GCF_003112775.1 - 24 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_BFCH01000001.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene-precursor	109,792	130,976

NZ_BFCH01000002.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	NRPS,betalactone	46,784	117,976
Region 2.2	T1PKS	153,171	195,150	Low	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	PKS
Region 2.3	RiPP-like	458,258	469,058

NZ_BFCH01000007.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	T1PKS	1	53,416	Low	microsclerodermin	NRPS:Type I+PKS:Type I
Region 4.2	NRPS-like,NRPS	339,729	388,872	High	isonitrile lipopeptides	NRPS:Type I

NZ_BFCH01000011.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	terpene-precursor	17,333	38,382
Region 8.2	RiPP-like	44,827	56,242

NZ_BFCH01000017.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	NRPS-like	197,035	240,616

NZ_BFCH01000018.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	NRPS-like	60,614	104,129
Region 14.2	NRPS	323,721	381,656	Low	glycopeptidolipid	NRPS:Type I
Region 14.3	T3PKS,T1PKS	489,172	547,491	High	methylated alkyl-resorcinol/methylated acyl-phloroglucinol	PKS
Region 14.4	lanthipeptide-class-ii	573,976	597,191
Region 14.5	NRPS-like	615,161	658,670
Region 14.6	NRPS-like	688,306	731,809
Region 14.7	T1PKS	1,148,667	1,201,152

NZ_BFCH01000019.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	T3PKS	157,223	198,323	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III

NZ_BFCH01000021.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	terpene	222,378	243,037

NZ_BFCH01000023.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	NRP-metallophore,NRPS,T1PKS	1	123,211	High	mycobactin	NRPS:Type I+PKS

NZ_BFCH01000024.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	NRPS	1	6,792

NZ_BFCH01000036.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	CDPS	198,776	220,704
Region 27.2	redox-cofactor	391,093	413,802

NZ_BFCH01000048.1 (Mycobacterium montefiorense)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	NAPAA	1	28,051	High	ε-Poly-L-lysine	NRPS:Type I
Region 31.2	t3nrps-iterative,T1PKS	78,066	140,662

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene-precursor	109,792	130,976
Region 2.1	NRPS,betalactone	46,784	117,976
Region 2.2	T1PKS	153,171	195,150	Low	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	PKS
Region 2.3	RiPP-like	458,258	469,058
Region 4.1	T1PKS	1	53,416	Low	microsclerodermin	NRPS:Type I+PKS:Type I
Region 4.2	NRPS-like,NRPS	339,729	388,872	High	isonitrile lipopeptides	NRPS:Type I
Region 8.1	terpene-precursor	17,333	38,382
Region 8.2	RiPP-like	44,827	56,242
Region 13.1	NRPS-like	197,035	240,616
Region 14.1	NRPS-like	60,614	104,129
Region 14.2	NRPS	323,721	381,656	Low	glycopeptidolipid	NRPS:Type I
Region 14.3	T3PKS,T1PKS	489,172	547,491	High	methylated alkyl-resorcinol/methylated acyl-phloroglucinol	PKS
Region 14.4	lanthipeptide-class-ii	573,976	597,191
Region 14.5	NRPS-like	615,161	658,670
Region 14.6	NRPS-like	688,306	731,809
Region 14.7	T1PKS	1,148,667	1,201,152
Region 15.1	T3PKS	157,223	198,323	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 17.1	terpene	222,378	243,037
Region 19.1	NRP-metallophore,NRPS,T1PKS	1	123,211	High	mycobactin	NRPS:Type I+PKS
Region 20.1	NRPS	1	6,792
Region 27.1	CDPS	198,776	220,704
Region 27.2	redox-cofactor	391,093	413,802
Region 31.1	NAPAA	1	28,051	High	ε-Poly-L-lysine	NRPS:Type I
Region 31.2	t3nrps-iterative,T1PKS	78,066	140,662

No secondary metabolite regions were found in these records:: NZ_BFCH01000006.1 (Mycobacterium montefiorense); NZ_BFCH01000008.1 (Mycobacterium montefiorense); NZ_BFCH01000009.1 (Mycobacterium montefiorense); NZ_BFCH01000010.1 (Mycobacterium montefiorense); NZ_BFCH01000012.1 (Mycobacterium montefiorense); NZ_BFCH01000013.1 (Mycobacterium montefiorense); NZ_BFCH01000014.1 (Mycobacterium montefiorense); NZ_BFCH01000016.1 (Mycobacterium montefiorense); NZ_BFCH01000020.1 (Mycobacterium montefiorense); NZ_BFCH01000022.1 (Mycobacterium montefiorense); NZ_BFCH01000026.1 (Mycobacterium montefiorense); NZ_BFCH01000027.1 (Mycobacterium montefiorense); NZ_BFCH01000028.1 (Mycobacterium montefiorense); NZ_BFCH01000030.1 (Mycobacterium montefiorense); NZ_BFCH01000031.1 (Mycobacterium montefiorense); NZ_BFCH01000032.1 (Mycobacterium montefiorense); NZ_BFCH01000041.1 (Mycobacterium montefiorense); NZ_BFCH01000043.1 (Mycobacterium montefiorense); NZ_BFCH01000045.1 (Mycobacterium montefiorense)

Compact view

NZ_BFCH01000001.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 109,792 - 130,976 nt. (total: 21,185 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: Oxidation

DB708_RS00560: Oxidation

MITE: MITE0000068Oxidation (identity: 64.30%)

Ligases: ligase synthetase

DB708_RS00585: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

DB708_RS00605: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000467.5	0.37	NRPS	yersiniabactin	Yersinia enterocolitica
BGC0001878.2	0.36	NRPS, PKS	detoxin N2, detoxin N3	Streptomyces sp. NRRL B-1347
BGC0002505.3	0.36	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0000648.3	0.34	terpene	carotenoid	Myxococcus xanthus
BGC0001841.2	0.34	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0001806.4	0.34	NRPS	tolaasin A	Pseudomonas tolaasii
BGC0000384.6	0.34	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0000871.4	0.33	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622
BGC0000632.5	0.33	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001760.5	0.32	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000467.5	0.37	NRPS	yersiniabactin	Yersinia enterocolitica
BGC0001878.2	0.36	NRPS, PKS	detoxin N2, detoxin N3	Streptomyces sp. NRRL B-1347
BGC0002505.3	0.36	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0000648.3	0.34	terpene	carotenoid	Myxococcus xanthus
BGC0001841.2	0.34	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0001806.4	0.34	NRPS	tolaasin A	Pseudomonas tolaasii
BGC0000384.6	0.34	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0000871.4	0.33	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622
BGC0000632.5	0.33	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001760.5	0.32	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

DB708_RS00585: PT_FPPS_like

Domain 1 (57 - 390): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 28.63 out of 29.65

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.11 out of 24.78

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 26.85

Confidence: medium

Additional weak hits (3):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.48 out of 25.88

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.39 out of 32.74

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.72 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BFCH01000002.1 - Region 1 - NRPS,betalactone

Download region GenBank file

Download region SVG

Location: 46,784 - 117,976 nt. (total: 71,193 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase methyltransferase

DB708_RS01440: aminotransferase

smcogs: SMCOG1019: aminotransferase

DB708_RS01450: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: hydratase

DB708_RS01420: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

DB708_RS01520: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

DB708_RS28285: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

DB708_RS28290: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

DB708_RS28295: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: permease

DB708_RS01410: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.71	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.94 out of 25.88

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.68 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.17 out of 18.57

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.21 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.19 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 46783 - 117976:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - D-X) + (X - D-Thr - Thr - Thr) + (Thr - NMe-Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS28285: Thr - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (787..1174): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSGHFDFSVWEGTQLLGGEINAYGPTEVTVYASM
Nearest Stachelhaus code(s):: Phe DFWTVAAVCK (74% 8Å match); Val DFESLAAVYK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1843..2247): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSLHFDFSVWEGSRVFGGEINMYGITETTVHASF
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

DB708_RS28290: X - Thr - Thr - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (450..839): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSLHFDFSIWEGTQVIGAEINVYGPTETTMWASK
Nearest Stachelhaus code(s):: Phe DFWTVAAVCK (71% 8Å match); Thr DFWNVGMVHK (62% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1501..1893): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEATQLLGGELNAYGPTEGTVYASM
Nearest Stachelhaus code(s):: Phe DFWTVAAVCK (74% 8Å match); Val DFESLAAVYK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2991..3377): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEATQLLGGEINAYGPTEATVYASM
Nearest Stachelhaus code(s):: Phe DFWTVAAVCK (71% 8Å match); Val DFESLAAVYK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (4044..4430): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: ISTHFDFSVWEATQLLGGEINAYGPSEATVYASM
Nearest Stachelhaus code(s):: Phe DFWTVAAVCK (65% 8Å match); Val DFESLAAVYK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

DB708_RS28295: X - X

AMP-binding (451..839): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QSLHFDFSVWEGTQLIGGEINAYGPTETTIYAAM
Nearest Stachelhaus code(s):: bOH-Tyr DASTLGAICK (62% 8Å match); Hpg DIWHLGAISK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1501..1891): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSLHFDFSVWEGTQVIGAEVNVYGPTETTMWASK
Nearest Stachelhaus code(s):: Phe DFWTVAAVCK (74% 8Å match); Thr DFWNVGMVHK (68% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_BFCH01000002.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 153,171 - 195,150 nt. (total: 41,980 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

DB708_RS01800: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

DB708_RS01815: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DB708_RS01820: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase acylase

DB708_RS01785: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

DB708_RS27495: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase phosphatase

DB708_RS01770: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

DB708_RS01795: thioesterase

smcogs: SMCOG1004: thioesterase

DB708_RS01925: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

DB708_RS01960: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

DB708_RS01810: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DB708_RS01880: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

DB708_RS27490: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

DB708_RS01830: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001161.5	0.60	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0000140.5	0.56	PKS	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	Streptomyces sp. 88-682
BGC0001163.3	0.54	PKS	1-heptadecene	Moorea producens 3L
BGC0001162.3	0.54	PKS	1-heptadecene	Moorea producens JHB

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001161.5	0.60	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0000140.5	0.56	PKS	4-hexadecanoyl-3-hydroxy-2-(hydroxymethyl)-2H-furan-5-one	Streptomyces sp. 88-682
BGC0001163.3	0.54	PKS	1-heptadecene	Moorea producens 3L
BGC0001162.3	0.54	PKS	1-heptadecene	Moorea producens JHB

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.63 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.66 out of 25.75

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.15 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 153170 - 195150:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal)
Non-colinear ordering:: DB708_RS27490 + DB708_RS27495

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS01810: NH2

CAL_domain (44..480): NH2

minowa: NH2

Prediction, score:

NH2: 112.7
AHBA: 19.0
shikimic_acid: 9.4
Acetyl-CoA: 0.5
fatty_acid: -1.0

DB708_RS27495: mal

PKS_AT (196..474): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 119.1
Methoxymalonyl-CoA: 68.2
Methylmalonyl-CoA: 64.5
inactive: 52.9
Propionyl-CoA: 34.6
Isobutyryl-CoA: 30.4
2-Methylbutyryl-CoA: 20.1
Ethylmalonyl-CoA: 16.5
trans-1,2-CPDA: 13.4
CHC-CoA: 11.7
fatty_acid: 9.6
Acetyl-CoA: 9.1
Benzoyl-CoA: 8.2
3-Methylbutyryl-CoA: 7.2

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BFCH01000002.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 458,258 - 469,058 nt. (total: 10,801 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DB708_RS03300: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: dehalogenase

DB708_RS03295: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002007.2	0.38	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000285.5	0.36	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000594.5	0.35	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8
BGC0002729.2	0.34	PKS	sordarial	Neurospora crassa OR74A
BGC0000236.5	0.33	PKS	kinamycin	Streptomyces murayamaensis
BGC0002473.3	0.31	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0000264.5	0.31	PKS	resistomycin, resistoflavine	Streptomyces resistomycificus
BGC0001882.3	0.31	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0001657.4	0.27	NRPS	lysocin	Lysobacter sp. RH2180-5
BGC0000819.5	0.27	NRPS, other (other)	paraherquamide	Penicillium fellutanum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002007.2	0.38	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000285.5	0.36	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000594.5	0.35	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8
BGC0002729.2	0.34	PKS	sordarial	Neurospora crassa OR74A
BGC0000236.5	0.33	PKS	kinamycin	Streptomyces murayamaensis
BGC0002473.3	0.31	NRPS	propanochelin, butanochelin, pentanochelin	Acinetobacter bouvetii DSM 14964 = CIP 107468
BGC0000264.5	0.31	PKS	resistomycin, resistoflavine	Streptomyces resistomycificus
BGC0001882.3	0.31	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0001657.4	0.27	NRPS	lysocin	Lysobacter sp. RH2180-5
BGC0000819.5	0.27	NRPS, other (other)	paraherquamide	Penicillium fellutanum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BFCH01000007.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 53,416 nt. (total: 53,416 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

DB708_RS03715: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS03855: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

DB708_RS03860: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: carboxylase

DB708_RS03835: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: hydrolase

DB708_RS03850: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: synthase

DB708_RS03720: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

DB708_RS03730: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DB708_RS03735: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DB708_RS03740: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DB708_RS03765: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.77	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.77	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.68	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.77	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.77	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.68	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.04 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.36 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.91 out of 28.19

Confidence: medium

Additional weak hits (12):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.15 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.24 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.84 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.05 out of 20.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.41 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.05 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.23 out of 26.06

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.27 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 53416:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal) + (Me-redmal) + (Me-ccmal) + (D-mal) + (Me-redmal)
Non-colinear ordering:: DB708_RS03720 + DB708_RS03725 + DB708_RS03730 + DB708_RS03735 + DB708_RS03740 + DB708_RS03765

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS03720: mmal

PKS_AT (561..797): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 66.7%; Malonyl-CoA: 62.5%; Ethylmalonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 82.6
Methoxymalonyl-CoA: 68.1
Ethylmalonyl-CoA: 66.6
Malonyl-CoA: 61.5
Propionyl-CoA: 53.5
Benzoyl-CoA: 50.9
trans-1,2-CPDA: 48.5
Isobutyryl-CoA: 42.3
fatty_acid: 40.5
CHC-CoA: 35.9
2-Methylbutyryl-CoA: 33.1
inactive: 24.9
Acetyl-CoA: 19.3
3-Methylbutyryl-CoA: 0.0

DB708_RS03730: mmal

PKS_AT (569..864): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 118.0
Methoxymalonyl-CoA: 97.2
Ethylmalonyl-CoA: 91.5
Malonyl-CoA: 88.3
Propionyl-CoA: 74.1
Isobutyryl-CoA: 67.8
trans-1,2-CPDA: 60.8
fatty_acid: 51.5
2-Methylbutyryl-CoA: 48.5
Benzoyl-CoA: 42.5
Acetyl-CoA: 41.5
CHC-CoA: 38.2
inactive: 30.3
3-Methylbutyryl-CoA: 26.2

DB708_RS03735: mmal

PKS_AT (560..852): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 75.0%; Malonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 140.5
Ethylmalonyl-CoA: 118.2
Methoxymalonyl-CoA: 115.2
Malonyl-CoA: 107.4
Isobutyryl-CoA: 82.3
Propionyl-CoA: 81.8
2-Methylbutyryl-CoA: 75.1
trans-1,2-CPDA: 68.6
Acetyl-CoA: 61.4
fatty_acid: 52.2
Benzoyl-CoA: 51.5
CHC-CoA: 49.8
inactive: 38.9
3-Methylbutyryl-CoA: 34.9

DB708_RS03740: mal

PKS_AT (546..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 120.8
Methoxymalonyl-CoA: 72.2
inactive: 62.9
Methylmalonyl-CoA: 57.1
Propionyl-CoA: 39.5
Ethylmalonyl-CoA: 32.4
Benzoyl-CoA: 24.2
2-Methylbutyryl-CoA: 16.0
Isobutyryl-CoA: 13.8
trans-1,2-CPDA: 12.4
fatty_acid: 12.1
CHC-CoA: 10.7
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

DB708_RS03765: mmal

PKS_AT (532..825): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 127.8
Ethylmalonyl-CoA: 108.2
Methoxymalonyl-CoA: 107.2
Malonyl-CoA: 99.5
2-Methylbutyryl-CoA: 82.3
Propionyl-CoA: 72.3
trans-1,2-CPDA: 60.0
Isobutyryl-CoA: 51.9
CHC-CoA: 51.6
Acetyl-CoA: 46.0
fatty_acid: 43.9
inactive: 31.7
3-Methylbutyryl-CoA: 26.1
Benzoyl-CoA: 19.3

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
ZuR variant 1	Zinc-responsive repressor

NZ_BFCH01000007.1 - Region 2 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 339,729 - 388,872 nt. (total: 49,144 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

DB708_RS05360: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

DB708_RS05365: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS05475: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Transferases: formyltransferase methyltransferase

DB708_RS05405: methyltransferase

smcogs: SMCOG1089: methyltransferase

DB708_RS05425: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: dehalogenase glucanase

DB708_RS05375: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

DB708_RS05410: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase dehydratase hydratase

DB708_RS05335: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

DB708_RS05340: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

DB708_RS05370: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase

DB708_RS05415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DB708_RS05420: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

DB708_RS05485: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DB708_RS05495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001627.4	0.70	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0000426.5	0.64	NRPS	sevadicin	Paenibacillus larvae
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0002164.2	0.60	NRPS	peramine	Epichloe festucae
BGC0001133.4	0.60	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001627.4	0.77	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0000426.5	0.65	NRPS	sevadicin	Paenibacillus larvae
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0002164.2	0.64	NRPS	peramine	Epichloe festucae
BGC0001133.4	0.63	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.70 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.70 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 20.47

Confidence: medium

Additional weak hits (11):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.18 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.67 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.22 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.37 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.72 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.88 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.71 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 339728 - 388872:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 339728 - >382610:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 342875 - 388872:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS05415: X

AMP-binding (0..339): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSLYFDASVEEGHQVVAAETNAYGPTESTLCATV
Nearest Stachelhaus code(s):: Phe DAWTVAAICK (71% 8Å match); Tyr DASTVAAVCK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

DB708_RS05420: X

AMP-binding (453..844): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LPLYFDASVEEGHQVVAAETNAYGPTETTLCVTV
Nearest Stachelhaus code(s):: Phe DAWTVAAICK (68% 8Å match); Tyr DASTVAAVCK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

DB708_RS05485: X

AMP-binding (15..422): X

nrpys: Pen, C4:0

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GWIPHIGGLWWTCLGYGGSVQVYGLSETGCTAMC
Nearest Stachelhaus code(s):: Pen or C4:0 IGWCGGVCTK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

DB708_RS05495: X

AMP-binding (489..848): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAVASDVSVEEGDLVIGGEVSTYGPTEATVVVTH
Nearest Stachelhaus code(s):: Lys DIEDVGSVVK (82% 8Å match); bLys DTEDVGTMVK (50% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_BFCH01000011.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 17,333 - 38,382 nt. (total: 21,050 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

DB708_RS07745: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Ligases: synthetase

DB708_RS07720: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001456.3	0.34	terpene	isorenieratene	Streptomyces argillaceus
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000665.5	0.33	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000936.5	0.32	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.32	terpene	isorenieratene	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001456.3	0.34	terpene	isorenieratene	Streptomyces argillaceus
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000665.5	0.33	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000936.5	0.32	other (other)	pyocyanine	Pseudomonas aeruginosa PAO1
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.32	terpene	isorenieratene	Streptomyces collinus Tu 365

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

DB708_RS07720: PT_FPPS_like

Domain 1 (33 - 347): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

Additional weak hits (6):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.17 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.59 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.76 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.59 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BFCH01000011.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 44,827 - 56,242 nt. (total: 11,416 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000468.5	0.36	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.36	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000469.6	0.35	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001903.3	0.27	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0002097.3	0.22	NRPS, PKS, saccharide	kosinostatin	Micromonospora sp. 28ISP2-46
BGC0001406.5	0.22	NRPS	telomycin	Streptomyces canus
BGC0000315.5	0.22	NRPS	CDA1b, CDA2a, CDA2b, CDA3a, CDA3b, CDA4a, CDA4b	Streptomyces coelicolor A3(2)
BGC0002440.3	0.21	NRPS	longicatenamide B, longicatenamide C, longicatenamide A, longicatenamide D	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000468.5	0.36	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.36	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000469.6	0.35	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001903.3	0.27	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0002097.3	0.22	NRPS, PKS, saccharide	kosinostatin	Micromonospora sp. 28ISP2-46
BGC0001406.5	0.22	NRPS	telomycin	Streptomyces canus
BGC0000315.5	0.22	NRPS	CDA1b, CDA2a, CDA2b, CDA3a, CDA3b, CDA4a, CDA4b	Streptomyces coelicolor A3(2)
BGC0002440.3	0.21	NRPS	longicatenamide B, longicatenamide C, longicatenamide A, longicatenamide D	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

Additional weak hits (2):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.32 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.74 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_BFCH01000017.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 197,035 - 240,616 nt. (total: 43,582 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

DB708_RS10900: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS10915: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS10930: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

DB708_RS10955: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

DB708_RS10980: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

DB708_RS11050: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DB708_RS11055: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: acyltransferase

DB708_RS10935: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: back translocase esterase glucosidase

DB708_RS10990: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

DB708_RS11005: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

DB708_RS11020: putative esterase

smcogs: SMCOG1104: putative esterase

Lyases: dehydratase

DB708_RS10920: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase

DB708_RS10965: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.48	other (other)	bacilysin	Bacillus sp. CS93
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000706.3	0.47	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001184.4	0.45	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001625.5	0.45	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883
BGC0001797.3	0.45	ribosomal	telomestatin	Streptomyces anulatus
BGC0001736.3	0.44	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001386.5	0.44	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000248.5	0.44	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000888.5	0.48	other (other)	bacilysin	Bacillus sp. CS93
BGC0002285.2	0.47	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000706.3	0.47	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001184.4	0.45	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001625.5	0.45	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883
BGC0001797.3	0.45	ribosomal	telomestatin	Streptomyces anulatus
BGC0001736.3	0.44	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001386.5	0.44	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000248.5	0.44	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (6):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.70 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.56 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.63 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.20 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.44 out of 21.55

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 197034 - 240616:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS10965: X

AMP-binding (95..527): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTEMHVGGRIPSGMGQGAEI-------TSFSTTA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor

NZ_BFCH01000018.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 60,614 - 104,129 nt. (total: 43,516 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

DB708_RS13110: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase

DB708_RS13155: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: ligase

DB708_RS13105: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0000919.5	0.44	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0002535.2	0.40	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002382.3	0.39	ribosomal	grimoviridin	Grimontia marina
BGC0000313.4	0.39	NRPS	beauvericin	Beauveria bassiana
BGC0001627.4	0.37	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000384.6	0.36	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0002706.2	0.36	NRPS	saframycin Mx1	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0000919.5	0.44	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0002535.2	0.40	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002382.3	0.39	ribosomal	grimoviridin	Grimontia marina
BGC0000313.4	0.39	NRPS	beauvericin	Beauveria bassiana
BGC0001627.4	0.37	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000384.6	0.36	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0002706.2	0.36	NRPS	saframycin Mx1	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.91 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 27.38 out of 29.65

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 23.11 out of 24.78

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.05 out of 24.78

Confidence: medium

Additional weak hits (9):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.25 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.29 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.79 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.85 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.80 out of 26.85

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.11 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 60613 - 104129:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS13105: X

AMP-binding (83..514): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MRSMHVMGRGIGNFAMTGSLDGYGSTEAG-MVLF
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_BFCH01000018.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 323,721 - 381,656 nt. (total: 57,936 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DB708_RS14365: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS14370: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase methyltransferase transferase

DB708_RS14215: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

DB708_RS14220: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

DB708_RS14320: methyltransferase

smcogs: SMCOG1089: methyltransferase

DB708_RS14325: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: decarboxylase dehydratase

DB708_RS14225: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

DB708_RS14235: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

DB708_RS14240: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

DB708_RS14300: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: ligase synthase

DB708_RS14250: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

DB708_RS14290: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DB708_RS14295: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DB708_RS14345: pseudouridine synthase

smcogs: SMCOG1279: pseudouridine synthase

Translocases: transport

DB708_RS14270: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

DB708_RS14275: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.66	NRPS	sevadicin	Paenibacillus larvae
BGC0002276.2	0.65	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001133.4	0.64	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.5	0.66	NRPS	sevadicin	Paenibacillus larvae
BGC0002276.2	0.65	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001133.4	0.64	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.16 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.13 out of 20.97

Confidence: medium

Additional weak hits (10):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.95 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.62 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.94 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.57 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.65 out of 20.97

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.37 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.25 out of 36.53

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.85 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 323720 - 381656:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Phe - D-Thr - D-Ala) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS14290: Phe - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (463..847): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LSFHFDFSVWEATQVVAGEINGYGPTETTVCVAI
Nearest Stachelhaus code(s):: Phe DFWTVAAVCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1952..2353): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSLHFDYSVWEGSQVFGGEINMYGITETTVHASF
Nearest Stachelhaus code(s):: Thr DYWSVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

DB708_RS14295: Ala - X

Search NORINE for peptide: strict or relaxed

AMP-binding (43..428): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LKLHFDVSVWEGCQFVAGEINAYGPTEGTIYAAM
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1539..1926): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LSPHFDVSVWENGQVMAGEINAYGPTEATIYAAI
Nearest Stachelhaus code(s):: Aol DVWYVAAIYK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_BFCH01000018.1 - Region 3 - T1PKS,T3PKS

Download region GenBank file

Download region SVG

Location: 489,172 - 547,491 nt. (total: 58,320 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase phosphate reductase

DB708_RS14905: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

DB708_RS14970: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acylase aminotransferase carbamoyltransferase kinase

DB708_RS14915: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

DB708_RS14920: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

DB708_RS14925: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

DB708_RS14950: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: lyase

DB708_RS14940: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

DB708_RS14935: argininosuccinate synthase

smcogs: SMCOG1291: argininosuccinate synthase

DB708_RS14945: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

DB708_RS14955: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DB708_RS14960: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DB708_RS14965: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

DB708_RS14985: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001665.3	1.06	PKS	methylated alkyl-resorcinol, methylated acyl-phloroglucinol	Mycobacterium marinum M
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001665.3	0.80	PKS	methylated alkyl-resorcinol, methylated acyl-phloroglucinol	Mycobacterium marinum M
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.77 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.49 out of 20.01

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.67 out of 23.79

Confidence: medium

Additional weak hits (12):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.65 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 21.55

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.37 out of 27.04

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.78 out of 39.62

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.59 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.38 out of 31.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.71 out of 25.88

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.52 out of 27.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.04 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.03 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.41 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.48 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 489171 - 547491:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (pk) + (redmal)
Non-colinear ordering:: DB708_RS14960 + DB708_RS14950 + DB708_RS14955

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS14950: pk

PKS_AT (568..861): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 222.0
Methylmalonyl-CoA: 219.0
Methoxymalonyl-CoA: 185.7
2-Methylbutyryl-CoA: 155.0
trans-1,2-CPDA: 133.9
Propionyl-CoA: 115.4
Malonyl-CoA: 110.2
Isobutyryl-CoA: 96.9
CHC-CoA: 94.2
Benzoyl-CoA: 76.0
3-Methylbutyryl-CoA: 52.0
inactive: 50.0
Acetyl-CoA: 46.8
fatty_acid: 41.4

DB708_RS14955: mal

PKS_AT (562..848): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.4
inactive: 87.6
Methoxymalonyl-CoA: 77.0
Methylmalonyl-CoA: 72.2
Propionyl-CoA: 40.2
Ethylmalonyl-CoA: 32.2
CHC-CoA: 25.5
fatty_acid: 23.5
2-Methylbutyryl-CoA: 22.6
Isobutyryl-CoA: 19.5
trans-1,2-CPDA: 19.1
Benzoyl-CoA: 18.4
Acetyl-CoA: 16.5
3-Methylbutyryl-CoA: 0.0

DB708_RS14960: mal

PKS_AT (500..790): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.0
inactive: 95.5
Methoxymalonyl-CoA: 78.5
Methylmalonyl-CoA: 63.6
Propionyl-CoA: 46.0
CHC-CoA: 32.3
fatty_acid: 31.0
Benzoyl-CoA: 30.4
2-Methylbutyryl-CoA: 24.9
Isobutyryl-CoA: 23.3
Ethylmalonyl-CoA: 23.3
trans-1,2-CPDA: 22.0
Acetyl-CoA: 18.2
3-Methylbutyryl-CoA: 0.0

DB708_RS14985: X

AMP-binding (464..873): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SGTTHESALLVGSYLFIGSVEFFATTDGQAVLAN
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_BFCH01000018.1 - Region 4 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 573,976 - 597,191 nt. (total: 23,216 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

DB708_RS15235: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

DB708_RS15250: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Lyases: cyclase

DB708_RS15215: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000528.5	0.53	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.53	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001948.3	0.48	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000504.5	0.46	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001210.5	0.45	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000669.3	0.45	terpene	marneral	Arabidopsis thaliana
BGC0000675.5	0.44	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000528.5	0.53	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.53	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001948.3	0.48	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000504.5	0.46	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001210.5	0.45	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000669.3	0.45	terpene	marneral	Arabidopsis thaliana
BGC0000675.5	0.44	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for DB708_RS15215

allorf_0576386_0576550

Leader:

MSCPENMDIARA

Core:

AGESAGYVLRVCTFTPVTAAATCDLGDVLVLTTGGWPGECIN

Core with dehydrations:

AGEDhaAGYVLRVCysDhbFDhbPVDhbAAADhbCysDLGDVLVLDhbDhbGGWPGECysIN

antiSMASH-DB 4.0 matches for allorf_0576386_0576550

100.0%

NZ_BFCH01000018.1:

Lanthipeptides: allorf_0576386_0576550_lanthipeptide

1

AGESAGYVLRVCTFTPVTAAATCDLGDVLVLTTGGWPGECIN

42

AGESAGYVLRVCTFTPVTAAATCDLGDVLVLTTGGWPGECIN

1

AGESAGYVLRVCTFTPVTAAATCDLGDVLVLTTGGWPGECIN

42

19.0%

NZ_CP035758.1:

Lanthipeptides: EPA93_RS35150_lanthipeptide

1

AGESAGYVLRVCTFTPVTAAATCDLGD

27

AG+ + + +C + AAA C+ G

5

AGQQSYNAILICNTLAILAAAQCNNGS

31

17.6%

NZ_KZ859514.1:

Lanthipeptides: DPQ64_RS06990_lanthipeptide

24

DLGDVLVLTTGGW-PGECI

41

DLGDV + GW G C+

20

DLGDVHTVEWSGWCTGSCL

38

with 3 more sequence matches

16.7%

NZ_LXQN01000007.1:

Lassopeptides: allorf_3937798_3937932_lassopeptide

3

ESAGYVLRVCTFTPVTAAATC

23

+ G L C F P TC

3

KGGGEKLDYCPFRPSKYDGTC

23

16.0%

NZ_CP023465.1:

Lanthipeptides: allorf_4131827_4132054_lanthipeptide

5

AGYVLRVCTFTPVTAAA

21

A +V R C +P T AA

26

ARHVSRHCRQSPATPAA

42

14.5%

NZ_KQ061217.1:

Lanthipeptides: allorf_4229632_4229841_lanthipeptide

9

LRVCTFTPVTAAATCDLGDVLVLTTGGW

36

+V ++T + +C L D+ L G W

3

FKVNSWTFLPHDPSCALYDICRLRRGPW

30

MIBiG 4.0 matches for allorf_0576386_0576550

9.5%

BGC0000503.5 (cinA):

Lanthipeptide: cinnamycin

10

RVCTFTPVT

18

+ C+F P T

3

QSCSFGPFT

11

allorf_0578448_0578525

Leader:

MNLRPLDPQEVAAA

Core:

CLRSSRAVFVA

Core with dehydrations:

CysLRDhaDhaRAVFVA

antiSMASH-DB 4.0 matches for allorf_0578448_0578525

100.0%

NZ_BFCH01000018.1:

Lanthipeptides: allorf_0578448_0578525_lanthipeptide

1

CLRSSRAVFVA

11

CLRSSRAVFVA

1

CLRSSRAVFVA

11

allorf_0580148_0580336

Leader:

MLSVIAAS

Core:

RYALVRLAVSAKGMPAGTFWTTSTGSIEIHRSAKSLSDTGPACGPGAAMPWSPT

Core with dehydrations:

RYALVRLAVDhaAKGMPAGDhbFWDhbDhbDhaDhbGDhaIEIHRDhaAKDhaLDhaDDhbGPACysGPGAAMPWDhaPDhb

antiSMASH-DB 4.0 matches for allorf_0580148_0580336

100.0%

NZ_BFCH01000018.1:

Lanthipeptides: allorf_0580148_0580336_lanthipeptide

1

RYALVRLAVSAKGMPAGTFWTTSTGSIEIHRSAKSLSDTGPACGPGAAMPWSPT

54

RYALVRLAVSAKGMPAGTFWTTSTGSIEIHRSAKSLSDTGPACGPGAAMPWSPT

1

RYALVRLAVSAKGMPAGTFWTTSTGSIEIHRSAKSLSDTGPACGPGAAMPWSPT

54

81.5%

NZ_JACKVL010000013.1:

Lanthipeptides: allorf_1185244_1185420_lanthipeptide

1

RYALVRLAVSAKGMPAGTFWTTSTGSIEIHRSAKSLSDTGPACGPGAAMP

50

RYALVRLAV+AK MPAG WTTSTG+IEIHRSAKSLSDTGPACGPGA MP

1

RYALVRLAVAAKRMPAGASWTTSTGNIEIHRSAKSLSDTGPACGPGADMP

50

21.4%

NZ_BMUG01000001.1:

Lanthipeptides: allorf_0372936_0373142_lanthipeptide

23

STGSIEIHRSAKSLSDTGPACGPGAAMP

50

TG E HR A D CG G A P

1

DTGEYE-HRLAADEEDAVARCGDGPASP

27

with 4 more sequence matches

18.5%

NZ_KN196470.1:

Lanthipeptides: LF63_RS03635_lanthipeptide

12

KGMPAGTFWTTSTGSIEIHRSAKS--LSDTGP

41

KG PAG+ +T S ++ + + + +TGP

1

KGNPAGSLFTVSNVDLKAVGNTREYGVLNTGP

32

14.8%

NC_009621.1and 4 others:

NZ_CP088111.1 Lanthipeptides: allorf_0787499_0787681_lanthipeptideNZ_NBUK01000063.1 Lanthipeptides: allorf_5939_6121_lanthipeptideNZ_VISX01000063.1 Lanthipeptides: allorf_2635_2817_lanthipeptideNZ_VITA01000039.1 Lanthipeptides: allorf_05894_06076_lanthipeptide

Lanthipeptides: allorf_1021255_1021437_lanthipeptide

6

RLAVSAKGMPAGTFWTT

22

RLAV++ P FW T

30

RLAVASCNPPLSRFWFT

46

14.5%

NZ_FOYL01000002.1:

Lanthipeptides: allorf_0629508_0629729_lanthipeptide

26

SIEIHRSAKSLSDTGPACGPGAAMP

50

SI +H L +GP CG +P

17

SIGMHLRVVVLGVSGPVCGLAQNLP

41

13.0%

NZ_GG657757.1and 1 other:

NZ_GG657757.1 Lanthipeptides: SSQG_RS42820_lanthipeptide

Lanthipeptides: SSQG_RS42820_lanthipeptide

15

PAGTFWTTSTGSIEIHRSA

33

P G W + + + HRSA

2

PTGCRWASGSRFVRCHRSA

20

MIBiG 4.0 matches for allorf_0580148_0580336

13.0%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

13

GMPAGTFWTTSTGSIEIHRS

32

G G T+T IH S

14

GALMGCNMKTATCHCSIHVS

33

allorf_0587891_0587971

Leader:

MRRITVVAS

Core:

RSHLIWHQCMQSGGSTR

Core with dehydrations:

RDhaHLIWHQCysMQDhaGGDhaDhbR

antiSMASH-DB 4.0 matches for allorf_0587891_0587971

100.0%

NZ_BFCH01000018.1and 1 other:

NZ_JACKVL010000013.1 Lanthipeptides: allorf_1192978_1193058_lanthipeptide

Lanthipeptides: allorf_0587891_0587971_lanthipeptide

1

RSHLIWHQCMQSGGSTR

17

RSHLIWHQCMQSGGSTR

1

RSHLIWHQCMQSGGSTR

17

allorf_0593429_0593524

Leader:

MEAAGNSVIRGS

Core:

RGANGVSVGLPCCGVQMFT

Core with dehydrations:

RGANGVDhaVGLPCysCysGVQMFDhb

antiSMASH-DB 4.0 matches for allorf_0593429_0593524

100.0%

NZ_BFCH01000018.1:

Lanthipeptides: allorf_0593429_0593524_lanthipeptide

1

RGANGVSVGLPCCGVQMFT

19

RGANGVSVGLPCCGVQMFT

1

RGANGVSVGLPCCGVQMFT

19

59.3%

NZ_JACKVL010000013.1:

Lanthipeptides: allorf_1198506_1198685_lanthipeptide

1

RGANGVSVGLPCCGVQMFT

19

RGA+GV VGLPCCGVQ+FT

9

RGASGVWVGLPCCGVQIFT

27

MIBiG 4.0 matches for allorf_0593429_0593524

10.8%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

5

GVSVGL

10

GV+VG+

18

GVAVGV

23

7.8%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

9

GLPCCG

14

LPCC

45

SLPCCA

50

allorf_0596314_0596454

Leader:

MSIIAGA

Core:

SRRHCYRLVSIRLDVERVIPEERETCRACPYHQPGKHSG

Core with dehydrations:

DhaRRHCysYRLVDhaIRLDVERVIPEEREDhbCysRACysPYHQPGKHDhaG

antiSMASH-DB 4.0 matches for allorf_0596314_0596454

100.0%

NZ_BFCH01000018.1:

Lanthipeptides: allorf_0596314_0596454_lanthipeptide

1

SRRHCYRLVSIRLDVERVIPEERETCRACPYHQPGKHSG

39

SRRHCYRLVSIRLDVERVIPEERETCRACPYHQPGKHSG

1

SRRHCYRLVSIRLDVERVIPEERETCRACPYHQPGKHSG

39

94.9%

NZ_JACKVL010000013.1:

Lanthipeptides: allorf_1201393_1201533_lanthipeptide

1

SRRHCYRLVSIRLDVERVIPEERETCRACPYHQPGKHSG

39

S RHCYRLVSIRLDVERVIP+ERETCRACPYHQPGKHSG

1

SGRHCYRLVSIRLDVERVIPKERETCRACPYHQPGKHSG

39

17.9%

NZ_JPLW01000002.1:

Lanthipeptides: allorf_1062224_1062367_lanthipeptide

23

RETCRACPYHQPGK

36

RET R HQ G+

2

RETVRLVDVHQIGE

15

with 2 more sequence matches

12.8%

NZ_CP036053.1and 7 others:

NZ_JAOPRA010000024.1 Lanthipeptides: OCE16_RS27090_lanthipeptideNZ_KB976667.1 Lanthipeptides: IG5_RS06165_lanthipeptideNZ_LDKD02000003.1 Lanthipeptides: ABH17_RS27060_lanthipeptideNZ_NUAO01000019.1 Lanthipeptides: CN544_RS19345_lanthipeptideNZ_NVFH01000027.1 Lanthipeptides: COL40_RS24675_lanthipeptideNZ_NVHY01000021.1 Lanthipeptides: COM05_RS26660_lanthipeptideNZ_NVOV01000033.1 Lanthipeptides: CON78_RS26470_lanthipeptide

Lanthipeptides: EXW64_RS27135_lanthipeptide

27

RACPYHQPG

35

+ CP+ QPG

11

KDCPWKQPG

19

12.8%

NZ_JVXR01000038.1and 2 others:

NZ_KV815277.1 Lanthipeptides: allorf_235630_235746_lanthipeptideNZ_KV820076.1 Lanthipeptides: allorf_135222_135338_lanthipeptide

Lanthipeptides: allorf_10948_11064_lanthipeptide

18

VIPEERETCRAC

29

+ P+E+E C+ C

2

LTPQEKEVCKIC

13

allorf_0596542_0596658

Leader:

MCVPAEYADADPSQVLAG

Core:

NCATPTTLKPLTIAAVISVP

Core with dehydrations:

NCysADhbPDhbDhbLKPLDhbIAAVIDhaVP

antiSMASH-DB 4.0 matches for allorf_0596542_0596658

100.0%

NZ_BFCH01000018.1:

Lanthipeptides: allorf_0596542_0596658_lanthipeptide

1

NCATPTTLKPLTIAAVISVP

20

NCATPTTLKPLTIAAVISVP

1

NCATPTTLKPLTIAAVISVP

20

90.0%

NZ_JACKVL010000013.1:

Lanthipeptides: allorf_1201621_1201737_lanthipeptide

1

NCATPTTLKPLTIAAVISVP

20

NC TPTTLKPLTIAAVIS P

1

NCVTPTTLKPLTIAAVISAP

20

14.3%

NZ_FUWS01000010.1:

Lanthipeptides: B5D66_RS17810_lanthipeptide

2

CATPTTLKPLTIA

14

CA+ + P TIA

24

CASTCSFGPFTIA

36

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.13 out of 29.72

Confidence: medium

Additional weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.71 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.52 out of 33.14

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_0576386_0576550 - Class II

Cleavage pHMM score: -4.40

RODEO score: 0

Monoisotopic mass: 4117.0 Da

Molecular weight: 4119.6 Da

Number of bridges: 3

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 4137.6 Da N = 1; 4155.7 Da N = 2; 4173.7 Da N = 3; 4191.7 Da N = 4

allorf_0578448_0578525 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 1187.6 Da

Molecular weight: 1188.4 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 1206.4 Da N = 1

allorf_0580148_0580336 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 5327.8 Da

Molecular weight: 5331.0 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 5349.0 Da N = 1; 5367.1 Da N = 2; 5385.1 Da N = 3; 5403.1 Da N = 4; 5421.1 Da N = 5; 5439.1 Da N = 6; 5457.2 Da N = 7; 5475.2 Da N = 8; 5493.2 Da N = 9; 5511.2 Da N = 10; 5529.2 Da N = 11; 5547.3 Da N = 12

allorf_0587891_0587971 - Class II

Cleavage pHMM score: -6.70

RODEO score: 0

Monoisotopic mass: 1926.9 Da

Molecular weight: 1928.1 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 1946.2 Da N = 1; 1964.2 Da N = 2; 1982.2 Da N = 3

allorf_0593429_0593524 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 1874.9 Da

Molecular weight: 1876.2 Da

Number of bridges: 2

Additional modifications: OH

allorf_0596314_0596454 - Class II

Cleavage pHMM score: -6.90

RODEO score: 0

Monoisotopic mass: 4576.3 Da

Molecular weight: 4579.2 Da

Number of bridges: 3

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 4597.2 Da N = 1

allorf_0596542_0596658 - Class II

Cleavage pHMM score: -7.10

RODEO score: 0

Monoisotopic mass: 1935.1 Da

Molecular weight: 1936.3 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 1954.3 Da N = 1; 1972.3 Da N = 2; 1990.4 Da N = 3; 2008.4 Da N = 4

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_BFCH01000018.1 - Region 5 - NRPS-like

Download region GenBank file

Download region SVG

Location: 615,161 - 658,670 nt. (total: 43,510 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase synthase

DB708_RS15395: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

DB708_RS15400: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

DB708_RS15425: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

DB708_RS15435: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

DB708_RS15440: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

DB708_RS15480: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS15500: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

DB708_RS15510: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS15515: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase methyltransferase

DB708_RS15465: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

DB708_RS15470: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase synthase

DB708_RS15395: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

DB708_RS15525: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase

DB708_RS15430: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001757.3	0.47	other (other)	rhabduscin	Xenorhabdus nematophila ATCC 19061
BGC0002474.2	0.46	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001904.2	0.45	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria
BGC0001868.4	0.45	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001625.5	0.44	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883
BGC0000219.4	0.44	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0001334.5	0.43	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis
BGC0001386.5	0.43	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0001369.3	0.43	PKS	metatricycloene	uncultured bacterium
BGC0001987.2	0.43	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001757.3	0.47	other (other)	rhabduscin	Xenorhabdus nematophila ATCC 19061
BGC0002474.2	0.46	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001904.2	0.45	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria
BGC0001868.4	0.45	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001625.5	0.44	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883
BGC0000219.4	0.44	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0001334.5	0.43	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis
BGC0001386.5	0.43	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0001369.3	0.43	PKS	metatricycloene	uncultured bacterium
BGC0001987.2	0.43	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.06 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.56 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.58 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.14 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 615160 - 658670:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS15430: X

AMP-binding (80..511): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VSGMHLGGRLPSGVFVGSAVDGYGLTETGILARD
Nearest Stachelhaus code(s):: Ser DFDTFGGILK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BFCH01000018.1 - Region 6 - NRPS-like

Download region GenBank file

Download region SVG

Location: 688,306 - 731,809 nt. (total: 43,504 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

DB708_RS15685: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

DB708_RS15690: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

DB708_RS15710: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DB708_RS15715: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS15730: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS15765: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS15770: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DB708_RS15795: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

DB708_RS15815: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: peptidase

DB708_RS15745: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

DB708_RS15750: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: hydratase

DB708_RS15720: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

DB708_RS15760: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.74	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000894.4	0.50	other (other)	citrinin	Monascus aurantiacus
BGC0002372.3	0.48	PKS, other (other), terpene	marinoterpin B, marinoterpin A, marinoterpin C	Streptomyces sp.
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001219.3	0.47	PKS	shanorellin	Chaetomium globosum CBS 148.51
BGC0001605.3	0.46	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002347.3	0.46	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0001335.5	0.46	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.74	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000894.4	0.50	other (other)	citrinin	Monascus aurantiacus
BGC0002372.3	0.48	PKS, other (other), terpene	marinoterpin B, marinoterpin A, marinoterpin C	Streptomyces sp.
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001219.3	0.47	PKS	shanorellin	Chaetomium globosum CBS 148.51
BGC0001605.3	0.46	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002347.3	0.46	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0001335.5	0.46	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (4):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.78 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.99 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.09 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.07 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 688305 - 731809:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS15760: X

AMP-binding (95..524): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TAQMHLIGYGYLSLPGGGGRVL------AVGCGS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BFCH01000018.1 - Region 7 - T1PKS

Download region GenBank file

Download region SVG

Location: 1,148,667 - 1,201,152 nt. (total: 52,486 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

DB708_RS17910: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

DB708_RS17920: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS17930: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS17980: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DB708_RS17985: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DB708_RS18070: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: sulfotransferase

DB708_RS18060: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Lyases: dehydratase

DB708_RS17990: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

DB708_RS17995: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DB708_RS18015: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

DB708_RS18075: cobaltochelatase subunit CobN

smcogs: SMCOG1263: cobaltochelatase subunit CobN

DB708_RS28325: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001605.3	0.48	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001504.4	0.47	PKS	amycomicin	Amycolatopsis sp. AA4
BGC0000867.3	0.47	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002234.3	0.47	PKS	flavoglaucin	Aspergillus ruber CBS 135680
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae
BGC0001529.5	0.46	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001987.2	0.45	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001605.3	0.48	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001504.4	0.47	PKS	amycomicin	Amycolatopsis sp. AA4
BGC0000867.3	0.47	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002234.3	0.47	PKS	flavoglaucin	Aspergillus ruber CBS 135680
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae
BGC0001529.5	0.46	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001987.2	0.45	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.33 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.31 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.51 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.94 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 1148666 - 1201152:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS17995: pk - mal

PKS_AT (556..855): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 225.7
Methylmalonyl-CoA: 223.3
Methoxymalonyl-CoA: 182.1
2-Methylbutyryl-CoA: 154.8
trans-1,2-CPDA: 128.2
Malonyl-CoA: 124.9
Propionyl-CoA: 105.0
Isobutyryl-CoA: 94.0
CHC-CoA: 86.2
Benzoyl-CoA: 73.1
Acetyl-CoA: 47.5
inactive: 41.1
3-Methylbutyryl-CoA: 38.1
fatty_acid: 35.7

PKS_AT (2583..2876): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 180.5
inactive: 83.2
Methoxymalonyl-CoA: 65.7
Methylmalonyl-CoA: 51.6
Propionyl-CoA: 44.0
Acetyl-CoA: 22.8
2-Methylbutyryl-CoA: 22.7
Benzoyl-CoA: 19.7
CHC-CoA: 18.7
Isobutyryl-CoA: 13.8
Ethylmalonyl-CoA: 13.8
fatty_acid: 10.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BFCH01000019.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 157,223 - 198,323 nt. (total: 41,101 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

DB708_RS19020: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS19045: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS19050: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DB708_RS19055: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

DB708_RS19095: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

DB708_RS19135: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase methyltransferase

DB708_RS19085: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

DB708_RS19100: Methylation

MITE: MITE0000155Methylation (identity: 61.30%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

DB708_RS19150: methyltransferase

smcogs: SMCOG1089: methyltransferase

DB708_RS19220: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: amidase

DB708_RS19080: amidase

smcogs: SMCOG1105: amidase

Lyases: dehydratase hydratase

DB708_RS19090: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

DB708_RS19125: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

DB708_RS19130: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: synthase

DB708_RS19105: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transport

DB708_RS19145: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.80	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.56	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001924.3	0.54	terpene	ascofuranone	Acremonium egyptiacum
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000902.4	0.52	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.49	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000866.5	0.47	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001262.3	0.46	PKS	AK-toxin I	Alternaria alternata
BGC0002103.2	0.46	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.80	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.56	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001924.3	0.54	terpene	ascofuranone	Acremonium egyptiacum
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000902.4	0.52	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.49	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000866.5	0.47	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001262.3	0.46	PKS	AK-toxin I	Alternaria alternata
BGC0002103.2	0.46	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.44 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.45 out of 25.31

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.81 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.12 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.02 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.52 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.32 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.29 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.04 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.35 out of 30.98

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_BFCH01000021.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 222,378 - 243,037 nt. (total: 20,660 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DB708_RS20805: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS20810: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

DB708_RS20835: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: decarboxylase dehydratase

DB708_RS20750: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

DB708_RS20815: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

DB708_RS20740: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000883.5	0.50	other (other)	arginomycin	Streptomyces arginensis
BGC0000674.5	0.42	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0000866.5	0.41	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000671.3	0.41	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002474.2	0.40	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0000204.5	0.38	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001850.4	0.37	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001797.3	0.37	ribosomal	telomestatin	Streptomyces anulatus
BGC0000253.4	0.36	PKS	oviedomycin	Streptomyces antibioticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000883.5	0.50	other (other)	arginomycin	Streptomyces arginensis
BGC0000674.5	0.42	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0000866.5	0.41	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000671.3	0.41	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002474.2	0.40	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0000204.5	0.38	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001850.4	0.37	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001797.3	0.37	ribosomal	telomestatin	Streptomyces anulatus
BGC0000253.4	0.36	PKS	oviedomycin	Streptomyces antibioticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

DB708_RS20785: TS_Pyr4

Domain 1 (3 - 207): Pyr4 type terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.47 out of 26.85

Confidence: medium

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.13 out of 20.01

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 24.35 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_BFCH01000023.1 - Region 1 - NRP-metallophore,NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 123,211 nt. (total: 123,211 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

DB708_RS21180: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

DB708_RS21200: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

DB708_RS21230: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS21315: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

DB708_RS21385: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DB708_RS21390: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DB708_RS21470: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acylase acyltransferase

DB708_RS21155: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

DB708_RS21400: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: amidase back translocase esterase hydrolase

DB708_RS21060: amidase

smcogs: SMCOG1105: amidase

DB708_RS21165: thioesterase

smcogs: SMCOG1004: thioesterase

DB708_RS21225: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

DB708_RS21330: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Lyases: decarboxylase

DB708_RS21115: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Isomerases: isomerase mutase

DB708_RS21250: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

DB708_RS21445: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

DB708_RS21040: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DB708_RS21145: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

DB708_RS21150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DB708_RS21160: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DB708_RS21170: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

DB708_RS21175: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DB708_RS21395: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DB708_RS21415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

DB708_RS21195: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

DB708_RS21405: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

DB708_RS21430: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	1.06	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.87	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.87	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.76	NRPS	AM-toxin	Alternaria alternata
BGC0001021.5	0.75	NRPS, PKS	mycobactin	Mycobacterium tuberculosis H37Rv
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001021.5	0.72	NRPS, PKS	mycobactin	Mycobacterium tuberculosis H37Rv
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.44 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (14):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.99 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.14 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.48 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.07 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.42 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.16 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.10 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.95 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.80 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.89 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.27 out of 36.53

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.86 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 123211:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal - redmal) + (X) + (Me-ohmal) + (Lys - X) + (D-Lys) + (D-Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 82047:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Me-ohmal) + (Lys - X) + (D-Lys) + (D-Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 72150 - 123211:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal - redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS21040: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (464..864): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSLHFDFSVWEGSQVFGGEINMYGITETTVHASF
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

DB708_RS21145: Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (473..857): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: lys (Lys)

Stachelhaus prediction details:

Stachelhaus sequence:: YDHWFDAAWQPADTALGGEYNCYGPTETTVEAVV
Nearest Stachelhaus code(s):: Lys DAQDAGCVEK (97% 8Å match); N6-ohLys DAQDAGCVEK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

DB708_RS21150: Lys - X

Search NORINE for peptide: strict or relaxed

AMP-binding (502..882): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: lys (Lys)

Stachelhaus prediction details:

Stachelhaus sequence:: YWFAFDVSMGEGHFPIGGEYNFYGPTETVVNCTS
Nearest Stachelhaus code(s):: Lys DVAHPGFINK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1574..1969): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFLEGGMEATAVCGGELNNIGSTETSGAVSR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

DB708_RS21155: mmal

PKS_AT (102..393): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; CE-Malonyl-CoA: 66.7%; Malonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 119.9
Methoxymalonyl-CoA: 118.3
Ethylmalonyl-CoA: 103.2
Malonyl-CoA: 72.6
2-Methylbutyryl-CoA: 65.9
Propionyl-CoA: 62.1
Isobutyryl-CoA: 61.5
trans-1,2-CPDA: 60.1
Benzoyl-CoA: 55.4
CHC-CoA: 55.0
Acetyl-CoA: 40.5
3-Methylbutyryl-CoA: 32.0
inactive: 28.2
fatty_acid: 13.9

DB708_RS21170: X

AMP-binding (560..955): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TFISGDISVMDVHFPTGGDAGLGGATETPVHNTI
Nearest Stachelhaus code(s):: Gly DIYHLGLVWK (32% 8Å match)
Stachelhaus code match:: 70% (weak)

DB708_RS21175: X

AMP-binding (39..446): X

nrpys: Sal

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFPLACPGGALQVGGAQQVFGMAEGLLNYTR
Nearest Stachelhaus code(s):: Sal PLPAQGVLNK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

DB708_RS21395: mal - mal

PKS_AT (549..848): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.1
inactive: 119.1
Methylmalonyl-CoA: 72.0
Methoxymalonyl-CoA: 60.5
Propionyl-CoA: 47.9
Isobutyryl-CoA: 40.2
fatty_acid: 26.1
Acetyl-CoA: 24.1
2-Methylbutyryl-CoA: 23.6
Benzoyl-CoA: 19.0
Ethylmalonyl-CoA: 18.0
CHC-CoA: 16.3
trans-1,2-CPDA: 11.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (2108..2409): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.2
inactive: 114.5
Methylmalonyl-CoA: 83.4
Methoxymalonyl-CoA: 68.0
Propionyl-CoA: 63.7
2-Methylbutyryl-CoA: 40.3
fatty_acid: 39.7
Acetyl-CoA: 30.4
Isobutyryl-CoA: 29.6
trans-1,2-CPDA: 27.8
Benzoyl-CoA: 27.8
CHC-CoA: 26.3
Ethylmalonyl-CoA: 25.2
3-Methylbutyryl-CoA: 9.4

DB708_RS21415: Acetyl-CoA

CAL_domain (39..481): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 38.0
fatty_acid: 20.9
NH2: 12.6
shikimic_acid: 0.0
AHBA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_BFCH01000024.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 6,792 nt. (total: 6,792 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

DB708_RS21545: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.65	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.64	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.65	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.64	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 6792:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS21545: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (459..846): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TDTAFDVSMLEGFMLTGGDQNGYGPTEATIFTTY
Nearest Stachelhaus code(s):: Val DALFLGGTFK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

NZ_BFCH01000036.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 198,776 - 220,704 nt. (total: 21,929 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

DB708_RS24780: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acyltransferase

DB708_RS24745: acyltransferase

smcogs: SMCOG1141: acyltransferase

Lyases: dehydratase

DB708_RS24740: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001948.3	0.50	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000870.5	0.41	other (other)	mycolic acid	Mycobacterium tuberculosis H37Rv
BGC0000871.4	0.36	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622
BGC0001483.4	0.34	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000430.5	0.33	NRPS, PKS	spumigin E, Spumigin E	Nodularia spumigena CCY9414
BGC0002591.2	0.30	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0001504.4	0.30	PKS	amycomicin	Amycolatopsis sp. AA4
BGC0000322.3	0.29	NRPS	chloroeremomycin	Amycolatopsis orientalis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001948.3	0.50	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000870.5	0.41	other (other)	mycolic acid	Mycobacterium tuberculosis H37Rv
BGC0000871.4	0.36	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622
BGC0001483.4	0.34	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000430.5	0.33	NRPS, PKS	spumigin E, Spumigin E	Nodularia spumigena CCY9414
BGC0002591.2	0.30	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0001504.4	0.30	PKS	amycomicin	Amycolatopsis sp. AA4
BGC0000322.3	0.29	NRPS	chloroeremomycin	Amycolatopsis orientalis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.67 out of 25.31

Confidence: medium

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.74 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.98 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.70 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.57 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.72 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.87 out of 27.04

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.66 out of 28.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CatR	H2O2-responsive repressor

NZ_BFCH01000036.1 - Region 2 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 391,093 - 413,802 nt. (total: 22,710 nt) Show pHMM detection rules used

Region on contig edge.

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

DB708_RS25665: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DB708_RS25670: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

DB708_RS25675: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

DB708_RS25685: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

DB708_RS25755: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase

DB708_RS25745: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Hydrolases: phosphatase

DB708_RS25680: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002103.2	0.46	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000769.3	0.45	saccharide	glycopeptidolipid	Mycobacterium avium subsp. hominissuis A5
BGC0000894.4	0.45	other (other)	citrinin	Monascus aurantiacus
BGC0001485.4	0.45	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0000905.5	0.43	other (other)	heme D1	Heliobacillus mobilis
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000906.3	0.43	other (other)	heme D1	Heliophilum fasciatum
BGC0001605.3	0.43	terpene	gibberellin	Sinorhizobium fredii NGR234

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002103.2	0.46	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000769.3	0.45	saccharide	glycopeptidolipid	Mycobacterium avium subsp. hominissuis A5
BGC0000894.4	0.45	other (other)	citrinin	Monascus aurantiacus
BGC0001485.4	0.45	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0000905.5	0.43	other (other)	heme D1	Heliobacillus mobilis
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000906.3	0.43	other (other)	heme D1	Heliophilum fasciatum
BGC0001605.3	0.43	terpene	gibberellin	Sinorhizobium fredii NGR234

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (5):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.05 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.69 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.98 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.24 out of 35.63

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Mycofactocin_RRE; Location: 22 - 102; Score: 101.7

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_BFCH01000048.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 1 - 28,051 nt. (total: 28,051 nt) Show pHMM detection rules used

Region on contig edge.

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

DB708_RS25875: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

DB708_RS25895: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

DB708_RS25945: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase sulfotransferase

DB708_RS25910: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

DB708_RS25940: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: dehydratase hydratase

DB708_RS25870: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

DB708_RS25960: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

DB708_RS25885: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.66	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002518.3	0.46	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000252.5	0.45	PKS	nonactin	Streptomyces griseus subsp. griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.66	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002518.3	0.46	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000252.5	0.45	PKS	nonactin	Streptomyces griseus subsp. griseus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.55 out of 18.46

Confidence: strong

Additional weak hits (3):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.65 out of 28.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.70 out of 20.01

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.90 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 28051:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS25885: X

AMP-binding (34..406): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BFCH01000048.1 - Region 2 - T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 78,066 - 140,662 nt. (total: 62,597 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DB708_RS26320: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DB708_RS26460: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acyltransferase transferase

DB708_RS26335: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

DB708_RS26430: acyltransferase

smcogs: SMCOG1141: acyltransferase

DB708_RS26435: acyltransferase

smcogs: SMCOG1141: acyltransferase

DB708_RS26440: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: esterase hydrolase

DB708_RS26355: putative esterase

smcogs: SMCOG1104: putative esterase

DB708_RS26360: putative esterase

smcogs: SMCOG1104: putative esterase

DB708_RS26425: hydrolase

smcogs: SMCOG1179: hydrolase

Lyases: decarboxylase

DB708_RS28125: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Isomerases: mutase

DB708_RS26495: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

DB708_RS26340: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DB708_RS26345: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001161.5	0.57	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001162.3	0.57	PKS	1-heptadecene	Moorea producens JHB
BGC0001163.3	0.57	PKS	1-heptadecene	Moorea producens 3L
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.50	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.48	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002171.2	0.33	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001161.5	0.62	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001162.3	0.62	PKS	1-heptadecene	Moorea producens JHB
BGC0001163.3	0.62	PKS	1-heptadecene	Moorea producens 3L
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.19 out of 19.26

Confidence: medium

Additional weak hits (16):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.17 out of 29.51

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.63 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.76 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.09 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.16 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.64 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.66 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.37 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.63 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.14 out of 27.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.25 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.79 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.40 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 78065 - 140662:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

DB708_RS26340: pk

PKS_AT (700..1003): pk

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%; Methylmalonyl-CoA: 54.2%

minowa: fatty_acid

Prediction, score:

fatty_acid: 143.9
Methylmalonyl-CoA: 65.6
Methoxymalonyl-CoA: 59.4
Malonyl-CoA: 43.5
Ethylmalonyl-CoA: 36.0
Isobutyryl-CoA: 35.2
Propionyl-CoA: 28.2
trans-1,2-CPDA: 28.0
inactive: 24.2
CHC-CoA: 20.2
2-Methylbutyryl-CoA: 20.2
Benzoyl-CoA: 10.6
Acetyl-CoA: 9.2
3-Methylbutyryl-CoA: 0.0

DB708_RS26345: Acetyl-CoA

CAL_domain (58..511): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 36.7
fatty_acid: 24.5
AHBA: 13.4
NH2: 0.7
shikimic_acid: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems