest Stachelhaus code(s):: ohEnd DLSVMGAVDK (76% 8Å match); Cit DMEADGAVDK (53% 8Å match); Hty DLGFTGAVCK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1997..2393): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3040..3448): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LVWSVDLFFSDWVTAVGSEVNAYGATENTVDATL
Nearest Stachelhaus code(s):: ohEnd DLSVMGAVDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000005.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 607,642 - 626,399 nt. (total: 18,758 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

C8D88_RS23520: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: aminotransferase

C8D88_RS23465: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Ligases: ligase

C8D88_RS23535: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000286.3	0.45	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001910.4	0.44	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0002013.4	0.40	ribosomal	curacozole	Streptomyces curacoi
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0002716.2	0.37	NRPS	gamexpeptide A, gamexpeptide B, gamexpeptide E, luminmide B, luminmide D, luminmide E, luminmide F, luminmide G	Photorhabdus laumondii subsp. laumondii
BGC0000384.6	0.37	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0002406.2	0.36	other (other)	hydroxycinnamoyltyramine	Oryza sativa Japonica Group

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000286.3	0.45	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001910.4	0.44	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus
BGC0002013.4	0.40	ribosomal	curacozole	Streptomyces curacoi
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0002716.2	0.37	NRPS	gamexpeptide A, gamexpeptide B, gamexpeptide E, luminmide B, luminmide D, luminmide E, luminmide F, luminmide G	Photorhabdus laumondii subsp. laumondii
BGC0000384.6	0.37	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0002406.2	0.36	other (other)	hydroxycinnamoyltyramine	Oryza sativa Japonica Group

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

C8D88_RS23515: T2TS

Domain 1 (1 - 401): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

C8D88_RS23545: Lycopene_cycl

Domain 1 (103 - 309): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.32 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.31 out of 26.06

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.01 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor

NZ_QGHB01000006.1 - Region 1 - hglE-KS

Download region GenBank file

Download region SVG

Location: 35,736 - 85,892 nt. (total: 50,157 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

C8D88_RS23790: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

C8D88_RS23885: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

C8D88_RS23925: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: glycosyltransferase

C8D88_RS23855: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

C8D88_RS23850: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

C8D88_RS23835: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

C8D88_RS23840: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0000863.3	0.52	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.59	PKS	ACT-Toxin II	Alternaria alternata
BGC0000863.3	0.52	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.88 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.15 out of 30.11

Confidence: strong

Additional weak hits (17):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.52 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.32 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.57 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.77 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 35.63

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 30.11

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.77 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.84 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.75 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.61 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 35735 - 85892:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (pk)
Non-colinear ordering:: C8D88_RS23835 + C8D88_RS23840 + C8D88_RS23845

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS23835: mal

PKS_AT (1134..1415): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 62.3
inactive: 33.3
Methoxymalonyl-CoA: 28.9
Methylmalonyl-CoA: 27.8
Propionyl-CoA: 13.1
trans-1,2-CPDA: 12.8
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

C8D88_RS23840: pk

PKS_AT (564..766): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor

NZ_QGHB01000006.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 156,351 - 177,415 nt. (total: 21,065 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

C8D88_RS24190: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

C8D88_RS24195: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.68	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.60	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000503.5	0.37	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002064.2	0.36	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001387.5	0.32	other (other)	nucleocidin	Streptomyces calvus
BGC0000821.5	0.31	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001366.5	0.30	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.68	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.60	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000503.5	0.37	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002064.2	0.36	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0000662.5	0.35	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001387.5	0.32	other (other)	nucleocidin	Streptomyces calvus
BGC0000821.5	0.31	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001366.5	0.30	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

C8D88_RS24195: T1TS

Domain 1 (4 - 353): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.85 out of 20.97

Confidence: medium

Additional weak hits (4):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.67 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.35 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.32 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A

NZ_QGHB01000006.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 419,092 - 445,113 nt. (total: 26,022 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

C8D88_RS25095: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase

C8D88_RS25165: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase hydratase

C8D88_RS25110: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

C8D88_RS25125: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

C8D88_RS25175: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.56 out of 30.11

Confidence: medium

Additional weak hits (5):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.80 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.83 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.83 out of 27.04

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 419091 - 445113:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS25175: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (464..859): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: YGWSFDVSIGDREIISGTD-NVFGVTEAAIDSIF
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor

NZ_QGHB01000007.1 - Region 1 - NRPS,T1PKS,indole

Download region GenBank file

Download region SVG

Location: 176,721 - 232,526 nt. (total: 55,806 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

C8D88_RS26240: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: esterase peptidase phosphatase

C8D88_RS26140: thioesterase

smcogs: SMCOG1004: thioesterase

C8D88_RS26180: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

C8D88_RS26190: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

C8D88_RS26205: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Ligases: ligase synthase

C8D88_RS26145: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

C8D88_RS26150: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

C8D88_RS26155: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

C8D88_RS26160: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

C8D88_RS26185: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.80	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.78	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.76	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

Additional weak hits (19):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.69 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.01 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.88 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.39 out of 26.33

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.67 out of 26.85

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.84 out of 30.22

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.25 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.86 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.15 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.49 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.52 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.14 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.14 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.51 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.32 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.38 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 176720 - 232526:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 183091 - 229489:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 189553 - 232526:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS26145: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (462..852): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDAATFEGFLVFGGEVNGYGPTETTTFASS
Nearest Stachelhaus code(s):: Val DAFFVGGTFK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

C8D88_RS26150: X

AMP-binding (489..873): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LELAFDVSVADVCLMAGGEVNIYGPTEASIWITS
Nearest Stachelhaus code(s):: Asn DVAFTGSIWK (53% 8Å match); Ser DMFCNGIIWK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

C8D88_RS26155: mal

PKS_AT (519..798): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.1
inactive: 118.9
Methoxymalonyl-CoA: 79.1
Methylmalonyl-CoA: 69.9
Propionyl-CoA: 64.9
Ethylmalonyl-CoA: 45.4
Isobutyryl-CoA: 36.8
2-Methylbutyryl-CoA: 33.4
CHC-CoA: 33.3
trans-1,2-CPDA: 18.4
Acetyl-CoA: 17.1
Benzoyl-CoA: 15.1
3-Methylbutyryl-CoA: 10.4
fatty_acid: 9.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000007.1 - Region 2 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 394,045 - 416,639 nt. (total: 22,595 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

C8D88_RS27080: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

C8D88_RS27140: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase

C8D88_RS27115: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002704.2	0.47	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001229.4	0.41	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000516.4	0.41	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0000527.5	0.41	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002704.2	0.47	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001229.4	0.41	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000516.4	0.41	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0000527.5	0.41	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for C8D88_RS27140

allorf_406636_406737

Leader:

MRSPIFRSRPESSAESGG

Core:

SAPMCSPHARARFCR

Core with dehydrations:

DhaAPMCysDhaPHARARFCysR

antiSMASH-DB 4.0 matches for allorf_406636_406737

100.0%

NZ_QGHB01000007.1:

Lanthipeptides: allorf_406636_406737_lanthipeptide

1

SAPMCSPHARARFCR

15

SAPMCSPHARARFCR

1

SAPMCSPHARARFCR

15

42.9%

NZ_CP099738.1:

Lanthipeptides: allorf_4179451_4179618_lanthipeptide

3

PMCSPHARARFCR

15

PMC ARAR CR

9

PMCGAVARARLCR

21

42.9%

NZ_FOFV01000025.1:

Lanthipeptides: allorf_022541_022708_lanthipeptide

3

PMCSPHARARFCR

15

PMC ARAR CR

9

PMCGAAARARLCR

21

with 3 more sequence matches

29.4%

NZ_CP074380.1:

Lanthipeptides: KGS77_RS26180_lanthipeptide

1

SAPMCSPHARARFC

14

S +C+ HA C

3

SLLLCNSHASVTLC

16

24.0%

NZ_CP068102.1and 1 other:

NZ_CP068102.1 Lanthipeptides: allorf_1181240_1181359_lanthipeptide

Lanthipeptides: allorf_1181240_1181359_lanthipeptide

5

CSPHARARFCR

15

CSPH R R

11

CSPHLRGDTLR

21

15.6%

NZ_GG657754.1and 1 other:

NZ_GG657754.1 Lanthipeptides: allorf_06532096_06532296_lanthipeptide

Lanthipeptides: allorf_06532096_06532296_lanthipeptide

2

APMCSPHAR

10

P C+PH R

11

TPPCTPHGR

19

allorf_413794_413970

Leader:

MALAGRGCNQPAVRERVSPRKRELTDGIHMRKAMAAA

Core:

LTGLALAGLAGTARSRVCGPV

Core with dehydrations:

LDhbGLALAGLAGDhbARDhaRVCysGPV

antiSMASH-DB 4.0 matches for allorf_413794_413970

100.0%

NZ_QGHB01000007.1:

Lanthipeptides: allorf_413794_413970_lanthipeptide

1

LTGLALAGLAGTARSRVCGPV

21

LTGLALAGLAGTARSRVCGPV

1

LTGLALAGLAGTARSRVCGPV

21

allorf_414895_415074

Leader:

MCAIQRNTPVVNTSVSLFGRLKNCLRRSAAAYG

Core:

PRHLRSRFRTLTPSTACGGPVWKDLS

Core with dehydrations:

PRHLRDhaRFRDhbLDhbPDhaDhbACysGGPVWKDLDha

antiSMASH-DB 4.0 matches for allorf_414895_415074

100.0%

NZ_QGHB01000007.1and 1 other:

NZ_QLTT01000004.1 Lanthipeptides: allorf_758223_758402_lanthipeptide

Lanthipeptides: allorf_414895_415074_lanthipeptide

1

PRHLRSRFRTLTPSTACGGPVWKDLS

26

PRHLRSRFRTLTPSTACGGPVWKDLS

1

PRHLRSRFRTLTPSTACGGPVWKDLS

26

20.7%

NZ_CP069396.1:

Lanthipeptides: JRI60_RS31715_lanthipeptide

7

RFRTLTPSTACGGP

20

R + P+T C GP

1

RSAEMQPATGCDGP

14

19.4%

NZ_FMXV01000009.1:

Lanthipeptides: allorf_148385_148519_lanthipeptide

8

FRTLTPSTACGGPVW

22

F + S C GP W

5

FGGFSRSKCCAGPNW

19

with 1 more sequence matches

17.6%

NZ_JAGGQH010000006.1:

Lanthipeptides: J7E20_RS10295_lanthipeptide

15

TACGGPVWK

23

TACG PV++

4

TACGLPVFR

12

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (4):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.30 out of 32.93

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.11 out of 32.93

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.35 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.61 out of 30.97

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_406636_406737 - Class II

Cleavage pHMM score: -4.30

RODEO score: 0

Monoisotopic mass: 1652.8 Da

Molecular weight: 1653.9 Da

Number of bridges: 2

allorf_413794_413970 - Class II

Cleavage pHMM score: -3.70

RODEO score: 0

Monoisotopic mass: 1928.1 Da

Molecular weight: 1929.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1947.3 Da N = 1; 1965.3 Da N = 2

allorf_414895_415074 - Class II

Cleavage pHMM score: -4.50

RODEO score: 0

Monoisotopic mass: 2829.6 Da

Molecular weight: 2831.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2849.3 Da N = 1; 2867.3 Da N = 2; 2885.3 Da N = 3; 2903.3 Da N = 4; 2921.3 Da N = 5

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000008.1 - Region 1 - T3PKS,terpene

Download region GenBank file

Download region SVG

Location: 108,625 - 149,794 nt. (total: 41,170 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

C8D88_RS27515: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase synthetase

C8D88_RS27505: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

C8D88_RS27510: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transporter

C8D88_RS27580: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000673.3	0.59	terpene	pimara-8(14),15-diene	Aspergillus nidulans FGSC A4
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000286.3	0.35	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002561.3	0.33	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0000934.4	0.33	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0000677.5	0.30	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001079.5	0.29	PKS, terpene	napyradiomycin A80915C, napyradiomycin 2, napyradiomycin 3, napyradiomycin 4	Streptomyces aculeolatus
BGC0001080.5	0.29	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0001911.3	0.29	terpene	raimonol	Streptomyces anulatus
BGC0000652.5	0.27	terpene	napyradiomycin	Streptomyces sp. CNQ525

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000673.3	0.63	terpene	pimara-8(14),15-diene	Aspergillus nidulans FGSC A4
BGC0002309.2	0.51	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000286.3	0.50	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002561.3	0.49	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0000934.4	0.49	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001079.5	0.46	PKS, terpene	napyradiomycin A80915C, napyradiomycin 2, napyradiomycin 3, napyradiomycin 4	Streptomyces aculeolatus
BGC0000652.5	0.45	terpene	napyradiomycin	Streptomyces sp. CNQ525
BGC0001080.5	0.45	other (phenazine)	endophenazine A, endophenazine B	Streptomyces anulatus
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

C8D88_RS27510: PT_FPPS_like

Domain 1 (28 - 316): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

C8D88_RS27515: T1TS

Domain 1 (8 - 246): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.03 out of 26.85

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.10 out of 29.72

Confidence: medium

Additional weak hits (8):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.22 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.38 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.70 out of 27.55

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.38 out of 27.18

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.24 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.67 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
HypR	L-hydroxyproline utilization repressor
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism

NZ_QGHB01000008.1 - Region 2 - deazapurine

Download region GenBank file

Download region SVG

Location: 226,478 - 273,151 nt. (total: 46,674 nt) Show pHMM detection rules used

deazapurine: (GTP_cyclohydroI and PTPS and QueE and QueC and not (dpdA1 or bTGT))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

C8D88_RS27950: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: glycosyltransferase

C8D88_RS28035: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase phosphatase

C8D88_RS28135: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

C8D88_RS28155: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Lyases: cyclase

C8D88_RS27970: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001217.5	0.55	other (other)	PreQ0 Base	Streptomyces qinglanensis
BGC0002354.4	0.53	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0000879.5	0.52	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000881.3	0.51	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.51	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000802.5	0.48	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0001937.4	0.47	other (other)	tubercidin	Streptomyces tubercidicus
BGC0001736.3	0.44	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000632.5	0.41	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001610.5	0.41	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001217.5	0.55	other (other)	PreQ0 Base	Streptomyces qinglanensis
BGC0002354.4	0.53	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0000879.5	0.52	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000881.3	0.51	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.51	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000802.5	0.48	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0001937.4	0.47	other (other)	tubercidin	Streptomyces tubercidicus
BGC0001736.3	0.44	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000632.5	0.41	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001610.5	0.41	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.19 out of 24.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.11 out of 25.31

Confidence: medium

Additional weak hits (6):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.16 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.41 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.34 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.47 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.77 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.80 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
LexA variant 2	Repressor of DNA damage response

NZ_QGHB01000010.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 128,545 - 169,594 nt. (total: 41,050 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

C8D88_RS31435: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

C8D88_RS31460: Hydroxylation

MITE: MITE0000081Hydroxylation (identity: 65.70%)
smcogs: SMCOG1006: acyl-CoA dehydrogenase

C8D88_RS31470: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

C8D88_RS31455: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase

C8D88_RS31390: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Isomerases: racemase

C8D88_RS31400: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase

C8D88_RS31465: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transporter

C8D88_RS31495: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001077.4	0.67	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.56	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0001810.3	0.42	PKS	trehangelin	Polymorphospora rubra
BGC0000495.5	0.42	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002285.2	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001610.5	0.40	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0002007.2	0.40	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001077.4	0.67	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.56	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0001810.3	0.42	PKS	trehangelin	Polymorphospora rubra
BGC0000495.5	0.42	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002285.2	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001610.5	0.40	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0002007.2	0.40	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.46 out of 32.38

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.38 out of 29.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.06 out of 36.53

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.71 out of 35.63

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.27 out of 32.93

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.60 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CsoR	Copper-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000011.1 - Region 1 - NRP-metallophore,NRPS,lassopeptide

Download region GenBank file

Download region SVG

Location: 77,995 - 162,938 nt. (total: 84,944 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

C8D88_RS32830: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

C8D88_RS33005: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: isomerase

C8D88_RS33030: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

C8D88_RS32980: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

C8D88_RS32985: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

C8D88_RS32990: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

C8D88_RS32995: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

C8D88_RS33015: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.76	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001050.5	0.74	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0000357.5	0.71	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002544.3	0.71	NRPS	amychelin A, amychelin B	Amycolatopsis methanolica
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000300.5	0.69	NRPS	amychelin	Streptomyces sp. AA4
BGC0002544.3	0.69	NRPS	amychelin A, amychelin B	Amycolatopsis methanolica
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.18 out of 29.51

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.12 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.48 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.07 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.71 out of 23.79

Confidence: medium

Additional weak hits (12):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.43 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.59 out of 30.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.66 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.25 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.94 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.46 out of 27.18

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.23 out of 27.18

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.12 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.54 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 77994 - 162938:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln - D-Fo-OH-Orn) + (D-OH-Orn) + (Ser - D-Ser) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 93359 - 162938:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln - D-Fo-OH-Orn) + (D-OH-Orn) + (Ser - D-Ser) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS32980: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (555..930): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDLSFDLSVYDGNCLLGGDAGLGGTTETAIHSTV
Nearest Stachelhaus code(s):: Ser DLYNLGLIHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

C8D88_RS32985: Ser - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (494..861): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAVDVTY
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1498..1865): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAVDVTY
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

C8D88_RS32990: OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (450..828): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDASWQPWELGVGGEYNLYGPTECTVDSAA
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

C8D88_RS32995: Gln - Fo-OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (440..807): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWMTFDASVWELQFVCGGEHNVYGPTETTVQVTR
Nearest Stachelhaus code(s):: Gln DAWQVGVVDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1431..1827): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISINELYLWCGGEYHGYGPAEATIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

C8D88_RS33015: X

AMP-binding (32..435): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFALASPGGAVQVGGAQQVFGMAEGLLNFTR
Nearest Stachelhaus code(s):: Sal ALPGQGVLNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 87; Score: 61.5

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000011.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 231,781 - 253,958 nt. (total: 22,178 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase kinase

C8D88_RS33540: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

C8D88_RS33575: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase

C8D88_RS33520: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000831.3	0.40	other (other)	violacein	Duganella sp. B2
BGC0001197.5	0.37	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001387.5	0.37	other (other)	nucleocidin	Streptomyces calvus
BGC0000583.5	0.37	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001513.3	0.37	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001488.3	0.36	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0001483.4	0.35	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000877.5	0.35	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000831.3	0.40	other (other)	violacein	Duganella sp. B2
BGC0001197.5	0.37	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001387.5	0.37	other (other)	nucleocidin	Streptomyces calvus
BGC0000583.5	0.37	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001513.3	0.37	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001488.3	0.36	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0001483.4	0.35	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000877.5	0.35	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

C8D88_RS33520: T1TS + T1TS

Domain 1 (1 - 328): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (338 - 688): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (8):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.89 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.80 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.70 out of 36.53

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.11 out of 27.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 30.98

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.87 out of 27.04

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.38 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.96 out of 31.73

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_QGHB01000013.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 164,341 - 187,920 nt. (total: 23,580 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

C8D88_RS36500: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: deformylase

C8D88_RS36395: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthetase

C8D88_RS36450: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001456.3	0.49	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.48	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.47	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.47	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000648.3	0.45	terpene	carotenoid	Myxococcus xanthus
BGC0000641.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000649.3	0.45	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001456.3	0.49	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.48	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.47	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.47	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000648.3	0.45	terpene	carotenoid	Myxococcus xanthus
BGC0000641.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000649.3	0.45	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

C8D88_RS36450: PT_FPPS_like

Domain 1 (58 - 346): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

C8D88_RS36460: PT_phytoene_like

Domain 1 (3 - 276): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.24 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.98 out of 24.78

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.29 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.62 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.42 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.41 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.92 out of 32.93

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.17 out of 39.62

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_QGHB01000013.1 - Region 2 - PKS-like,RiPP-like,T2PKS

Download region GenBank file

Download region SVG

Location: 204,037 - 276,516 nt. (total: 72,480 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
PKS-like: (t2pks2 or ksIII)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

C8D88_RS36670: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

C8D88_RS36720: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

C8D88_RS36750: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

C8D88_RS36840: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

C8D88_RS36845: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

C8D88_RS36855: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

C8D88_RS36885: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

C8D88_RS36905: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

C8D88_RS36925: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

C8D88_RS36940: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase acyltransferase kinase methyltransferase

C8D88_RS36620: acyltransferase

smcogs: SMCOG1141: acyltransferase

C8D88_RS36640: methyltransferase

smcogs: SMCOG1089: methyltransferase

C8D88_RS36645: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

C8D88_RS36665: methyltransferase

smcogs: SMCOG1089: methyltransferase

C8D88_RS36770: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase hydrolase

C8D88_RS36635: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

C8D88_RS36860: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase dehydratase

C8D88_RS36730: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

C8D88_RS36755: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

C8D88_RS36795: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

C8D88_RS36775: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

C8D88_RS36780: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

C8D88_RS36830: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.94	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.71	PKS	spore pigment	Streptomyces collinus
BGC0000234.5	0.68	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.67	PKS	oviedomycin	Streptomyces antibioticus
BGC0000275.4	0.61	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001197.5	0.60	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000271.5	0.59	PKS	spore pigment	Streptomyces avermitilis
BGC0001513.3	0.58	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0002477.3	0.58	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.70	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001723.5	0.61	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0002084.4	0.58	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002477.3	0.57	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0000275.4	0.57	PKS	tetracenomycin C	Streptomyces glaucescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (14):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.48 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.85 out of 30.97

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.48 out of 32.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.41 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.64 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.48 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.98 out of 23.43

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.83 out of 24.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

RREFinder

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

C8D88_RS36770: mal

PKS_AT (5..281): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 48.4
Methylmalonyl-CoA: 34.3
Methoxymalonyl-CoA: 32.8
Propionyl-CoA: 28.6
inactive: 20.2
Ethylmalonyl-CoA: 10.7
fatty_acid: 5.5
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 11 - 111; Score: 70.8; RRE type: NHLP_CD_RRE; Location: 10 - 90; Score: 48.0; RRE type: Cyanobactin_D_RRE; Location: 12 - 87; Score: 46.9

Type II PKS gene cluster prediction details

Cluster section:: 204036 to 276516
Starter unit(s):: 2-methylbutyryl-CoA (Score: 719.0; E-value: 7.48e-160)
Malonyl elongations:: 8|9 (Score: 630.1; E-value: 3e-192)
Product class(es):: anthracycline
aureolic acid
tetracycline
Product molecular weight(s):: 2-methylbutyryl-CoA_8: 396 Da
2-methylbutyryl-CoA_9: 438 Da

C8D88_RS36665: MET (Score: 27.2; E-value: 4.7e-09)
C8D88_RS36670: KR (Score: 45.8; E-value: 1.3e-14)
C8D88_RS36765: CYC C5-C14/C3-C16 (Score: 407.2; E-value: 6.2e-125)
C8D88_RS36770: AT (Score: 364.6; E-value: 1.1e-111); AT ADB23379.1_TLN-05220/TLN-05223_2-methylbutyryl-CoA (Score: 278.0; E-value: 1.94e-92)
C8D88_RS36775: CLF 8|9 (Score: 630.1; E-value: 3e-192)
C8D88_RS36780: KS (Score: 737.5; E-value: 9.4e-225)
C8D88_RS36795: CYC C7-C12 (Score: 413.1; E-value: 1.3e-126)
C8D88_RS36800: ACP (Score: 98.0; E-value: 5.6e-31)
C8D88_RS36830: KSIII (Score: 438.9; E-value: 2.9e-134); KSIII AKT74268.1_Trioxacarcin_2-methylbutyryl-CoA (Score: 441.0; E-value: 7.48e-160)
C8D88_RS36845: KR C9 (Score: 456.7; E-value: 5e-140)
C8D88_RS36925: KR (Score: 38.2; E-value: 2.9e-12)
C8D88_RS36940: KR (Score: 73.9; E-value: 3.7e-23)

TFBS definitions

Regulator	Description

NZ_QGHB01000015.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 54,497 - 79,985 nt. (total: 25,489 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

C8D88_RS38390: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: hydrolase

C8D88_RS38395: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase dehydratase

C8D88_RS38435: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

C8D88_RS48880: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000508.3	0.43	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000556.5	0.41	ribosomal	streptin	Streptococcus pyogenes
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000508.3	0.43	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000556.5	0.41	ribosomal	streptin	Streptococcus pyogenes
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.30 out of 29.25

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.90 out of 30.11

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.60 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 239; Score: 29.5

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_QGHB01000016.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 156,868 - 179,435 nt. (total: 22,568 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

C8D88_RS40170: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acylase

C8D88_RS40235: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: protease

C8D88_RS40185: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

C8D88_RS40210: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: synthase

C8D88_RS40220: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

C8D88_RS40230: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.67	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.64	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000518.3	0.51	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.50	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.67	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.64	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000518.3	0.51	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.50	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for C8D88_RS40210

C8D88_RS40205

Leader:

MGFILDMQDLETPETTSVMAS

Core:

GGSGGGGGGSTTASNASLLLPCSHSTVSLLAC

Core with dehydrations:

GGDhaGGGGGGDhaDhbDhbADhaNADhaLLLPCysDhaHDhaDhbVDhaLLACys

antiSMASH-DB 4.0 matches for C8D88_RS40205

100.0%

NZ_CP016793.1and 2 others:

NZ_QGHB01000016.1 Lanthipeptides: C8D88_RS40205_lanthipeptideNZ_QLTT01000007.1 Lanthipeptides: C8D87_RS29500_lanthipeptide

Lanthipeptides: BBK82_RS02805_lanthipeptide

1

GGSGGGGGGSTTASNASLLLPCSHSTVSLLAC

32

GGSGGGGGGSTTASNASLLLPCSHSTVSLLAC

1

GGSGGGGGGSTTASNASLLLPCSHSTVSLLAC

32

90.9%

NZ_FNET01000005.1and 1 other:

NZ_JAJCXE010000046.1 Lanthipeptides: L6E10_RS30695_lanthipeptide

Lanthipeptides: BLR21_RS13720_lanthipeptide

2

GSGGGGGGSTTASNASLLLPCSHSTVSLLAC

32

G GGGGGGSTTASNASLLLPCSHSTVSLLAC

3

GHGGGGGGSTTASNASLLLPCSHSTVSLLAC

33

90.6%

NZ_QFWW01000007.1:

Lanthipeptides: DI276_RS13535_lanthipeptide

2

GSGGGGGGSTTASNASLLLPCSHSTVSLLAC

32

G GGGGGSTTASNASLLLPCSHSTVSLLAC

1

GGSGGGGGSTTASNASLLLPCSHSTVSLLAC

31

with 44 more sequence matches

Only the first 10 are displayed here.

85.7%

NZ_BMNC01000020.1and 2 others:

NZ_FOFR01000004.1 Lanthipeptides: BMW88_RS12345_lanthipeptideNZ_JAAMPJ010000008.1 Lanthipeptides: G7043_RS27905_lanthipeptide

Lanthipeptides: IEY88_RS39185_lanthipeptide

2

GSGGGGGGSTTASNASLLLPCSHSTVSLLAC

32

G GGGGGGSTTASNASLLLPCSHSTVSLLAC

5

GGGGGGGGSTTASNASLLLPCSHSTVSLLAC

35

75.0%

NZ_PVTF01000018.1:

Lanthipeptides: CLV43_RS41575_lanthipeptide

2

GSGGGGGGSTTASNASLLLPCSHSTVSLLAC

32

SG GGGGSTTAS+ASLLLPCSHS+ SL+ C

1

ASGHGGGGSTTASSASLLLPCSHSSASLVLC

31

71.9%

NZ_BBOJ01000004.1and 8 others:

NZ_BNAR01000026.1 Lanthipeptides: IE307_RS43650_lanthipeptideNZ_CP099738.1 Lanthipeptides: ND450_RS23215_lanthipeptideNZ_FNCC01000020.1 Lanthipeptides: BLT23_RS35745_lanthipeptideNZ_FNIX01000011.1 Lanthipeptides: BLQ91_RS25790_lanthipeptideNZ_FOFV01000016.1 Lanthipeptides: BMY74_RS32885_lanthipeptideNZ_FWYC01000011.1 Lanthipeptides: B9C42_RS41415_lanthipeptideNZ_JAPJDL010000024.1 Lanthipeptides: ORI60_RS35805_lanthipeptideNZ_QQAU01000015.1 Lanthipeptides: DFR72_RS35920_lanthipeptide

Lanthipeptides: AOM45_RS50700_lanthipeptide

10

STTASNASLLLPCSHSTVSLLAC

32

STTASNASLLLPCSHSTVSLLAC

10

STTASNASLLLPCSHSTVSLLAC

32

68.8%

NZ_CP034550.1:

Lanthipeptides: EKG83_RS07645_lanthipeptide

11

TTASNASLLLPCSHSTVSLLAC

32

TTASNASLLLPCSHSTVSLLAC

9

TTASNASLLLPCSHSTVSLLAC

30

65.6%

NZ_FOYL01000007.1:

Lanthipeptides: BM417_RS27140_lanthipeptide

8

GGSTTASNASLLLPCSHSTVSLLAC

32

GGSTTAS+ASLLLPCSHS+ SLL C

7

GGSTTASSASLLLPCSHSSASLLLC

31

58.8%

NZ_JAJHUO010000006.1:

Lanthipeptides: LNK82_RS10890_lanthipeptide

11

TTASNASLLLPCSHSTVSLLAC

32

TTASNASLLLPCSHSTVSL+ C

13

TTASNASLLLPCSHSTVSLVLC

34

58.8%

NZ_LWLC01000002.1:

Lanthipeptides: A6A25_RS42770_lanthipeptide

11

TTASNASLLLPCSHSTVSLLAC

32

TTASNASLLLPCSHSTVSL+ C

13

TTASNASLLLPCSHSTVSLILC

34

56.2%

NZ_JACHJN010000006.1:

Lanthipeptides: FHS29_RS22065_lanthipeptide

11

TTASNASLLLPCSHSTVSLLAC

32

TTASN SLLLPCSHST SL+ C

11

TTASNVSLLLPCSHSTASLVLC

32

53.1%

NZ_CP095376.1:

Lanthipeptides: MUY14_RS34840_lanthipeptide

5

GGGGGSTTASNASLLLPCSHSTVSLLAC

32

G GGG+ SN SLL C+HST+SLL C

1

GHGGGT---SNLSLLAACAHSTLSLLTC

25

53.1%

NZ_FNON01000002.1:

Lanthipeptides: BLV57_RS10465_lanthipeptide

3

SGGGGGGSTTASNASLLLPCSHSTVSLLAC

32

SG GGG SN SLL C++ST+SLL C

1

SGHGGG---EPSNLSLLASCTNSTISLLTC

27

MIBiG 4.0 matches for C8D88_RS40205

18.8%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

25

STVSLLAC

32

S VSLL C

3

SQVSLLVC

10

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.12 out of 23.43

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (7):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.24 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.90 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.79 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.44 out of 26.06

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

C8D88_RS40205 - Class III

Cleavage pHMM score: 10.20

RODEO score: 0

Monoisotopic mass: 2638.3 Da

Molecular weight: 2639.9 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2657.9 Da N = 1; 2675.9 Da N = 2; 2693.9 Da N = 3; 2712.0 Da N = 4; 2730.0 Da N = 5; 2748.0 Da N = 6; 2766.0 Da N = 7; 2784.0 Da N = 8

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000017.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 43,667 - 86,066 nt. (total: 42,400 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

C8D88_RS40585: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: kinase

C8D88_RS40570: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Ligases: ligase

C8D88_RS40490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport transporter

C8D88_RS40415: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

C8D88_RS40505: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0000894.4	0.46	other (other)	citrinin	Monascus aurantiacus
BGC0001627.4	0.42	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0001475.4	0.41	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002285.2	0.41	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002407.3	0.40	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus
BGC0001940.3	0.40	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0000894.4	0.46	other (other)	citrinin	Monascus aurantiacus
BGC0001627.4	0.42	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0001475.4	0.41	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002285.2	0.41	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002407.3	0.40	other (other), saccharide	angustmycin A, angustmycin C	Streptomyces angustmyceticus
BGC0001940.3	0.40	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.20 out of 20.97

Confidence: medium

Additional weak hits (8):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.31 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.34 out of 36.54

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.60 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.41 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.44 out of 36.53

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 43666 - 86066:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS40490: X

AMP-binding (9..354): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NSILYGLSVV-SHGTQAGGFVMYGQTEATARMAY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_QGHB01000018.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 48,000 nt. (total: 48,000 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

C8D88_RS41025: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase

C8D88_RS41000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

C8D88_RS41005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.66	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.66	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.16 out of 26.33

Confidence: medium

Additional weak hits (10):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.37 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.65 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.95 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.80 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.20 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.26 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.84 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 48000:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Orn - D-Orn - D-Orn - D-Orn) + (D-Leu - Leu - D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS41000: Orn - Orn - Orn - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (17..242): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: ---SFDVSIGDREIISGTD-NVFGVTEAAIDSIF
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1313..1709): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: YGWSFDVSIGDREIISGTD-NVFGVTEAAIDSIF
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2786..3195): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: YGWSFDVSIGDREIISGTDVNVFGVTEAAIDSIF
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4278..4668): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: YGWSFDVSIGDREIISGTDVNVFGVTEAAIDSIF
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

C8D88_RS41005: Leu - Leu - X

Search NORINE for peptide: strict or relaxed

AMP-binding (460..859): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDPAFDASTWETFMLAGGEHNMYGPTETTVYASS
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1931..2319): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDPAFDASTWETFMLAGGEYNMYGPTESTVYASF
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2958..3343): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VDPAFDTGAFELLLVVGGDVNAYGPTETTMTCTV
Nearest Stachelhaus code(s):: Thr DGMLVGAIVK (62% 8Å match); Leu DAMLVGAACK (59% 8Å match); Hpg DIWHVGAITK (50% 8Å match); bLys DTEDVGTMVK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_QGHB01000021.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 3,896 - 37,633 nt. (total: 33,738 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase protease

C8D88_RS42800: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

C8D88_RS42875: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

C8D88_RS42885: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

C8D88_RS42890: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

C8D88_RS42895: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001250.4	0.61	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000842.5	0.45	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002514.3	0.45	PKS	julichrome Q6.6	Streptomyces sampsonii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001250.4	0.61	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000842.5	0.45	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002514.3	0.45	PKS	julichrome Q6.6	Streptomyces sampsonii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.58 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.91 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.74 out of 27.04

Confidence: medium

Additional weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.13 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.13 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 3895 - 37633:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS42835: X

AMP-binding (17..389): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism

NZ_QGHB01000023.1 - Region 1 - 2dos,NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 11,279 - 70,732 nt. (total: 59,454 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

C8D88_RS44005: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

C8D88_RS44010: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: aminotransferase glycosyltransferase transferase

C8D88_RS43995: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

C8D88_RS44040: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

C8D88_RS44050: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

C8D88_RS44045: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

C8D88_RS43945: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

C8D88_RS43950: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

C8D88_RS43955: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

C8D88_RS44020: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.22	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	1.04	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	1.04	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	1.02	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	1.01	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.99	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.99	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.99	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.95	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.93	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.37 out of 27.78

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.14 out of 28.19

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.49 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.08 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.44 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.11 out of 27.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.69 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 11278 - 70732:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Pro) + (redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 16532 - 70732:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Pro) + (redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS43945: Thr - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (108..509): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSCHFDVSVWEGTTVFCGEINMYGITEATVHSTF
Nearest Stachelhaus code(s):: Ser DVWNVAMVHK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1151..1543): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWQAFDVSVQEAFLITAGEVNQYGPTETHVTTCH
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

C8D88_RS43950: mal

PKS_AT (536..819): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.4
inactive: 103.9
Methoxymalonyl-CoA: 63.3
Methylmalonyl-CoA: 55.0
Propionyl-CoA: 36.4
Isobutyryl-CoA: 32.0
Ethylmalonyl-CoA: 26.4
fatty_acid: 16.3
2-Methylbutyryl-CoA: 15.7
CHC-CoA: 14.8
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_QGHB01000025.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 34,662 - 45,480 nt. (total: 10,819 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

C8D88_RS44740: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.31	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.29	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.26	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.31	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.29	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.26	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.16 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.17 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.68 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production

NZ_QGHB01000026.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 44,380 nt. (total: 44,380 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

C8D88_RS44925: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

C8D88_RS44945: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

C8D88_RS44950: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthetase

C8D88_RS44915: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

C8D88_RS44940: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

C8D88_RS45070: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transport

C8D88_RS44905: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002309.2	0.53	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001969.3	0.48	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0000639.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000642.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000630.3	0.47	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000638.3	0.46	terpene	carotenoid	Pantoea ananatis
BGC0000643.3	0.46	terpene	carotenoid	Brevundimonas vesicularis
BGC0000664.5	0.46	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002309.2	0.53	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001969.3	0.48	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0000639.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000642.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000630.3	0.47	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000638.3	0.46	terpene	carotenoid	Pantoea ananatis
BGC0000643.3	0.46	terpene	carotenoid	Brevundimonas vesicularis
BGC0000664.5	0.46	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

C8D88_RS44910: PT_phytoene_like

Domain 1 (38 - 311): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

C8D88_RS44915: PT_FPPS_like

Domain 1 (59 - 349): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

C8D88_RS44940: PT_FPPS_like

Domain 1 (66 - 356): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

C8D88_RS44945: T1TS

Domain 1 (2 - 319): Type 1 terpene synthase

Subtype: unknown

C8D88_RS44950: T1TS

Domain 1 (13 - 321): Type 1 terpene synthase

Subtype: unknown

C8D88_RS45070: PT_FPPS_like

Domain 1 (58 - 336): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.09 out of 26.33

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

Additional weak hits (11):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.10 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.62 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.14 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.42 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.23 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.35 out of 32.74

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.12 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.40 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_QGHB01000028.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 29,055 nt. (total: 29,055 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

C8D88_RS45380: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

C8D88_RS45415: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

C8D88_RS45435: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

C8D88_RS45440: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

C8D88_RS45455: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: acylase

C8D88_RS45450: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

C8D88_RS45385: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.67	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.67	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.58 out of 23.79

Confidence: medium

Additional weak hits (2):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.52 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.91 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 29055:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Me-Me-redmal)
Non-colinear ordering:: C8D88_RS45450 + C8D88_RS45385

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS45385: mmal

PKS_AT (563..855): mmal

ATSignature: Methylmalonyl-CoA, Malonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Malonyl-CoA: 79.2%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 135.9
Ethylmalonyl-CoA: 107.5
Methoxymalonyl-CoA: 105.6
trans-1,2-CPDA: 85.0
Malonyl-CoA: 81.0
Propionyl-CoA: 78.2
2-Methylbutyryl-CoA: 77.3
Isobutyryl-CoA: 70.3
Benzoyl-CoA: 57.6
CHC-CoA: 57.1
fatty_acid: 51.1
Acetyl-CoA: 45.2
3-Methylbutyryl-CoA: 36.8
inactive: 24.7

C8D88_RS45450: mal

PKS_AT (10..301): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 93.5
Methoxymalonyl-CoA: 55.3
Methylmalonyl-CoA: 47.1
Propionyl-CoA: 20.1
CHC-CoA: 17.2
Ethylmalonyl-CoA: 14.7
2-Methylbutyryl-CoA: 13.8
fatty_acid: 13.7
Acetyl-CoA: 10.1
trans-1,2-CPDA: 9.4
inactive: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_QGHB01000030.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 389 - 16,987 nt. (total: 16,599 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

C8D88_RS45645: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

C8D88_RS45650: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

C8D88_RS45655: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

C8D88_RS45670: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

C8D88_RS45675: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Lyases: cyclase

C8D88_RS45680: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000286.3	0.38	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000597.4	0.37	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001197.5	0.37	PKS	frankiamicin	Frankia sp. EAN1pec

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000286.3	0.38	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000597.4	0.37	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001197.5	0.37	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

C8D88_RS45680: T1TS

Domain 1 (18 - 328): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

Additional weak hits (2):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.07 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.53 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_QGHB01000032.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 8,371 nt. (total: 8,371 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

C8D88_RS45820: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 8371:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

C8D88_RS45820: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (1251..1638): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: YGWSFDVSIGDREIISGTD-NVFGVTEAAIDSIF
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor