GCF_003002815.1 - 46 region(s)

Download region SVG

Location: 234,921 - 256,036 nt. (total: 21,116 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CLV43_RS07220: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: methyltransferase

CLV43_RS07185: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

CLV43_RS07190: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

CLV43_RS07215: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.74	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001137.5	0.43	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0001223.5	0.40	other (other)	hydroxysporine	uncultured bacterium
BGC0000597.4	0.39	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000922.5	0.38	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0000929.3	0.36	other (other)	xanthothricin	Burkholderia glumae
BGC0002347.3	0.35	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001895.4	0.34	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.74	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001137.5	0.43	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0001223.5	0.40	other (other)	hydroxysporine	uncultured bacterium
BGC0000597.4	0.39	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000922.5	0.38	PKS	2-heptyl-3-hydroxy-4-quinolone, 2,4-Quinolinediol, 2-heptylquinolin-4(1H)-one	Pseudomonas aeruginosa PAO1
BGC0000929.3	0.36	other (other)	xanthothricin	Burkholderia glumae
BGC0002347.3	0.35	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001895.4	0.34	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

CLV43_RS07190: T1TS

Domain 1 (7 - 367): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

Additional weak hits (6):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.79 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.90 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_PVTF01000002.1 - Region 2 - NRPS,NRPS-like,PKS-like,terpene

Download region SVG

Location: 384,071 - 477,293 nt. (total: 93,223 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (t2pks2 or ksIII)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CLV43_RS07860: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

CLV43_RS07895: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

CLV43_RS07945: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS08030: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

CLV43_RS08050: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

CLV43_RS08105: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase sulfhydrylase

CLV43_RS07905: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

CLV43_RS07975: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: back translocase deaminase esterase glucosidase

CLV43_RS07910: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

CLV43_RS07915: thioesterase

smcogs: SMCOG1004: thioesterase

CLV43_RS07985: thioesterase

smcogs: SMCOG1004: thioesterase

CLV43_RS08020: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

CLV43_RS08120: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: ligase synthase

CLV43_RS07890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS07925: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS07935: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS07940: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS07950: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

CLV43_RS07995: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CLV43_RS08000: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.24	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	1.22	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	1.19	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.19	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.18	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	1.17	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.16	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001251.4	1.13	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	1.13	NRPS	epichloenin A	Epichloe festucae
BGC0001825.4	1.12	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.75	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

CLV43_RS08095: PT_phytoene_like

Domain 1 (8 - 285): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.64 out of 27.55

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.25 out of 24.78

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

Additional weak hits (20):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.83 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.07 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.11 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.60 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.56 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.65 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.54 out of 36.53

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.55 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.48 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.96 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.33 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.13 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.93 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.57 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.00 out of 27.18

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.25 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 384070 - 477293:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Asn) + (NH2 - X - X) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 384070 - 425864:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - X - X) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 393985 - 468059:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Asn) + (NH2 - X - X) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS07890: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (14..407): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LSDCFDPSAFEGWMLAGGDVNGYGPTEDTCFTSC
Nearest Stachelhaus code(s):: Ala DTFWLGGTFK (71% 8Å match); Val DAFWLGGTFK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

CLV43_RS07925: X

AMP-binding (513..903): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDVSMYEGSQLFAGEVNMYGITETTVHASW
Nearest Stachelhaus code(s):: Ser DVYSLALVHK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

CLV43_RS07935: X

AMP-binding (16..418): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQTEIVATGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

CLV43_RS07940: NH2 - X

CAL_domain (39..451): NH2

minowa: NH2

Prediction, score:

NH2: 110.5
fatty_acid: 24.3
AHBA: 5.3
shikimic_acid: 4.8
Acetyl-CoA: 0.1

AMP-binding (1092..1489): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HQMAFDISVWQTELLSTGEHNAYGPAECTDDVTA
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (79% 8Å match); Dab DIWELTADDK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

CLV43_RS08000: Gly - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (11..393): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: TALTFDISVVELQAWCGGEWDLYGPTETTIWSAV
Nearest Stachelhaus code(s):: Gly DILQWGLIWK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1022..1417): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLPVTSPKLVVGGEVNEYGPTETTVGCTW
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
GnfM	Regulator of nitrogen-fixation genes
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_PVTF01000002.1 - Region 3 - lanthipeptide-class-ii

Download region SVG

Location: 791,629 - 814,697 nt. (total: 23,069 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

CLV43_RS09590: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

CLV43_RS09665: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Lyases: cyclase

CLV43_RS09625: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000503.5	0.51	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000528.5	0.48	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002704.2	0.47	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000527.5	0.43	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002346.3	0.42	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000503.5	0.51	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000528.5	0.48	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002704.2	0.47	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.45	ribosomal	archalan α	Halorussus salinus
BGC0000527.5	0.43	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002346.3	0.42	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for CLV43_RS09625

allorf_796702_796920

Leader:

MPPHLLRVHPKNTGARPPWHGVRWPAASSPSPAARPIPPADQEVKNMKKIAIRKTGSIKLTSSAAG

Core:

YCSPCC

Core with dehydrations:

YCysDhaPCysCys

antiSMASH-DB 4.0 matches for allorf_796702_796920

100.0%

Lanthipeptides: allorf_796702_796920_lanthipeptide

1

YCSPCC

6

YCSPCC

1

YCSPCC

6

allorf_797510_797749

Leader:

MMVSLGRGALCGRVGVAAG

Core:

DFECGRLDLGPLFWASSGEKGQVVEPARRLIVSPKTPSQVGRTGGRACSVSLGLGGLLGW

Core with dehydrations:

DFECysGRLDLGPLFWADhaDhaGEKGQVVEPARRLIVDhaPKDhbPDhaQVGRDhbGGRACysDhaVDhaLGLGGLLGW

antiSMASH-DB 4.0 matches for allorf_797510_797749

100.0%

Lanthipeptides: allorf_797510_797749_lanthipeptide

1

DFECGRLDLGPLFWASSGEKGQVVEPARRLIVSPKTPSQVGRTGGRACSVSLGLGGLLGW

60

DFECGRLDLGPLFWASSGEKGQVVEPARRLIVSPKTPSQVGRTGGRACSVSLGLGGLLGW

1

DFECGRLDLGPLFWASSGEKGQVVEPARRLIVSPKTPSQVGRTGGRACSVSLGLGGLLGW

60

20.0%

NZ_JAGPXN010000013.1:

Lanthipeptides: allorf_134935_135108_lanthipeptide

17

SGEKGQVVEPARRLIVSPKTPSQVGRTGGRACSVSLG

53

S + V P R L ++P S + R GR CS ++

2

SAWRSSVCSPVRMLWLTPSRNSALMRHRGRRCSSAIA

38

19.7%

NZ_KB896392.1:

Lanthipeptides: allorf_142287_142517_lanthipeptide

12

LFWASSGEKGQVVEPARRLIVSPKTPSQVGRTGGRACSVSL

52

W G + PAR + VS + S V R RA V +

5

FLWLRRGATRALRSPARAVAVSARCRSAVIRHPRRALPVRV

45

with 3 more sequence matches

14.8%

NZ_AUCI01000015.1:

Lanthipeptides: allorf_01258_01473_lanthipeptide

43

TGGRACSVSLGLGGLLG

59

TG R CS+ L LLG

7

TGIRCCSIIYLLSALLG

23

11.7%

NZ_JAASAG010000001.1:

Lanthipeptides: allorf_345810_345944_lanthipeptide

33

SPKTPSQVGRTGG

45

SPK+P+Q+ R G

2

SPKSPTQLARVGA

14

11.7%

Lanthipeptides: allorf_797655_797861_lanthipeptide

4

CGRLDLG

10

CGRLDLG

40

CGRLDLG

46

allorf_797655_797861

Leader:

MGCADGLSRRTEGEAGG

Core:

ERPTGAPTTIGRAERTKCTPITNRANRPTPTKPSKLVRPCGRLDLGFLGLQ

Core with dehydrations:

ERPDhbGAPDhbDhbIGRAERDhbKCysDhbPIDhbNRANRPDhbPDhbKPDhaKLVRPCysGRLDLGFLGLQ

antiSMASH-DB 4.0 matches for allorf_797655_797861

100.0%

Lanthipeptides: allorf_797655_797861_lanthipeptide

1

ERPTGAPTTIGRAERTKCTPITNRANRPTPTKPSKLVRPCGRLDLGFLGLQ

51

ERPTGAPTTIGRAERTKCTPITNRANRPTPTKPSKLVRPCGRLDLGFLGLQ

1

ERPTGAPTTIGRAERTKCTPITNRANRPTPTKPSKLVRPCGRLDLGFLGLQ

51

21.6%

NZ_JAHUVW010000001.1and 2 others:

NZ_JAHUVW010000001.1 Lanthipeptides: allorf_1084623_1084760_lanthipeptideNZ_JAHUVW010000001.1 Lanthipeptides: allorf_1084623_1084760_lanthipeptide

Lanthipeptides: allorf_1084623_1084760_lanthipeptide

31

TKPSKLVRPCGRLD-----LGFLGL

50

T+ + VRP GR GFLGL

3

TRSAGAVRPAGRSSAETGAWGFLGL

27

11.7%

Lanthipeptides: allorf_797510_797749_lanthipeptide

40

CGRLDLG

46

CGRLDLG

4

CGRLDLG

10

allorf_811997_812170

Leader:

MPGPEDVPGA

Core:

PENPYKSLPDMGEPIWGLVGSTPARRACTCSSSLDIRQQGQREPRAR

Core with dehydrations:

PENPYKDhaLPDMGEPIWGLVGDhaDhbPARRACysDhbCysDhaDhaDhaLDIRQQGQREPRAR

antiSMASH-DB 4.0 matches for allorf_811997_812170

100.0%

BGC0000535.4 (ADJ56352.1):

Lanthipeptides: allorf_811997_812170_lanthipeptide

1

PENPYKSLPDMGEPIWGLVGSTPARRACTCSSSLDIRQQGQREPRAR

47

PENPYKSLPDMGEPIWGLVGSTPARRACTCSSSLDIRQQGQREPRAR

1

PENPYKSLPDMGEPIWGLVGSTPARRACTCSSSLDIRQQGQREPRAR

47

22.0%

NC_015953.1:

Lanthipeptides: allorf_2485079_2485273_lanthipeptide

10

DMGEPIWGLV------GSTPARRACTCS

31

+G P G + G PARR CT S

12

KLGGPACGTLRRRYGAGIAPARRGCTAS

39

22.0%

NZ_WWGT01000021.1and 1 other:

NZ_WWGT01000021.1 Lanthipeptides: allorf_033513_033707_lanthipeptide

Lanthipeptides: allorf_033513_033707_lanthipeptide

10

DMGEPIWGLV------GSTPARRACTCS

31

+G P G + G PARR CT S

12

KLGAPACGTLRRRYGAGIAPARRGCTAS

39

with 4 more sequence matches

19.7%

NZ_MCIF01000002.1:

Lanthipeptides: allorf_2113382_2113621_lanthipeptide

19

VGSTP--ARRACTCSSSLDIRQQGQREPRA

46

+GS P R AC CS +R++ R+ RA

9

LGSLPCHVRPACGCSEVCLLRRRIARQVRA

38

18.3%

NZ_BKZV01000001.1:

Lanthipeptides: allorf_0688400_0688639_lanthipeptide

19

VGSTPAR--RACTCSSSLDIRQQGQREPRA

46

+GS P AC C +RQ+ R+ RA

8

LGSLPCHVGLACDCGEVWLLRQRIARQVRA

37

14.9%

NZ_CP093340.1:

Lanthipeptides: MNO14_RS13850_lanthipeptide

20

GSTPARRACTCSSS

33

GST + CTCS++

2

GSTSSYAGCTCSTA

15

14.9%

NZ_NUBO01000052.1and 1 other:

NZ_NVJC01000007.1 Lanthipeptides: allorf_20591_20770_lanthipeptide

Lanthipeptides: allorf_20310_20489_lanthipeptide

13

EPIWGLVGSTPARR

26

EPIW +VG +R

4

EPIWSVVGVVMEQR

17

MIBiG 4.0 matches for allorf_811997_812170

17.0%

Lanthipeptide: nisin A

7

SLPDMGEPIWGLVGSTPARRACTCS

31

SL G L+G C CS

5

SLCTPGCKTGALMGCNMKTATCHCS

29

15.7%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

20

GSTPARRACTCSSSL

34

S PA AC SSL

32

SSRPAAPACHTLSSL

46

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.69 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.25 out of 23.79

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

Additional weak hits (9):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.15 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.87 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.27 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.25 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.33 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.56 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.12 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.86 out of 27.18

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_796702_796920 - Class II

Cleavage pHMM score: -4.30

RODEO score: 0

Monoisotopic mass: 610.2 Da

Molecular weight: 610.8 Da

Number of bridges: 0

Additional modifications: AviCys

allorf_797510_797749 - Class II

Cleavage pHMM score: -3.90

RODEO score: 0

Monoisotopic mass: 6076.3 Da

Molecular weight: 6080.0 Da

Number of bridges: 1

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 6098.0 Da N = 1; 6116.0 Da N = 2; 6134.0 Da N = 3; 6152.0 Da N = 4; 6170.1 Da N = 5; 6188.1 Da N = 6

allorf_797655_797861 - Class II

Cleavage pHMM score: -3.40

RODEO score: 0

Monoisotopic mass: 5333.0 Da

Molecular weight: 5336.2 Da

Number of bridges: 1

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 5354.2 Da N = 1; 5372.2 Da N = 2; 5390.3 Da N = 3; 5408.3 Da N = 4; 5426.3 Da N = 5; 5444.3 Da N = 6; 5462.3 Da N = 7

allorf_811997_812170 - Class II

Cleavage pHMM score: -1.70

RODEO score: 0

Monoisotopic mass: 5037.6 Da

Molecular weight: 5040.7 Da

Number of bridges: 1

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 5058.7 Da N = 1; 5076.7 Da N = 2; 5094.7 Da N = 3; 5112.8 Da N = 4; 5130.8 Da N = 5

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_PVTF01000002.1 - Region 4 - RiPP-like

Download region SVG

Location: 825,226 - 837,463 nt. (total: 12,238 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

CLV43_RS09720: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002518.3	0.42	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002115.3	0.41	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002584.2	0.40	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000565.5	0.40	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001137.5	0.39	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002311.3	0.38	ribosomal	cutimycin	Cutibacterium acnes KPA171202

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002518.3	0.42	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002115.3	0.41	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002584.2	0.40	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000565.5	0.40	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001137.5	0.39	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0002311.3	0.38	ribosomal	cutimycin	Cutibacterium acnes KPA171202

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 24.25 out of 26.33

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.54 out of 23.79

Confidence: strong

Additional weak hits (9):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.96 out of 29.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.90 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.11 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.78 out of 39.62

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 0 - 101; Score: 77.0; RRE type: Cyanobactin_D_RRE; Location: 3 - 79; Score: 60.2; RRE type: NHLP_CD_RRE; Location: 1 - 97; Score: 57.1

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
IolR	Regulator of the inositol catabolism

NZ_PVTF01000002.1 - Region 5 - NRPS,PKS-like

Download region SVG

Location: 837,868 - 898,390 nt. (total: 60,523 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase phosphate reductase

CLV43_RS09795: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

CLV43_RS09825: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

CLV43_RS09905: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CLV43_RS09940: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acyltransferase aminotransferase kinase methyltransferase transketolase

CLV43_RS09790: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

CLV43_RS09815: transketolase

smcogs: SMCOG1204: transketolase

CLV43_RS09820: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

CLV43_RS09855: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

CLV43_RS09900: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: deacetylase esterase

CLV43_RS09785: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

CLV43_RS09860: thioesterase

smcogs: SMCOG1004: thioesterase

Isomerases: isomerase

CLV43_RS09930: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

CLV43_RS09810: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

CLV43_RS09835: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS09845: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS09865: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS09870: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS09875: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CLV43_RS09880: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.95	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.88	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.85	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.84	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.83	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.82	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.81	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.81	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.81	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.80	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.73	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.11 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

Additional weak hits (5):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.67 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.93 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.60 out of 30.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 837867 - 898390:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - Ala - Ala) + (NH2) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 837867 - 897325:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - Ala - Ala) + (NH2) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 857379 - 898390:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - Ala - Ala) + (NH2) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS09835: X

AMP-binding (351..742): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SARMFDGAAGGWHSSVGGELNDYGPTECSVWATA
Nearest Stachelhaus code(s):: mTyr or ohdmTyr DGSHSGDVWK (82% 8Å match); dohmTyr DGGHAGDVWK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

CLV43_RS09845: X

AMP-binding (485..882): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SARAFDAAGGGWDGVVAGEFNEYGPTEASVWASV
Nearest Stachelhaus code(s):: 4,5-dhArg DAGDIAEVWK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

CLV43_RS09865: NH2

CAL_domain (143..453): NH2

minowa: NH2

Prediction, score:

NH2: 94.4
Acetyl-CoA: 43.9
fatty_acid: 31.4
AHBA: 13.7
shikimic_acid: 0.0

CLV43_RS09870: Ala - Ala - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (436..806): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: MWATFDLSVYEANTNLAGEHNLYGPSEDTTYSTH
Nearest Stachelhaus code(s):: Ala DLYNNALTYK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1421..1791): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: MWATFDLSVYEANTNLAGEHNLYGPSEDTTYSTH
Nearest Stachelhaus code(s):: Ala DLYNNALTYK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2413..2783): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: MWATFDLSVYEANTNLAGEHNLYGPSEDTTYSTH
Nearest Stachelhaus code(s):: Ala DLYNNALTYK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator

NZ_PVTF01000003.1 - Region 1 - NAPAA

Download region SVG

Location: 732,543 - 766,385 nt. (total: 33,843 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase hydrolase protease

CLV43_RS13800: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

CLV43_RS13835: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

CLV43_RS13895: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

CLV43_RS13845: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.41 out of 27.04

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.47 out of 27.04

Confidence: strong

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.81 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.99 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.62 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 732542 - 766385:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS13845: X

AMP-binding (29..401): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_PVTF01000004.1 - Region 1 - terpene-precursor

Download region SVG

Location: 587,746 - 608,552 nt. (total: 20,807 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CLV43_RS16825: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: carboxylase

CLV43_RS16850: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthetase

CLV43_RS16845: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000779.3	0.39	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0001831.3	0.38	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002284.3	0.35	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000234.5	0.34	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000665.5	0.33	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000255.5	0.33	PKS	pederin	Uncultured bacterium
BGC0002007.2	0.32	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000632.5	0.32	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000218.5	0.32	PKS	doxorubicin	Streptomyces peucetius
BGC0000261.5	0.31	PKS	R1128	Streptomyces sp. R1128

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000779.3	0.39	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0001831.3	0.38	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002284.3	0.35	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000234.5	0.34	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000665.5	0.33	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000255.5	0.33	PKS	pederin	Uncultured bacterium
BGC0002007.2	0.32	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000632.5	0.32	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000218.5	0.32	PKS	doxorubicin	Streptomyces peucetius
BGC0000261.5	0.31	PKS	R1128	Streptomyces sp. R1128

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CLV43_RS16845: PT_FPPS_like

Domain 1 (43 - 225): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_PVTF01000005.1 - Region 1 - T3PKS,terpene

Download region SVG

Location: 23,259 - 66,745 nt. (total: 43,487 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

CLV43_RS17695: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CLV43_RS17715: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

CLV43_RS17725: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

CLV43_RS17740: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

CLV43_RS17745: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

CLV43_RS17765: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

CLV43_RS17790: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase

CLV43_RS17800: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: cyclase hydratase

CLV43_RS17720: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

CLV43_RS17735: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

CLV43_RS17750: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

CLV43_RS17755: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

CLV43_RS17760: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

CLV43_RS17770: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS17785: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.50	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002391.2	0.47	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000282.3	0.43	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0002173.2	0.39	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000675.5	0.39	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002403.2	0.38	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0001969.3	0.37	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002721.2	0.37	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0001277.4	0.37	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.59	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002391.2	0.57	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000282.3	0.54	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001924.3	0.53	terpene	ascofuranone	Acremonium egyptiacum
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002173.2	0.52	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000902.4	0.52	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002721.2	0.52	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0000675.5	0.51	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002403.2	0.51	PKS	β-Diketones	Hordeum vulgare subsp. vulgare

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

CLV43_RS17710: T2TS

Domain 1 (194 - 495): Type 2 terpene synthase

Subtype: unknown

CLV43_RS17720: T1TS

Domain 1 (23 - 302): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.73 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.66 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.80 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.97 out of 24.78

Confidence: medium

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.82 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.82 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.78 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.31 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.17 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.88 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.21 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

CLV43_RS17770: X

AMP-binding (1..345): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DRIHFN---TGAVGVSSGAVNAYGSSETGTVSIG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response

NZ_PVTF01000005.1 - Region 2 - lassopeptide

Download region SVG

Location: 248,380 - 270,903 nt. (total: 22,524 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

CLV43_RS18725: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

CLV43_RS18745: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: dehalogenase hydrolase

CLV43_RS18690: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

CLV43_RS18715: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001779.5	0.71	ribosomal	siamycin	Streptomyces nodosus
BGC0001493.5	0.62	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0000579.4	0.62	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.60	ribosomal	ulleungdin	Streptomyces sp.
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002074.2	0.59	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001550.3	0.58	ribosomal	citrulassin D	Streptomyces katrae
BGC0001781.4	0.58	ribosomal	sphaericin	Planomonospora sphaerica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001779.5	0.71	ribosomal	siamycin	Streptomyces nodosus
BGC0001493.5	0.62	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0000579.4	0.62	ribosomal	SSV-2083	Streptomyces sviceus ATCC 29083
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.60	ribosomal	ulleungdin	Streptomyces sp.
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002074.2	0.59	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001550.3	0.58	ribosomal	citrulassin D	Streptomyces katrae
BGC0001781.4	0.58	ribosomal	sphaericin	Planomonospora sphaerica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.82 out of 23.79

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.93 out of 20.97

Confidence: medium

Additional weak hits (6):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.62 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.45 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.55 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.07 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.96 out of 29.38

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 5 - 84; Score: 75.7; RRE type: Lasso_Fused_RRE; Location: 2 - 57; Score: 36.1

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism

NZ_PVTF01000005.1 - Region 3 - azole-containing-RiPP

Download region SVG

Location: 298,677 - 320,878 nt. (total: 22,202 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CLV43_RS18910: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CLV43_RS18935: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: protease

CLV43_RS18965: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

CLV43_RS18960: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000483.5	0.42	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002115.3	0.42	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000477.3	0.41	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0000565.5	0.41	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002584.2	0.40	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002551.2	0.40	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0001264.3	0.40	PKS	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0002485.2	0.39	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000471.4	0.39	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000597.4	0.39	ribosomal	SWA-2138	Streptomyces sp. e14

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000483.5	0.42	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002115.3	0.42	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000477.3	0.41	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0000565.5	0.41	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002584.2	0.40	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002551.2	0.40	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0001264.3	0.40	PKS	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0002485.2	0.39	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000471.4	0.39	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000597.4	0.39	ribosomal	SWA-2138	Streptomyces sp. e14

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.62 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.15 out of 30.11

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

Additional weak hits (6):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.78 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.25 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.43 out of 20.01

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 4 - 102; Score: 77.0; RRE type: Cyanobactin_D_RRE; Location: 3 - 80; Score: 59.8; RRE type: NHLP_CD_RRE; Location: 5 - 99; Score: 59.0

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_PVTF01000005.1 - Region 4 - NRPS,T1PKS

Download region SVG

Location: 359,929 - 519,908 nt. (total: 159,980 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CLV43_RS19185: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS19225: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

CLV43_RS19230: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

CLV43_RS19240: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CLV43_RS19300: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

CLV43_RS19305: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

CLV43_RS19405: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

CLV43_RS19415: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS19470: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS19480: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS19490: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS19510: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS19525: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS19530: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

CLV43_RS19545: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS19660: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS19675: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase acyltransferase aminotransferase glycosyltransferase methyltransferase

CLV43_RS19260: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

CLV43_RS19285: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

CLV43_RS19360: methyltransferase

smcogs: SMCOG1089: methyltransferase

CLV43_RS19425: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

CLV43_RS19535: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

CLV43_RS19560: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CLV43_RS19580: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: dehalogenase esterase hydrolase phosphatase

CLV43_RS19235: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

CLV43_RS19400: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

CLV43_RS19445: thioesterase

smcogs: SMCOG1004: thioesterase

CLV43_RS19610: thioesterase

smcogs: SMCOG1004: thioesterase

CLV43_RS19665: thioesterase

smcogs: SMCOG1004: thioesterase

CLV43_RS19695: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: dehydratase hydratase lyase

CLV43_RS19205: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

CLV43_RS19275: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

CLV43_RS19390: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CLV43_RS19720: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

CLV43_RS19250: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CLV43_RS19255: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS19290: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS19420: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS19430: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CLV43_RS19440: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS19505: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS19550: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS19600: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS19605: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS19615: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS19635: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS19650: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.54	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	1.54	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.52	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	1.51	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	1.49	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	1.48	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	1.46	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	1.44	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	1.43	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.42	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001023.5	0.73	NRPS, PKS	myxochromide S1	Stigmatella aurantiaca

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.28 out of 25.88

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.03 out of 27.04

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.95 out of 29.65

Confidence: medium

Additional weak hits (38):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.76 out of 20.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.97 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.74 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.90 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.75 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.16 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.43 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.16 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.99 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.04 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.63 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.03 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.07 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.05 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.78 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.84 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.01 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.84 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.74 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.00 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.32 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.52 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.39 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.91 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.10 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.91 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.12 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.83 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.03 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.67 out of 27.04

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.46 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.20 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.52 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 359928 - 519908:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (Orn - D-X - Phe) + (NMe-X - Tyr) + (X) + (mal) + (Ser) + (Ser - Hpg) + (Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 359928 - 415908:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn - D-X - Phe) + (D-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 409746 - 470774:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-X - Tyr) + (X) + (mal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 464781 - 519908:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Hpg) + (Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS19255: X

AMP-binding (1227..1606): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LRYYFDGAIMESAMGAGGDLNLYGPTECTVLTVY
Nearest Stachelhaus code(s):: Orn DSDDGGLVDK (53% 8Å match); R-bmeTrp DAGALGVVLK (50% 8Å match); OH-Orn DAQEGGLVDK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

CLV43_RS19260: Orn - X - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (9..406): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: VAWTTDLFFADREMSVGAEVNAFGTTETTADSCV
Nearest Stachelhaus code(s):: ohEnd DLSVMGAVDK (62% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1044..1435): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CHMSFDFGLMQAALIVGGEANLYGPAETTMHATG
Nearest Stachelhaus code(s):: Orn DVWNIGLIHK (47% 8Å match); Thr DFWNIGMVHK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (2543..2927): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSVLFDASVLETILVSGGEFNGYGPTEATVCATM
Nearest Stachelhaus code(s):: S-bohPhe or Phe DALIVAAVCK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

CLV43_RS19290: X

AMP-binding (26..388): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AATLFLQQRYWSMGWTGSAYEGYGLNETCIVSKN
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CLV43_RS19420: X - Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (7..405): X

nrpys: Leu, Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDAAFDAALFEGFLLVGGELNGYGPTEATTFAAV
Nearest Stachelhaus code(s):: Leu or Ile DAFFLGMTFK (74% 8Å match); Ile DAFFLGVTFK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1401..1783): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRTFDGSIPELYLTLATEVNAYGPTEASVAASA
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

CLV43_RS19425: X

A-OX (477..1208): X

No predictions made

CLV43_RS19430: mal

PKS_AT (521..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 130.4
inactive: 67.0
Methoxymalonyl-CoA: 63.0
Methylmalonyl-CoA: 60.3
Propionyl-CoA: 49.9
Ethylmalonyl-CoA: 33.8
2-Methylbutyryl-CoA: 27.2
CHC-CoA: 21.7
Isobutyryl-CoA: 20.3
fatty_acid: 16.0
trans-1,2-CPDA: 15.3
Benzoyl-CoA: 7.5
Acetyl-CoA: 4.8
3-Methylbutyryl-CoA: 0.0

CLV43_RS19440: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (541..924): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMAFDFSVWEGHFFSGGEHNLYGPTETSVDVTH
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

CLV43_RS19505: X

AMP-binding (32..447): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TCMLLNAGFGTQLAQTGGSVDLYGMLETGVTSCT
Nearest Stachelhaus code(s):: dh-Trp DAALMGAVTK (35% 8Å match); Trp DAGLVGEVWK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

CLV43_RS19550: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (51..456): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LTFAHGGPLRFVQWVHSSAEEYYASQEAAGITMI
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CLV43_RS19600: Ser - Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (458..848): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEASVDVTL
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1492..1883): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSAFDIANYEVHLLTGGDRHLYGPTEATLCATS
Nearest Stachelhaus code(s):: Hpg DIYHLGLLCK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

CLV43_RS19615: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (467..869): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LFHAFDTSWEAWDVLLGGEYNLYGPTECTLDALW
Nearest Stachelhaus code(s):: Orn DTEDMGLVDK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

CLV43_RS19635: X

AMP-binding (19..425): X

nrpys: Leu, Ser

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWLSFDLSQRATHCLFGGELHQYGVAECTDVATS
Nearest Stachelhaus code(s):: Leu or Ser DLRHLGQDVK (97% 8Å match); Leu or Ala DLRHLGQDVK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

CLV43_RS19650: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (16..404): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHSFDMVYEDAFQSVAGEVNQYGPSETHVVTQY
Nearest Stachelhaus code(s):: Pro DMQFVAQVVK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
DasR	N-acetylglucosamine dependent repressor
LexA variant 1	Repressor of DNA damage response
PsrA	Oleic acid responsive regulator

NZ_PVTF01000005.1 - Region 5 - NRPS-like

Download region SVG

Location: 593,821 - 636,814 nt. (total: 42,994 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CLV43_RS20160: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase

CLV43_RS20135: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 27.04

Confidence: strong

Additional weak hits (10):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.44 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.74 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.43 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.46 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 593820 - 636814:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS20135: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (409..801): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YYATFDLPITAPKLVVGGEVNEYGPTEFTVGCVV
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_PVTF01000006.1 - Region 1 - indole

Download region SVG

Location: 47,583 - 68,680 nt. (total: 21,098 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CLV43_RS20640: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

CLV43_RS20660: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001294.5	0.49	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002643.2	0.46	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.38	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001840.2	0.33	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0000391.5	0.32	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0000876.5	0.31	other (other)	neopolyoxin C	Streptomyces tendae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001294.5	0.49	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002643.2	0.46	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.38	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.37	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001840.2	0.33	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0000391.5	0.32	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0000876.5	0.31	other (other)	neopolyoxin C	Streptomyces tendae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

Additional weak hits (8):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.94 out of 19.26

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.37 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.10 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.58 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.61 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.96 out of 21.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.90 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_PVTF01000006.1 - Region 2 - NRPS

Download region SVG

Location: 118,304 - 165,257 nt. (total: 46,954 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CLV43_RS20970: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS20995: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS21020: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS21025: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase glycosyltransferase

CLV43_RS20985: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CLV43_RS20990: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: hydrolase

CLV43_RS21075: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

CLV43_RS21005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS21015: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS21030: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS21070: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001873.3	0.72	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001873.3	0.72	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 29.05 out of 30.22

Confidence: strong

Additional weak hits (15):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.75 out of 26.06

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.39 out of 29.51

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.21 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.94 out of 33.14

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.18 out of 30.11

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.26 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.35 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.01 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.54 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.81 out of 25.88

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 118303 - 165257:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Pro)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS21005: Ser - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (452..837): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEVNLYGPTEATVDVSF
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1469..1864): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: VGQAFDVSFQESFLVSSGEENQYGPTETHVATTF
Nearest Stachelhaus code(s):: Pro DVQFVSQVMK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

CLV43_RS21030: X

AMP-binding (76..340): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: WVMVYGLFTGGGMVIFGAEVDIYGLSE----VMG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator

NZ_PVTF01000006.1 - Region 3 - arylpolyene

Download region SVG

Location: 197,660 - 238,820 nt. (total: 41,161 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CLV43_RS21305: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS21310: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS21365: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

CLV43_RS21370: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Hydrolases: hydrolase

CLV43_RS21230: isochorismatase

smcogs: SMCOG1027: isochorismatase

CLV43_RS21340: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase decarboxylase

CLV43_RS21285: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

CLV43_RS21315: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: synthase

CLV43_RS21290: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS21320: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CLV43_RS21325: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS21335: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001310.5	0.51	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002554.2	0.47	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002711.2	0.47	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001150.5	0.46	PKS	pamamycin-607, pamamycin-621A, pamamycin-635G, pamamycin-663A, homopamamycin-677A, pamamycin-649B	Streptomyces alboniger
BGC0002000.4	0.46	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000844.5	0.46	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002381.3	0.45	PKS, other (other)	tambjamine BE-18591	Streptomyces albus subsp. albus
BGC0001903.3	0.45	other (other)	neocarazostatin A	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001310.5	0.51	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002554.2	0.47	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002711.2	0.47	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001150.5	0.46	PKS	pamamycin-607, pamamycin-621A, pamamycin-635G, pamamycin-663A, homopamamycin-677A, pamamycin-649B	Streptomyces alboniger
BGC0002000.4	0.46	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000844.5	0.46	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002381.3	0.45	PKS, other (other)	tambjamine BE-18591	Streptomyces albus subsp. albus
BGC0001903.3	0.45	other (other)	neocarazostatin A	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.63 out of 28.19

Confidence: medium

Additional weak hits (16):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 39.62

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.47 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.44 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.13 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.24 out of 26.12

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.44 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.84 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.72 out of 31.73

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.60 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.57 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.59 out of 23.43

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_PVTF01000006.1 - Region 4 - terpene

Download region SVG

Location: 447,531 - 468,490 nt. (total: 20,960 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CLV43_RS22295: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase

CLV43_RS22325: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Lyases: cyclase dehydratase

CLV43_RS22320: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CLV43_RS22340: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

CLV43_RS22365: cobaltochelatase subunit CobN

smcogs: SMCOG1263: cobaltochelatase subunit CobN

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002707.2	0.48	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.40	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0001364.3	0.38	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002690.2	0.38	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0002246.3	0.36	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0000633.3	0.35	terpene	carotenoid	Streptomyces avermitilis
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis
BGC0002496.3	0.33	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0002294.3	0.32	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002707.2	0.48	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.40	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0001364.3	0.38	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002690.2	0.38	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0002246.3	0.36	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0000633.3	0.35	terpene	carotenoid	Streptomyces avermitilis
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis
BGC0002496.3	0.33	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0002294.3	0.32	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

CLV43_RS22340: T1TS

Domain 1 (22 - 311): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.84 out of 20.97

Confidence: medium

Additional weak hits (4):

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.91 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.90 out of 20.01

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.85 out of 18.57

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.22 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_PVTF01000006.1 - Region 5 - T1PKS,hglE-KS

Download region SVG

Location: 605,345 - 646,484 nt. (total: 41,140 nt) Show pHMM detection rules used

Region on contig edge.

hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CLV43_RS23035: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CLV43_RS23050: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CLV43_RS50095: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: carboxylase glycosyltransferase transferase

CLV43_RS23040: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

CLV43_RS23045: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

CLV43_RS23095: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase protease

CLV43_RS23000: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

CLV43_RS23015: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

CLV43_RS23020: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

CLV43_RS23025: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

CLV43_RS23090: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: synthase

CLV43_RS23075: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS23080: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.54	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000107.3	0.51	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002192.3	0.50	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.49	PKS	ACT-Toxin II	Alternaria alternata
BGC0002284.3	0.45	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000107.3	0.59	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0002284.3	0.56	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.87 out of 30.25

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.24 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.98 out of 24.78

Confidence: medium

Additional weak hits (12):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.62 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.43 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.43 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.08 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.41 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.85 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.98 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.18 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.47 out of 27.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 605344 - 646484:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (pk)
Non-colinear ordering:: CLV43_RS23075 + CLV43_RS23080 + CLV43_RS23085

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 612165 - 646484:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (pk)
Non-colinear ordering:: CLV43_RS23075 + CLV43_RS23080 + CLV43_RS23085

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS23075: mal

PKS_AT (1201..1482): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 67.7
Methoxymalonyl-CoA: 29.2
Methylmalonyl-CoA: 27.4
inactive: 20.0
Propionyl-CoA: 12.8
trans-1,2-CPDA: 11.0
CHC-CoA: 8.4
Ethylmalonyl-CoA: 7.4
2-Methylbutyryl-CoA: 2.9
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

CLV43_RS23080: pk

PKS_AT (611..817): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 12.2
Propionyl-CoA: 6.2
Malonyl-CoA: 4.8
Methylmalonyl-CoA: 3.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_PVTF01000007.1 - Region 1 - NRPS,T1PKS,phosphonate

Download region SVG

Location: 201,337 - 362,128 nt. (total: 160,792 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
phosphonate: (phosphonates and minimum(1, [2-Hacid_dh_C, Aldedh, Aminotran_1_2, Aminotran_5, AurF, CTP_transf_like, DUF4992, Fe-ADH, HMGL-like, Metallophos_2, NTP_transf_3, NTP_transf_5, PALP, PEP_mutase, TPP_enzyme_C, TPP_enzyme_N, phosphonates]) and not (phosphonatesHydrolase or phosphonatesMeIsocitrateLyase))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase phosphate reductase

CLV43_RS24135: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS24170: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS24215: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS24305: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS24330: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS24375: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS24415: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

CLV43_RS24420: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

CLV43_RS24425: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

Transferases: acetyltransferase acylase aminotransferase glycosyltransferase

CLV43_RS24175: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

CLV43_RS24180: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

CLV43_RS24185: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CLV43_RS24190: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

CLV43_RS24405: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: esterase hydrolase phosphatase

CLV43_RS24200: thioesterase

smcogs: SMCOG1004: thioesterase

CLV43_RS24240: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

CLV43_RS24315: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

CLV43_RS24350: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

CLV43_RS24105: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

CLV43_RS24205: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

CLV43_RS24150: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS24155: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CLV43_RS24160: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS24345: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS24355: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS24380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS24385: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.60	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002333.3	0.68	PKS	lucensomycin	Streptomyces cyanogenus
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.80 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.03 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (21):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.81 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.62 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.07 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.07 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.73 out of 31.73

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.89 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.89 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.26 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.58 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.73 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.86 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.16 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.03 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 201336 - 362128:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - Me-ohmal - ohmal - ohmal - ohmal) + (ccmal) + (ccmal) + (Me-ccmal - Me-ccmal) + (Me-ccmal - ccmal - Me-ccmal - ccmal) + (Val) + (Cys) + (D-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 201336 - 316515:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal - Me-ccmal) + (Me-ccmal - ccmal - Me-ccmal - ccmal) + (ccmal - ohmal - Me-ohmal - ohmal - ohmal - ohmal) + (ccmal) + (ccmal)
Non-colinear ordering:: CLV43_RS24185 + CLV43_RS24190 + CLV43_RS24150 + CLV43_RS24155 + CLV43_RS24160

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 305771 - 362128:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X) + (Cys) + (Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS24150: mal - mal - mmal - mal - mal - mal

PKS_AT (552..845): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.9
inactive: 86.9
Methoxymalonyl-CoA: 65.9
Methylmalonyl-CoA: 54.8
Isobutyryl-CoA: 32.6
Propionyl-CoA: 30.9
Acetyl-CoA: 25.9
2-Methylbutyryl-CoA: 17.7
Ethylmalonyl-CoA: 16.3
Benzoyl-CoA: 13.3
CHC-CoA: 12.6
trans-1,2-CPDA: 11.4
fatty_acid: 5.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (2289..2583): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 226.3
inactive: 117.5
Methoxymalonyl-CoA: 62.5
Methylmalonyl-CoA: 54.4
Propionyl-CoA: 34.8
Acetyl-CoA: 24.1
Benzoyl-CoA: 22.1
Ethylmalonyl-CoA: 19.7
Isobutyryl-CoA: 18.8
trans-1,2-CPDA: 16.6
2-Methylbutyryl-CoA: 13.3
CHC-CoA: 10.6
fatty_acid: 9.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (3811..4108): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 208.1
Ethylmalonyl-CoA: 203.1
Methoxymalonyl-CoA: 161.2
2-Methylbutyryl-CoA: 142.5
trans-1,2-CPDA: 130.1
Propionyl-CoA: 108.5
CHC-CoA: 98.0
Malonyl-CoA: 85.8
Isobutyryl-CoA: 65.0
Benzoyl-CoA: 59.5
Acetyl-CoA: 35.8
3-Methylbutyryl-CoA: 30.3
fatty_acid: 27.7
inactive: 16.0

PKS_AT (5339..5638): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.0
inactive: 117.5
Methoxymalonyl-CoA: 70.9
Methylmalonyl-CoA: 66.3
Propionyl-CoA: 38.0
Isobutyryl-CoA: 36.0
Ethylmalonyl-CoA: 34.6
Benzoyl-CoA: 24.8
Acetyl-CoA: 20.5
trans-1,2-CPDA: 17.8
2-Methylbutyryl-CoA: 15.0
CHC-CoA: 13.1
fatty_acid: 9.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (6855..7142): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.0
inactive: 105.3
Methoxymalonyl-CoA: 65.8
Methylmalonyl-CoA: 51.5
Propionyl-CoA: 29.1
Acetyl-CoA: 24.3
Ethylmalonyl-CoA: 19.6
Isobutyryl-CoA: 19.2
fatty_acid: 16.7
Benzoyl-CoA: 13.4
2-Methylbutyryl-CoA: 5.3
trans-1,2-CPDA: 4.0
CHC-CoA: 4.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8345..8642): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.7
inactive: 111.9
Methoxymalonyl-CoA: 66.6
Methylmalonyl-CoA: 60.2
Propionyl-CoA: 36.2
Isobutyryl-CoA: 33.1
Acetyl-CoA: 20.5
2-Methylbutyryl-CoA: 20.3
Benzoyl-CoA: 18.6
CHC-CoA: 15.0
3-Methylbutyryl-CoA: 13.8
Ethylmalonyl-CoA: 10.4
fatty_acid: 10.1
trans-1,2-CPDA: 2.8

CLV43_RS24155: mal

PKS_AT (540..829): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.8
inactive: 98.1
Methoxymalonyl-CoA: 58.9
Methylmalonyl-CoA: 47.4
Acetyl-CoA: 22.8
Propionyl-CoA: 21.4
Ethylmalonyl-CoA: 10.3
Benzoyl-CoA: 7.7
trans-1,2-CPDA: 6.7
Isobutyryl-CoA: 6.1
2-Methylbutyryl-CoA: 5.5
CHC-CoA: 5.3
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

CLV43_RS24160: mal

PKS_AT (539..818): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.1
inactive: 92.9
Methoxymalonyl-CoA: 62.6
Methylmalonyl-CoA: 50.7
Isobutyryl-CoA: 21.5
Acetyl-CoA: 18.5
Propionyl-CoA: 17.9
Ethylmalonyl-CoA: 15.5
Benzoyl-CoA: 10.6
2-Methylbutyryl-CoA: 7.5
CHC-CoA: 6.6
fatty_acid: 6.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

CLV43_RS24185: mmal - mmal

PKS_AT (554..852): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 199.1
Ethylmalonyl-CoA: 181.8
Methoxymalonyl-CoA: 167.9
2-Methylbutyryl-CoA: 131.6
trans-1,2-CPDA: 114.8
Propionyl-CoA: 109.5
Malonyl-CoA: 101.8
CHC-CoA: 91.3
Isobutyryl-CoA: 88.2
Benzoyl-CoA: 76.7
Acetyl-CoA: 64.0
3-Methylbutyryl-CoA: 62.2
fatty_acid: 45.0
inactive: 35.6

PKS_AT (2220..2518): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.2
Ethylmalonyl-CoA: 210.3
Methoxymalonyl-CoA: 176.8
2-Methylbutyryl-CoA: 143.8
Propionyl-CoA: 118.5
trans-1,2-CPDA: 116.1
Malonyl-CoA: 102.7
Isobutyryl-CoA: 101.5
CHC-CoA: 99.9
Benzoyl-CoA: 68.4
3-Methylbutyryl-CoA: 62.8
Acetyl-CoA: 58.4
fatty_acid: 51.7
inactive: 37.0

CLV43_RS24190: mmal - mal - mmal - mal

PKS_AT (563..861): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.7
Ethylmalonyl-CoA: 206.7
Methoxymalonyl-CoA: 173.3
2-Methylbutyryl-CoA: 136.9
trans-1,2-CPDA: 117.7
Propionyl-CoA: 115.8
Malonyl-CoA: 99.5
Isobutyryl-CoA: 99.2
CHC-CoA: 99.0
Benzoyl-CoA: 70.4
3-Methylbutyryl-CoA: 57.1
Acetyl-CoA: 56.6
fatty_acid: 42.2
inactive: 33.6

PKS_AT (2261..2548): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.1
inactive: 104.1
Methoxymalonyl-CoA: 63.9
Methylmalonyl-CoA: 54.9
Isobutyryl-CoA: 27.5
Acetyl-CoA: 22.1
Propionyl-CoA: 21.3
Ethylmalonyl-CoA: 12.5
Benzoyl-CoA: 11.6
2-Methylbutyryl-CoA: 4.2
CHC-CoA: 2.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3977..4275): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 208.2
Ethylmalonyl-CoA: 202.7
Methoxymalonyl-CoA: 170.9
2-Methylbutyryl-CoA: 135.1
trans-1,2-CPDA: 111.9
Propionyl-CoA: 105.6
CHC-CoA: 101.1
Isobutyryl-CoA: 95.5
Malonyl-CoA: 91.6
Benzoyl-CoA: 62.5
Acetyl-CoA: 53.0
3-Methylbutyryl-CoA: 52.5
fatty_acid: 40.1
inactive: 26.8

PKS_AT (5683..5966): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.6
inactive: 106.8
Methoxymalonyl-CoA: 62.9
Methylmalonyl-CoA: 54.7
Isobutyryl-CoA: 22.3
Acetyl-CoA: 22.2
Propionyl-CoA: 20.7
Ethylmalonyl-CoA: 15.6
Benzoyl-CoA: 14.0
CHC-CoA: 11.0
2-Methylbutyryl-CoA: 8.5
fatty_acid: 5.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

CLV43_RS24345: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (8..404): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQVFGGEVNMYGITETTVHVTA
Nearest Stachelhaus code(s):: Val DFWNVGMVHK (97% 8Å match); Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

CLV43_RS24355: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (169..586): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDLSVYSGNSLLSGDVALGGPTETTVWSNY
Nearest Stachelhaus code(s):: Cys DLYNLSLVWK (65% 8Å match)
Stachelhaus code match:: 100% (strong)

CLV43_RS24380: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (7..405): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGSMVFGGESNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

CLV43_RS24385: X

AMP-binding (15..396): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: IHAAFDFAALELMGVAGGEWNIYGPTETTIFSTC
Nearest Stachelhaus code(s):: Val DFLQVGIIFK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism

NZ_PVTF01000007.1 - Region 2 - terpene

Download region SVG

Location: 489,906 - 510,994 nt. (total: 21,089 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CLV43_RS25060: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CLV43_RS25080: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

CLV43_RS25095: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS25100: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase

CLV43_RS25120: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Lyases: cyclase

CLV43_RS25075: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

CLV43_RS25125: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001223.5	0.44	other (other)	hydroxysporine	uncultured bacterium
BGC0001336.5	0.44	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002651.2	0.43	terpene	sordaricin B	Rosellinia necatrix
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002482.2	0.42	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000821.5	0.40	other (other)	rebeccamycin	Lechevalieria aerocolonigenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001223.5	0.44	other (other)	hydroxysporine	uncultured bacterium
BGC0001336.5	0.44	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002651.2	0.43	terpene	sordaricin B	Rosellinia necatrix
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002482.2	0.42	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000821.5	0.40	other (other)	rebeccamycin	Lechevalieria aerocolonigenes

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

CLV43_RS25075: T1TS

Domain 1 (10 - 314): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.20 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.36 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.81 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.66 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.20 out of 28.14

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_PVTF01000007.1 - Region 3 - azoxy-crosslink

Download region SVG

Location: 574,799 - 600,069 nt. (total: 25,271 nt) Show pHMM detection rules used

azoxy-crosslink: (azdH and LPG_synthase_C and azdO and vlmB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CLV43_RS25475: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

CLV43_RS25480: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Transferases: aminotransferase

CLV43_RS25485: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: ligase

CLV43_RS25445: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0002805.2	0.46	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000857.3	0.46	other (other)	ectoine	Methylophaga alcalica
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.45	other (ectoine)	ectoine	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0002805.2	0.46	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000857.3	0.46	other (other)	ectoine	Methylophaga alcalica
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.45	other (ectoine)	ectoine	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.38 out of 20.01

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.60 out of 35.63

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.03 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.54 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_PVTF01000008.1 - Region 1 - terpene

Download region SVG

Location: 36,689 - 62,844 nt. (total: 26,156 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CLV43_RS25815: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

CLV43_RS25835: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

CLV43_RS25855: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

CLV43_RS50120: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase

CLV43_RS25810: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

CLV43_RS25830: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.70	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.65	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.59	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.59	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.58	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.56	terpene	carotenoid	Myxococcus xanthus
BGC0000636.3	0.53	terpene	carotenoid	Brevibacterium linens
BGC0000645.3	0.49	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.70	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.65	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.59	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.59	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.58	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.56	terpene	carotenoid	Myxococcus xanthus
BGC0000636.3	0.53	terpene	carotenoid	Brevibacterium linens
BGC0000645.3	0.49	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

CLV43_RS25800: Lycopene_cycl

Domain 1 (5 - 94): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

CLV43_RS25805: Lycopene_cycl

Domain 1 (5 - 95): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

CLV43_RS25825: PT_phytoene_like

Domain 1 (17 - 305): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

CLV43_RS25830: PT_FPPS_like

Domain 1 (48 - 367): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.55 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.35 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.96 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_PVTF01000008.1 - Region 2 - terpene

Download region SVG

Location: 571,285 - 606,471 nt. (total: 35,187 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CLV43_RS28065: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

CLV43_RS28090: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS28100: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

CLV43_RS28110: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CLV43_RS28120: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

CLV43_RS28125: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Ligases: synthetase

CLV43_RS28060: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

CLV43_RS28075: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000665.5	0.56	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000678.5	0.52	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.48	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0002309.2	0.45	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000666.5	0.45	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000665.5	0.56	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002043.3	0.53	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000678.5	0.52	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.48	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0002309.2	0.45	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000666.5	0.45	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001910.4	0.45	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CLV43_RS28060: PT_FPPS_like

Domain 1 (58 - 322): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

CLV43_RS28075: PT_FPPS_like

Domain 1 (36 - 310): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

CLV43_RS28130: TS_Pyr4

Domain 1 (36 - 195): Pyr4 type terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.53 out of 25.88

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.50 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (8):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.37 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.83 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.86 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.00 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.03 out of 25.88

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
PsrA	Oleic acid responsive regulator

NZ_PVTF01000009.1 - Region 1 - hydrogen-cyanide

Download region SVG

Location: 148,301 - 161,001 nt. (total: 12,701 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

CLV43_RS28840: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

CLV43_RS28850: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Translocases: transporter

CLV43_RS28825: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.34	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001093.3	0.33	NRPS, PKS	disorazol A	Sorangium cellulosum
BGC0001386.5	0.30	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000903.3	0.29	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000495.5	0.26	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000344.5	0.25	NRPS	entolysin	Pseudomonas entomophila L48
BGC0000883.5	0.25	other (other)	arginomycin	Streptomyces arginensis
BGC0000268.5	0.25	PKS	Sch-47554, Sch-47555	Streptomyces sp. SCC 2136
BGC0000804.5	0.25	saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.34	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001093.3	0.33	NRPS, PKS	disorazol A	Sorangium cellulosum
BGC0001386.5	0.30	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000903.3	0.29	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000495.5	0.26	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000344.5	0.25	NRPS	entolysin	Pseudomonas entomophila L48
BGC0000883.5	0.25	other (other)	arginomycin	Streptomyces arginensis
BGC0000268.5	0.25	PKS	Sch-47554, Sch-47555	Streptomyces sp. SCC 2136
BGC0000804.5	0.25	saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.84 out of 28.19

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (1):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.39 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
ZuR variant 1	Zinc-responsive repressor

NZ_PVTF01000009.1 - Region 2 - HR-T2PKS,terpene-precursor

Download region SVG

Location: 292,191 - 337,055 nt. (total: 44,865 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CLV43_RS29545: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

CLV43_RS29660: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Hydrolases: hydrolase

CLV43_RS29570: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase synthetase

CLV43_RS29505: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

CLV43_RS29560: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS29575: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.29	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000888.5	0.29	other (other)	bacilysin	Bacillus sp. CS93
BGC0000677.5	0.27	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000234.5	0.26	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001276.3	0.26	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001987.2	0.26	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0002309.2	0.26	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001605.3	0.25	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001723.5	0.25	PKS	oviedomycin	Streptomyces antibioticus
BGC0001184.4	0.25	other (other)	bacilysin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000866.5	0.54	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.52	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000231.5	0.49	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001987.2	0.49	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0002000.4	0.48	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000234.5	0.48	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.48	PKS	oviedomycin	Streptomyces antibioticus
BGC0002047.2	0.47	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002514.3	0.47	PKS	julichrome Q6.6	Streptomyces sampsonii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CLV43_RS29505: PT_FPPS_like

Domain 1 (60 - 337): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.12 out of 24.78

Confidence: medium

Additional weak hits (10):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.07 out of 30.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.47 out of 26.85

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.76 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.32 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.39 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.18 out of 29.38

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response

NZ_PVTF01000009.1 - Region 3 - terpene

Download region SVG

Location: 433,511 - 455,691 nt. (total: 22,181 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase protease

CLV43_RS30170: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

CLV43_RS30185: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

CLV43_RS30160: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Translocases: transport

CLV43_RS30195: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000523.3	0.41	ribosomal	lactocin S	Lactobacillus sakei
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001779.5	0.40	ribosomal	siamycin	Streptomyces nodosus
BGC0000521.3	0.39	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0002323.2	0.39	ribosomal	nisin J	Staphylococcus capitis
BGC0002663.2	0.39	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0000514.5	0.39	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0000539.5	0.39	ribosomal	nukacin ISK-1	Staphylococcus warneri

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.81	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002700.2	0.41	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000523.3	0.41	ribosomal	lactocin S	Lactobacillus sakei
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001779.5	0.40	ribosomal	siamycin	Streptomyces nodosus
BGC0000521.3	0.39	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis
BGC0002323.2	0.39	ribosomal	nisin J	Staphylococcus capitis
BGC0002663.2	0.39	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0000514.5	0.39	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0000539.5	0.39	ribosomal	nukacin ISK-1	Staphylococcus warneri

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

CLV43_RS30160: T1TS + T1TS

Domain 1 (1 - 329): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (332 - 699): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.30 out of 25.31

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.99 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.24 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.98 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.54 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.59 out of 30.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.44 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_PVTF01000010.1 - Region 1 - NRP-metallophore,NRPS

Download region SVG

Location: 86,985 - 144,421 nt. (total: 57,437 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CLV43_RS31095: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: methyltransferase

CLV43_RS31190: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

CLV43_RS31175: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

CLV43_RS48020: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: lyase

CLV43_RS31045: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

CLV43_RS31105: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002424.3	0.84	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0000349.5	0.80	NRPS	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0002135.2	0.79	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.69	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002424.3	0.73	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0000349.5	0.72	NRPS	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.08 out of 27.04

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.57 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (16):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.59 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.51 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.44 out of 35.63

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.67 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.28 out of 27.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.99 out of 36.53

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.83 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.16 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.26 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 86984 - 144421:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-X - OH-Orn - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS31105: Fo-OH-Orn - X - OH-Orn - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (20..419): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAAFDVAVWDMILVVGTEVAAYGLTEATVNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWIIGAVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1495..1891): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWLYFDPSIQEGDLFSGGEVNVYGPTEAVVQVTS
Nearest Stachelhaus code(s):: Arg DPLDFGVVQK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2956..3358): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4001..4398): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAAFDVAVFEMILLVGTELAAYGLTEATVNSTL
Nearest Stachelhaus code(s):: OH-Orn DVFILGAVNK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor

NZ_PVTF01000010.1 - Region 2 - terpene-precursor

Download region SVG

Location: 168,413 - 189,453 nt. (total: 21,041 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CLV43_RS31350: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CLV43_RS31425: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Ligases: synthetase

CLV43_RS31385: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.53	terpene	stellatic acid	Aspergillus stellatus
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.47	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000285.5	0.44	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000678.5	0.44	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000665.5	0.43	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001336.5	0.43	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.53	terpene	stellatic acid	Aspergillus stellatus
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.47	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000285.5	0.44	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000678.5	0.44	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000665.5	0.43	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001336.5	0.43	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CLV43_RS31385: PT_FPPS_like

Domain 1 (61 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.73 out of 36.53

Confidence: medium

Additional weak hits (6):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.24 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.06 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.51 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.72 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DmdR1	Iron(II)-dependent repressor

NZ_PVTF01000010.1 - Region 3 - NRPS,thioamide-NRP

Download region SVG

Location: 225,585 - 300,342 nt. (total: 74,758 nt) Show pHMM detection rules used

thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CLV43_RS31700: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CLV43_RS31775: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS31795: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

CLV43_RS31800: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS31835: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS31840: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acylase halogenase

CLV43_RS31750: flavin-dependent trp 6 7 halogenase

halogenases: flavin-dependent trp 6 7 halogenase
MITE: MITE0000130Halogenation (identity: 63.40%)
smcogs: SMCOG1119: halogenase

CLV43_RS31830: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: deaminase

CLV43_RS31755: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase

CLV43_RS31680: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

CLV43_RS31615: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

CLV43_RS31670: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CLV43_RS31760: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

CLV43_RS31765: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.82	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.81	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.78	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.78	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.29 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.15 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 23.25 out of 24.78

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.65 out of 27.04

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (19):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.81 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.23 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.44 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.57 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.55 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.62 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.38 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.06 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.77 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.56 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.75 out of 23.43

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.79 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.14 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.09 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.72 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 225584 - 300342:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (D-X - Trp - X - Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS31765: X - Trp - X - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (472..880): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQAEVVVTGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1996..2394): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MSLAFDATVWELALVVAGEFNGYGPTESVIAATV
Nearest Stachelhaus code(s):: Trp DAWAFAGVAK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3062..3468): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HCKAFDISVWQTEVVVTGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4131..4534): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LDMTFDISNLEVQAITGGERNMYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQVGMIWK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

CLV43_RS31830: mal

PKS_AT (8..299): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 54.5
Methoxymalonyl-CoA: 27.2
Methylmalonyl-CoA: 22.0
Ethylmalonyl-CoA: 20.9
trans-1,2-CPDA: 19.6
2-Methylbutyryl-CoA: 16.9
CHC-CoA: 15.9
Propionyl-CoA: 14.7
Acetyl-CoA: 12.7
Isobutyryl-CoA: 9.4
fatty_acid: 9.3
Benzoyl-CoA: 8.7
inactive: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_PVTF01000011.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 37,546 nt. (total: 37,546 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

CLV43_RS32345: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

CLV43_RS32425: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS32430: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

CLV43_RS32465: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS32470: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acylase

CLV43_RS32385: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: glucanase glucosidase

CLV43_RS32325: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

CLV43_RS32335: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

CLV43_RS48695: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000056.3	0.49	PKS	esperamicin	Actinomadura verrucosospora
BGC0001338.4	0.47	PKS	citrinin	Monascus ruber

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000056.3	0.49	PKS	esperamicin	Actinomadura verrucosospora
BGC0001338.4	0.47	PKS	citrinin	Monascus ruber

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.95 out of 26.85

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.50 out of 30.11

Confidence: medium

Additional weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.95 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.53 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.82 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 37546:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS32385: mmal

PKS_AT (543..834): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 79.2%; Propionyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 145.7
Methoxymalonyl-CoA: 125.7
Ethylmalonyl-CoA: 112.6
Isobutyryl-CoA: 95.7
Malonyl-CoA: 91.1
trans-1,2-CPDA: 75.3
Propionyl-CoA: 74.5
Benzoyl-CoA: 73.9
2-Methylbutyryl-CoA: 72.8
Acetyl-CoA: 47.6
CHC-CoA: 40.5
inactive: 40.3
3-Methylbutyryl-CoA: 34.7
fatty_acid: 16.7

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism

NZ_PVTF01000011.1 - Region 2 - terpene

Download region SVG

Location: 77,587 - 107,102 nt. (total: 29,516 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

CLV43_RS32710: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS32735: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS32740: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

CLV43_RS32750: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CLV43_RS32795: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CLV43_RS32800: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase methyltransferase

CLV43_RS32725: aminotransferase

smcogs: SMCOG1019: aminotransferase

CLV43_RS32745: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

CLV43_RS49610: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001529.5	0.51	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001528.4	0.48	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0000666.5	0.48	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0002402.2	0.48	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000665.5	0.47	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002007.2	0.47	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001206.5	0.46	other (other)	indolmycin	Streptomyces griseus subsp. griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001529.5	0.51	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001528.4	0.48	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0000666.5	0.48	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0002402.2	0.48	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000665.5	0.47	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002007.2	0.47	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001206.5	0.46	other (other)	indolmycin	Streptomyces griseus subsp. griseus

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

CLV43_RS32730: T2TS

Domain 1 (225 - 553): Type 2 terpene synthase

Subtype: unknown

CLV43_RS49610: PT_FPPS_like

Domain 1 (397 - 688): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.06 out of 26.85

Confidence: medium

Additional weak hits (12):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 24.05 out of 30.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.65 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.71 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.86 out of 21.55

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.91 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.33 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_PVTF01000011.1 - Region 3 - NRPS,NRPS-like,T1PKS,T3PKS

Download region SVG

Location: 151,284 - 239,137 nt. (total: 87,854 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

CLV43_RS33010: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS33015: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

CLV43_RS33160: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS33245: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS33270: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS33275: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS33295: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS33305: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS33340: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

CLV43_RS33345: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

CLV43_RS33360: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acylase aminotransferase methyltransferase

CLV43_RS33100: methyltransferase

smcogs: SMCOG1089: methyltransferase

CLV43_RS33110: methyltransferase

smcogs: SMCOG1248: methyltransferase

CLV43_RS33150: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

CLV43_RS33170: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase

CLV43_RS33370: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

CLV43_RS33105: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

CLV43_RS33165: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS33180: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS33185: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CLV43_RS33195: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CLV43_RS33210: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS33265: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transporter

CLV43_RS33000: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	2.08	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	2.08	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001261.3	1.97	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	1.90	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	1.89	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	1.84	NRPS	enniatin	Fusarium equiseti
BGC0001240.4	1.84	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001273.3	1.82	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	1.80	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	1.79	PKS	6-methylsalicyclic acid	Aspergillus terreus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.73	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.73	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.67	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.66	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.66	NRPS	enniatin	Fusarium equiseti
BGC0000357.5	0.65	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.04 out of 26.85

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.23 out of 23.43

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.73 out of 23.79

Confidence: medium

Additional weak hits (22):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.64 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.65 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.86 out of 25.88

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.84 out of 27.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.96 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.42 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.75 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.29 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.82 out of 20.01

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.30 out of 30.22

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.83 out of 26.12

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.44 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 151283 - 239137:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ohmal) + (Val) + (NH2 - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 151283 - 192354:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 163908 - 210480:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ohmal) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 176664 - 219760:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ohmal) + (Val) + (NH2 - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 192735 - 239137:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (NH2 - mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS33165: X

AMP-binding (13..396): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAWSWDSAVQDAHSALGGDAGAYGSSECSCALLR
Nearest Stachelhaus code(s):: Phe DAGALGACAK (35% 8Å match); Leu DALHSGAVAK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

CLV43_RS33170: mal

PKS_AT (552..845): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 156.9
inactive: 94.4
Methoxymalonyl-CoA: 79.8
Methylmalonyl-CoA: 62.0
Propionyl-CoA: 54.6
Ethylmalonyl-CoA: 44.8
2-Methylbutyryl-CoA: 35.8
trans-1,2-CPDA: 31.2
CHC-CoA: 29.6
Isobutyryl-CoA: 18.4
Benzoyl-CoA: 17.7
Acetyl-CoA: 10.4
3-Methylbutyryl-CoA: 9.8
fatty_acid: 0.0

CLV43_RS33210: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (14..406): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LPSAWDAMSLEPWLLTGGEWNGYGPVESTVFATT
Nearest Stachelhaus code(s):: Val DALWLGGVFK (62% 8Å match)
Stachelhaus code match:: 100% (strong)

CLV43_RS33265: NH2 - mal

CAL_domain (41..485): NH2

minowa: NH2

Prediction, score:

NH2: 134.7
Acetyl-CoA: 54.1
AHBA: 16.4
fatty_acid: 14.4
shikimic_acid: 0.4

PKS_AT (1276..1568): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 149.9
inactive: 84.1
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 54.7
Propionyl-CoA: 46.6
Isobutyryl-CoA: 26.8
Ethylmalonyl-CoA: 26.3
2-Methylbutyryl-CoA: 22.3
CHC-CoA: 19.2
trans-1,2-CPDA: 18.3
Benzoyl-CoA: 13.4
Acetyl-CoA: 8.6
3-Methylbutyryl-CoA: 8.4
fatty_acid: 0.0

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

NZ_PVTF01000011.1 - Region 4 - NRPS,betalactone

Download region SVG

Location: 309,663 - 375,481 nt. (total: 65,819 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CLV43_RS33950: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: aminotransferase methyltransferase

CLV43_RS33755: methyltransferase

smcogs: SMCOG1089: methyltransferase

CLV43_RS33800: aminotransferase

smcogs: SMCOG1019: aminotransferase

CLV43_RS33920: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

CLV43_RS33960: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: deacetylase dehalogenase hydrolase

CLV43_RS33720: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

CLV43_RS33795: isochorismatase

smcogs: SMCOG1027: isochorismatase

CLV43_RS33825: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: dehydratase

CLV43_RS33940: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

CLV43_RS33745: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS33775: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

CLV43_RS33845: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

CLV43_RS33890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.35	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.34	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.34	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.33	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.33	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.33	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.33	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.33	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.33	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.32	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.14 out of 21.55

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.25 out of 20.01

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.00 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.74 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.58 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.29 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.09 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.95 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.49 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

Additional weak hits (11):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.36 out of 29.51

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.16 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.13 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.22 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.58 out of 24.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.09 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.47 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 309662 - 375481:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys - Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 330567 - 375481:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys - Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS33745: X

AMP-binding (26..443): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HGTVFHANAWGGGALGGGSTHSWGMTEISPVGTI
Nearest Stachelhaus code(s):: Leu DAWFLGNVVK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

CLV43_RS33890: Cys - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (14..406): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TEISFDLSVYDGHTVLTGDVSMGGATETSINSLV
Nearest Stachelhaus code(s):: Pyr DVHHVTEINK (38% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1076..1457): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LAITFDIAALEAQALCGGEWNLYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
ArcA	Repressor of carbon oxidation
ArgR	Regulator of arginine biosynthesis genes
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

NZ_PVTF01000012.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 28,468 nt. (total: 28,468 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

CLV43_RS34045: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

CLV43_RS34000: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002171.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.49	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.29 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.81 out of 20.97

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.71 out of 27.04

Confidence: medium

Additional weak hits (9):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.88 out of 30.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.22 out of 39.62

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.15 out of 23.43

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.33 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.73 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.66 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 28468:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS34000: mal

PKS_AT (1820..2099): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.3
inactive: 83.3
Methoxymalonyl-CoA: 69.1
Methylmalonyl-CoA: 63.3
Propionyl-CoA: 34.4
Acetyl-CoA: 26.4
Ethylmalonyl-CoA: 24.9
Isobutyryl-CoA: 23.4
Benzoyl-CoA: 21.0
2-Methylbutyryl-CoA: 17.4
CHC-CoA: 14.7
trans-1,2-CPDA: 11.1
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism

NZ_PVTF01000013.1 - Region 1 - NRPS-like,T1PKS

Download region SVG

Location: 1 - 42,305 nt. (total: 42,305 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CLV43_RS35720: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS35755: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS35765: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

CLV43_RS35780: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Hydrolases: dehalogenase hydrolase

CLV43_RS35675: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

CLV43_RS35725: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

CLV43_RS35740: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

CLV43_RS35710: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS35790: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.70	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.69	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000867.3	0.37	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002171.2	0.37	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.37	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001850.4	0.31	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001647.3	0.30	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001987.2	0.30	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000231.5	0.29	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.29	PKS	oviedomycin	Streptomyces antibioticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.68	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000867.3	0.51	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002171.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.50	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001850.4	0.46	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001647.3	0.45	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001987.2	0.45	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000231.5	0.44	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.44	PKS	oviedomycin	Streptomyces antibioticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.25 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.05 out of 20.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.41 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.33 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 42305:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS35710: AHBA - mal

CAL_domain (32..374): AHBA

minowa: AHBA

Prediction, score:

AHBA: 173.9
shikimic_acid: 155.4
fatty_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0

PKS_AT (952..1209): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Isobutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 144.1
inactive: 70.7
Methoxymalonyl-CoA: 66.2
Methylmalonyl-CoA: 56.0
Ethylmalonyl-CoA: 24.3
Isobutyryl-CoA: 19.8
Acetyl-CoA: 19.4
2-Methylbutyryl-CoA: 17.1
CHC-CoA: 16.5
Propionyl-CoA: 15.4
Benzoyl-CoA: 15.3
fatty_acid: 14.5
trans-1,2-CPDA: 13.6
3-Methylbutyryl-CoA: 0.0

CLV43_RS35790: X

AMP-binding (21..399): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SPLTHNAAVLWACLATGAALEFYSATEAQAIVIT
Nearest Stachelhaus code(s):: Val DALFAGGALK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_PVTF01000013.1 - Region 2 - ectoine

Download region SVG

Location: 212,077 - 222,451 nt. (total: 10,375 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deaminase hydrolase

CLV43_RS36565: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

CLV43_RS36595: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002295.3	0.49	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0000375.5	0.49	NRPS	indigoidine	Streptomyces chromofuscus
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0002301.2	0.39	PKS	(P)-ustilaginoidin A	Aschersonia paraphysata
BGC0001075.5	0.38	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0000772.5	0.37	saccharide	lipopolysaccharide	Brucella melitensis
BGC0001954.2	0.36	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii
BGC0001366.5	0.36	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0002058.3	0.35	NRPS, PKS	mutanocyclin	Streptococcus mutans B04Sm5
BGC0002287.2	0.35	NRPS	mutanocyclin, leuvalin, tyrvalin	Streptococcus mutans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002295.3	0.49	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0000375.5	0.49	NRPS	indigoidine	Streptomyces chromofuscus
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0002301.2	0.39	PKS	(P)-ustilaginoidin A	Aschersonia paraphysata
BGC0001075.5	0.38	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0000772.5	0.37	saccharide	lipopolysaccharide	Brucella melitensis
BGC0001954.2	0.36	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii
BGC0001366.5	0.36	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0002058.3	0.35	NRPS, PKS	mutanocyclin	Streptococcus mutans B04Sm5
BGC0002287.2	0.35	NRPS	mutanocyclin, leuvalin, tyrvalin	Streptococcus mutans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

Additional weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.67 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.46 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.72 out of 32.74

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.75 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.35 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.31 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_PVTF01000015.1 - Region 1 - NI-siderophore

Download region SVG

Location: 13,863 - 43,635 nt. (total: 29,773 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

CLV43_RS38755: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CLV43_RS38825: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

CLV43_RS38840: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase

CLV43_RS38830: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: deacetylase hydrolase

CLV43_RS38750: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

CLV43_RS38765: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

CLV43_RS38810: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002305.2	0.51	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002464.3	0.50	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002657.2	0.46	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0002620.2	0.46	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002692.2	0.46	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000131.5	0.44	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001441.5	0.44	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002567.2	0.44	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0001531.5	0.44	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000932.5	0.43	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002305.2	0.51	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002464.3	0.50	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002657.2	0.46	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0002620.2	0.46	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002692.2	0.46	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000131.5	0.44	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001441.5	0.44	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002567.2	0.44	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0001531.5	0.44	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000932.5	0.43	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.17 out of 23.79

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.17 out of 30.11

Confidence: medium

Additional weak hits (13):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.31 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.86 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.82 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.67 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.16 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.64 out of 33.14

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.33 out of 23.43

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.19 out of 30.11

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_PVTF01000015.1 - Region 2 - T1PKS

Download region SVG

Location: 172,299 - 255,801 nt. (total: 83,503 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

CLV43_RS39355: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

CLV43_RS39435: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS39445: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS39450: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

CLV43_RS39460: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

CLV43_RS39470: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Hydrolases: glucosidase phosphatase

CLV43_RS39350: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

CLV43_RS39390: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: synthase

CLV43_RS39385: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CLV43_RS39410: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS48190: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS49790: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

CLV43_RS49795: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000067.5	0.62	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0000041.3	0.61	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000067.5	0.62	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0000041.3	0.61	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.24 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.16 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.52 out of 26.85

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.92 out of 30.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.74 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.43 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.16 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.45 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 172298 - 255801:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - Me-ccmal - ccmal) + (ccmal - Me-redmal) + (redmal - Me-ccmal) + (mal)
Non-colinear ordering:: CLV43_RS39410 + CLV43_RS49790 + CLV43_RS49795 + CLV43_RS48190

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS39410: mal - mal - mmal - mal

PKS_AT (517..787): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.9
inactive: 94.0
Methoxymalonyl-CoA: 65.4
Methylmalonyl-CoA: 45.8
Propionyl-CoA: 37.2
Isobutyryl-CoA: 22.1
Acetyl-CoA: 20.9
CHC-CoA: 16.9
fatty_acid: 15.7
Ethylmalonyl-CoA: 13.9
2-Methylbutyryl-CoA: 10.3
Benzoyl-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1457..1750): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.0
inactive: 106.3
Methoxymalonyl-CoA: 66.0
Methylmalonyl-CoA: 48.3
Isobutyryl-CoA: 26.3
Propionyl-CoA: 25.0
Acetyl-CoA: 23.3
fatty_acid: 13.9
Benzoyl-CoA: 10.8
Ethylmalonyl-CoA: 10.0
CHC-CoA: 8.5
2-Methylbutyryl-CoA: 3.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3110..3400): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 201.9
Ethylmalonyl-CoA: 194.0
Methoxymalonyl-CoA: 157.0
2-Methylbutyryl-CoA: 123.7
trans-1,2-CPDA: 118.2
Propionyl-CoA: 103.7
Malonyl-CoA: 102.9
CHC-CoA: 98.6
Isobutyryl-CoA: 71.5
Benzoyl-CoA: 62.6
3-Methylbutyryl-CoA: 37.6
Acetyl-CoA: 37.3
inactive: 33.0
fatty_acid: 26.3

PKS_AT (4785..5070): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.7
inactive: 91.6
Methoxymalonyl-CoA: 76.9
Methylmalonyl-CoA: 71.7
Propionyl-CoA: 49.4
Isobutyryl-CoA: 39.2
Ethylmalonyl-CoA: 28.2
Acetyl-CoA: 19.3
2-Methylbutyryl-CoA: 18.4
Benzoyl-CoA: 16.5
CHC-CoA: 16.0
fatty_acid: 12.6
trans-1,2-CPDA: 6.3
3-Methylbutyryl-CoA: 0.0

CLV43_RS49790: mal - mmal

PKS_AT (553..841): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.7
inactive: 105.3
Methoxymalonyl-CoA: 67.5
Methylmalonyl-CoA: 48.9
Propionyl-CoA: 26.9
Isobutyryl-CoA: 25.6
Acetyl-CoA: 24.5
fatty_acid: 16.4
Ethylmalonyl-CoA: 15.7
Benzoyl-CoA: 13.5
trans-1,2-CPDA: 9.0
2-Methylbutyryl-CoA: 8.6
CHC-CoA: 5.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (2173..2465): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 191.1
Ethylmalonyl-CoA: 177.7
Methoxymalonyl-CoA: 144.8
2-Methylbutyryl-CoA: 111.5
trans-1,2-CPDA: 106.2
Propionyl-CoA: 98.9
Malonyl-CoA: 89.6
CHC-CoA: 83.1
Isobutyryl-CoA: 48.1
Benzoyl-CoA: 46.7
Acetyl-CoA: 41.8
3-Methylbutyryl-CoA: 33.1
fatty_acid: 24.1
inactive: 19.8

CLV43_RS49795: mal - mmal

PKS_AT (552..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.1
inactive: 104.3
Methoxymalonyl-CoA: 66.7
Methylmalonyl-CoA: 51.0
Isobutyryl-CoA: 25.4
Propionyl-CoA: 24.0
Acetyl-CoA: 23.5
Benzoyl-CoA: 15.4
fatty_acid: 15.0
Ethylmalonyl-CoA: 13.6
CHC-CoA: 9.7
2-Methylbutyryl-CoA: 3.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2523..2821): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 218.3
Ethylmalonyl-CoA: 215.4
Methoxymalonyl-CoA: 178.7
2-Methylbutyryl-CoA: 144.8
trans-1,2-CPDA: 122.7
Malonyl-CoA: 116.3
CHC-CoA: 114.8
Propionyl-CoA: 111.7
Isobutyryl-CoA: 97.0
Benzoyl-CoA: 78.7
Acetyl-CoA: 63.6
3-Methylbutyryl-CoA: 42.9
fatty_acid: 39.4
inactive: 37.3

CLV43_RS48190: mal

PKS_AT (557..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 207.1
inactive: 112.0
Methoxymalonyl-CoA: 54.3
Methylmalonyl-CoA: 47.6
Propionyl-CoA: 18.2
Ethylmalonyl-CoA: 18.1
Acetyl-CoA: 18.0
Benzoyl-CoA: 11.2
Isobutyryl-CoA: 9.6
fatty_acid: 8.5
2-Methylbutyryl-CoA: 4.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_PVTF01000016.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 106,774 nt. (total: 106,774 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

CLV43_RS39690: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acylase glycosyltransferase

CLV43_RS39645: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CLV43_RS39655: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase esterase

CLV43_RS39635: thioesterase

smcogs: SMCOG1004: thioesterase

CLV43_RS39670: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

CLV43_RS39610: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS39615: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS39625: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS39640: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

CLV43_RS49805: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS49810: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

CLV43_RS39660: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.66	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000050.5	0.63	PKS	E-837	Streptomyces aculeolatus
BGC0000058.5	0.62	PKS	FD-891	Streptomyces graminofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.66	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000050.5	0.63	PKS	E-837	Streptomyces aculeolatus
BGC0000058.5	0.62	PKS	FD-891	Streptomyces graminofaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (15):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.50 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.12 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.44 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.10 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.66 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.33 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.46 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.82 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.47 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 106774:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ohmal) + (ohmal - ohmal - ohmal - ohmal - ohmal) + (redmal) + (Me-ccmal - ohmal - ccmal - ccmal) + (ccmal - ccmal - ccmal) + (Me-ccmal - ccmal)
Non-colinear ordering:: CLV43_RS49805 + CLV43_RS39610 + CLV43_RS39615 + CLV43_RS49810 + CLV43_RS39625 + CLV43_RS49815

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS49805: mal - mal

PKS_AT (1826..2101): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.1
inactive: 116.7
Methoxymalonyl-CoA: 68.7
Methylmalonyl-CoA: 63.6
Propionyl-CoA: 45.6
Isobutyryl-CoA: 29.8
Ethylmalonyl-CoA: 20.9
Acetyl-CoA: 20.5
2-Methylbutyryl-CoA: 19.6
Benzoyl-CoA: 18.0
CHC-CoA: 12.8
3-Methylbutyryl-CoA: 12.0
trans-1,2-CPDA: 11.7
fatty_acid: 9.8

PKS_AT (3298..3574): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 223.5
inactive: 116.3
Methoxymalonyl-CoA: 69.0
Methylmalonyl-CoA: 68.9
Propionyl-CoA: 50.5
Isobutyryl-CoA: 27.8
2-Methylbutyryl-CoA: 25.5
Ethylmalonyl-CoA: 23.2
Acetyl-CoA: 22.7
Benzoyl-CoA: 21.1
CHC-CoA: 18.9
trans-1,2-CPDA: 16.7
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

CLV43_RS39610: mal - mal - mal - mal - mal

PKS_AT (550..818): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.8
inactive: 97.5
Methylmalonyl-CoA: 67.6
Methoxymalonyl-CoA: 65.3
Propionyl-CoA: 37.3
CHC-CoA: 27.8
Isobutyryl-CoA: 27.5
Ethylmalonyl-CoA: 26.5
Acetyl-CoA: 24.5
Benzoyl-CoA: 21.4
2-Methylbutyryl-CoA: 21.4
trans-1,2-CPDA: 13.1
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2025..2292): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.5
inactive: 108.3
Methoxymalonyl-CoA: 74.6
Methylmalonyl-CoA: 73.5
Propionyl-CoA: 42.0
Ethylmalonyl-CoA: 39.1
Isobutyryl-CoA: 36.5
Acetyl-CoA: 29.7
Benzoyl-CoA: 26.1
2-Methylbutyryl-CoA: 23.3
trans-1,2-CPDA: 21.5
CHC-CoA: 20.9
fatty_acid: 10.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (3405..3664): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.4
inactive: 96.2
Methoxymalonyl-CoA: 67.3
Methylmalonyl-CoA: 66.4
Propionyl-CoA: 46.9
Ethylmalonyl-CoA: 40.7
2-Methylbutyryl-CoA: 31.7
Isobutyryl-CoA: 27.1
Acetyl-CoA: 22.7
Benzoyl-CoA: 22.6
CHC-CoA: 18.8
trans-1,2-CPDA: 17.1
fatty_acid: 10.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (4877..5143): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.6
inactive: 91.0
Methoxymalonyl-CoA: 74.5
Methylmalonyl-CoA: 68.4
Propionyl-CoA: 45.0
Ethylmalonyl-CoA: 34.6
CHC-CoA: 26.6
Isobutyryl-CoA: 22.7
Acetyl-CoA: 21.8
trans-1,2-CPDA: 19.2
Benzoyl-CoA: 17.9
2-Methylbutyryl-CoA: 17.4
fatty_acid: 13.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (6250..6517): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.0
inactive: 96.2
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 62.9
Propionyl-CoA: 45.7
2-Methylbutyryl-CoA: 32.3
Isobutyryl-CoA: 31.7
Ethylmalonyl-CoA: 29.8
CHC-CoA: 27.4
Acetyl-CoA: 24.3
trans-1,2-CPDA: 23.1
Benzoyl-CoA: 21.7
fatty_acid: 12.6
3-Methylbutyryl-CoA: 0.0

CLV43_RS39615: mal

PKS_AT (538..821): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.0
inactive: 87.6
Methylmalonyl-CoA: 57.3
Methoxymalonyl-CoA: 55.5
Propionyl-CoA: 26.0
Acetyl-CoA: 23.9
Isobutyryl-CoA: 17.3
Benzoyl-CoA: 16.9
Ethylmalonyl-CoA: 15.3
2-Methylbutyryl-CoA: 8.4
trans-1,2-CPDA: 7.6
CHC-CoA: 6.8
3-Methylbutyryl-CoA: 1.4
fatty_acid: 0.0

CLV43_RS49810: mmal - mal - mal - mal

PKS_AT (567..863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.5
Ethylmalonyl-CoA: 195.5
Methoxymalonyl-CoA: 164.4
2-Methylbutyryl-CoA: 148.3
trans-1,2-CPDA: 126.3
Propionyl-CoA: 113.5
CHC-CoA: 105.7
Malonyl-CoA: 87.3
Isobutyryl-CoA: 69.5
Benzoyl-CoA: 58.3
Acetyl-CoA: 44.6
3-Methylbutyryl-CoA: 33.2
fatty_acid: 31.7
inactive: 29.1

PKS_AT (2245..2522): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.4
inactive: 99.5
Methoxymalonyl-CoA: 68.3
Methylmalonyl-CoA: 66.9
Propionyl-CoA: 34.6
Ethylmalonyl-CoA: 34.2
Acetyl-CoA: 22.8
Isobutyryl-CoA: 22.6
Benzoyl-CoA: 16.3
CHC-CoA: 16.1
2-Methylbutyryl-CoA: 15.9
trans-1,2-CPDA: 15.1
fatty_acid: 12.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (3711..3983): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.5
inactive: 100.7
Methoxymalonyl-CoA: 65.6
Methylmalonyl-CoA: 59.8
Propionyl-CoA: 39.7
Ethylmalonyl-CoA: 39.6
2-Methylbutyryl-CoA: 25.2
Isobutyryl-CoA: 24.7
Acetyl-CoA: 22.1
trans-1,2-CPDA: 21.3
Benzoyl-CoA: 21.1
CHC-CoA: 12.4
fatty_acid: 10.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (5379..5642): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.7
inactive: 111.5
Methoxymalonyl-CoA: 64.8
Methylmalonyl-CoA: 61.2
Propionyl-CoA: 39.3
2-Methylbutyryl-CoA: 25.0
Ethylmalonyl-CoA: 24.1
Isobutyryl-CoA: 20.7
Benzoyl-CoA: 18.9
Acetyl-CoA: 17.4
trans-1,2-CPDA: 12.1
CHC-CoA: 11.5
fatty_acid: 10.0
3-Methylbutyryl-CoA: 0.0

CLV43_RS39625: mal - mal - mal

PKS_AT (551..803): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 199.2
inactive: 108.4
Methylmalonyl-CoA: 63.3
Methoxymalonyl-CoA: 62.7
Isobutyryl-CoA: 38.4
Propionyl-CoA: 37.2
Ethylmalonyl-CoA: 27.5
Acetyl-CoA: 25.2
Benzoyl-CoA: 23.9
trans-1,2-CPDA: 20.8
2-Methylbutyryl-CoA: 20.3
CHC-CoA: 20.2
fatty_acid: 13.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2176..2435): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.8
inactive: 106.9
Methoxymalonyl-CoA: 75.5
Methylmalonyl-CoA: 71.5
Propionyl-CoA: 36.6
Ethylmalonyl-CoA: 35.2
Isobutyryl-CoA: 34.0
CHC-CoA: 21.0
2-Methylbutyryl-CoA: 17.1
Acetyl-CoA: 16.7
Benzoyl-CoA: 13.9
trans-1,2-CPDA: 13.4
fatty_acid: 10.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (3797..4081): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.5
inactive: 101.1
Methoxymalonyl-CoA: 62.7
Methylmalonyl-CoA: 57.9
Propionyl-CoA: 27.9
Ethylmalonyl-CoA: 27.6
Acetyl-CoA: 26.7
Benzoyl-CoA: 25.5
Isobutyryl-CoA: 20.1
CHC-CoA: 16.5
trans-1,2-CPDA: 13.4
2-Methylbutyryl-CoA: 12.9
fatty_acid: 11.2
3-Methylbutyryl-CoA: 0.0

CLV43_RS49815: mmal - mal

PKS_AT (560..857): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.1
Ethylmalonyl-CoA: 214.9
Methoxymalonyl-CoA: 175.7
2-Methylbutyryl-CoA: 155.8
trans-1,2-CPDA: 133.5
Propionyl-CoA: 109.1
CHC-CoA: 99.0
Malonyl-CoA: 97.8
Isobutyryl-CoA: 96.3
Benzoyl-CoA: 62.5
Acetyl-CoA: 47.2
fatty_acid: 36.0
3-Methylbutyryl-CoA: 29.5
inactive: 23.2

PKS_AT (2231..2497): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.1
inactive: 97.5
Methoxymalonyl-CoA: 70.8
Methylmalonyl-CoA: 66.4
Ethylmalonyl-CoA: 39.9
Propionyl-CoA: 36.2
Isobutyryl-CoA: 35.9
Benzoyl-CoA: 29.7
Acetyl-CoA: 21.9
trans-1,2-CPDA: 21.6
CHC-CoA: 21.0
2-Methylbutyryl-CoA: 15.2
fatty_acid: 15.0
3-Methylbutyryl-CoA: 0.0

CLV43_RS39640: X

AMP-binding (8..370): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NRNLHQYGLSMIDACSGAALDSYGSTEMGNVSFA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CLV43_RS39645: pk

PKS_AT (51..290): pk

ATSignature: (unknown)

No matches above 50%

minowa: CHC-CoA

Prediction, score:

CHC-CoA: 9.2
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_PVTF01000016.1 - Region 2 - NRPS,lanthipeptide-class-ii

Download region SVG

Location: 112,456 - 162,325 nt. (total: 49,870 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase peptidase protease

CLV43_RS39835: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

CLV43_RS39840: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

CLV43_RS39855: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase decarboxylase hydratase

CLV43_RS39775: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

CLV43_RS39830: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

CLV43_RS39865: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

CLV43_RS48965: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

CLV43_RS48970: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

CLV43_RS39875: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.71	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.70	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Lanthipeptide predictions

Lanthipeptide(s) for CLV43_RS39775

allorf_116027_116173

Leader:

MLSNSRPPRLGRSRSLSGG

Core:

AERATRAGRRGLRGPAPCQGHVISWADAR

Core with dehydrations:

AERADhbRAGRRGLRGPAPCysQGHVIDhaWADAR

antiSMASH-DB 4.0 matches for allorf_116027_116173

100.0%

NZ_PVTF01000016.1:

Lanthipeptides: allorf_116027_116173_lanthipeptide

1

AERATRAGRRGLRGPAPCQGHVISWADAR

29

AERATRAGRRGLRGPAPCQGHVISWADAR

1

AERATRAGRRGLRGPAPCQGHVISWADAR

29

24.1%

NZ_CP012109.1:

Lanthipeptides: allorf_7970617_7970727_lanthipeptide

5

TRAGRRGLRGP

15

TR+GRR L P

7

TRSGRRSLHSP

17

23.8%

NZ_CP072384.1:

Lanthipeptides: allorf_2899895_2900053_lanthipeptide

3

RATRAGRRGLRGPAPCQGHVISWADAR

29

R R R R PA H I W R

12

RRLRDFTRDFREPAMESCHTIGWTTDR

38

with 1 more sequence matches

20.7%

NZ_JACHIN010000021.1:

Lanthipeptides: allorf_119871_119978_lanthipeptide

17

PCQGHVISWA

26

PC HV S+A

1

PCYSHVTSYA

10

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.13 out of 26.85

Confidence: medium

Additional weak hits (8):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.79 out of 36.54

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.27 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

allorf_116027_116173 - Class II

Cleavage pHMM score: -4.90

RODEO score: 0

Monoisotopic mass: 3078.6 Da

Molecular weight: 3080.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3098.5 Da N = 1

Predicted core structure(s)

For candidate cluster 2, location 112455 - 162325:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Val - Asn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS48965: X

AMP-binding (464..861): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGQSWDAFALEGQMMTGGEINGYGPAESMGFTTV
Nearest Stachelhaus code(s):: Val DALWMGGTFK (47% 8Å match)
Stachelhaus code match:: 80% (moderate)

CLV43_RS48970: Val - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (453..828): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: TGQAWDAAVLEGWLLTGGDVHGYGPVESMVFATA
Nearest Stachelhaus code(s):: Val DALWLGGVFK (50% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1463..1834): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTAVKAVVGGEVNEYGPTEATVGCTW
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_PVTF01000018.1 - Region 1 - terpene

Download region SVG

Location: 18,867 - 43,957 nt. (total: 25,091 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

CLV43_RS41105: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acyltransferase

CLV43_RS41145: acyltransferase

smcogs: SMCOG1141: acyltransferase

Ligases: synthetase

CLV43_RS41100: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.56	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.55	terpene	isorenieratene	Streptomyces argillaceus
BGC0000650.3	0.54	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000633.3	0.53	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.53	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.51	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.56	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.55	terpene	isorenieratene	Streptomyces argillaceus
BGC0000650.3	0.54	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000633.3	0.53	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.53	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.51	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

CLV43_RS41100: PT_FPPS_like

Domain 1 (51 - 337): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

CLV43_RS41115: PT_phytoene_like

Domain 1 (1 - 219): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 27.38 out of 29.65

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 24.78 out of 24.78

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (10):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.95 out of 25.88

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.33 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.03 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.58 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.58 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.93 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.22 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.52 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.54 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_PVTF01000018.1 - Region 2 - lanthipeptide-class-iii

BGC0000553.3 (SSGG_RS09925):

Download region SVG

Location: 117,721 - 140,270 nt. (total: 22,550 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

CLV43_RS41605: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acylase

CLV43_RS41545: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

CLV43_RS41550: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

CLV43_RS41560: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.63	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.63	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000518.3	0.52	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for CLV43_RS41570

CLV43_RS41575

Leader:

MGFILDMQELETPEAPSNAM

Core:

ASGHGGGGSTTASSASLLLPCSHSSASLVLC

Core with dehydrations:

ADhaGHGGGGDhaDhbDhbADhaDhaADhaLLLPCysDhaHDhaDhaADhaLVLCys

antiSMASH-DB 4.0 matches for CLV43_RS41575

100.0%

NZ_PVTF01000018.1:

Lanthipeptides: CLV43_RS41575_lanthipeptide

1

ASGHGGGGSTTASSASLLLPCSHSSASLVLC

31

ASGHGGGGSTTASSASLLLPCSHSSASLVLC

1

ASGHGGGGSTTASSASLLLPCSHSSASLVLC

31

85.7%

NZ_JANYMP010000002.1:

Lanthipeptides: NZH93_RS06250_lanthipeptide

1

ASGHGGGG----STTASSASLLLPCSHSSASLVLC

31

ASGHGGGG STTASSASLLLPCSHSSASL+LC

1

ASGHGGGGGGGGSTTASSASLLLPCSHSSASLILC

35

59.4%

NZ_JACHJN010000006.1:

Lanthipeptides: FHS29_RS22065_lanthipeptide

10

TTASSASLLLPCSHSSASLVLC

31

TTAS+ SLLLPCSHS+ASLVLC

11

TTASNVSLLLPCSHSTASLVLC

32

with 46 more sequence matches

Only the first 10 are displayed here.

56.2%

NZ_BBOJ01000004.1and 13 others:

NZ_BMNC01000020.1 Lanthipeptides: IEY88_RS39185_lanthipeptideNZ_BNAR01000026.1 Lanthipeptides: IE307_RS43650_lanthipeptideNZ_CP099738.1 Lanthipeptides: ND450_RS23215_lanthipeptideNZ_FNCC01000020.1 Lanthipeptides: BLT23_RS35745_lanthipeptideNZ_FNET01000005.1 Lanthipeptides: BLR21_RS13720_lanthipeptideNZ_FNIX01000011.1 Lanthipeptides: BLQ91_RS25790_lanthipeptideNZ_FOFR01000004.1 Lanthipeptides: BMW88_RS12345_lanthipeptideNZ_FOFV01000016.1 Lanthipeptides: BMY74_RS32885_lanthipeptideNZ_FWYC01000011.1 Lanthipeptides: B9C42_RS41415_lanthipeptideNZ_JAAMPJ010000008.1 Lanthipeptides: G7043_RS27905_lanthipeptideNZ_JAJCXE010000046.1 Lanthipeptides: L6E10_RS30695_lanthipeptideNZ_JAPJDL010000024.1 Lanthipeptides: ORI60_RS35805_lanthipeptideNZ_QQAU01000015.1 Lanthipeptides: DFR72_RS35920_lanthipeptide

Lanthipeptides: AOM45_RS50700_lanthipeptide

9

STTASSASLLLPCSHSSASLVLC

31

STTAS+ASLLLPCSHS+ SL+ C

10

STTASNASLLLPCSHSTVSLLAC

32

55.9%

NZ_JAJHUO010000006.1:

Lanthipeptides: LNK82_RS10890_lanthipeptide

10

TTASSASLLLPCSHSSASLVLC

31

TTAS+ASLLLPCSHS+ SLVLC

13

TTASNASLLLPCSHSTVSLVLC

34

53.1%

NZ_CP016793.1and 4 others:

NZ_CP034550.1 Lanthipeptides: EKG83_RS07645_lanthipeptideNZ_QFWW01000007.1 Lanthipeptides: DI276_RS13535_lanthipeptideNZ_QGHB01000016.1 Lanthipeptides: C8D88_RS40205_lanthipeptideNZ_QLTT01000007.1 Lanthipeptides: C8D87_RS29500_lanthipeptide

Lanthipeptides: BBK82_RS02805_lanthipeptide

10

TTASSASLLLPCSHSSASLVLC

31

TTAS+ASLLLPCSHS+ SL+ C

11

TTASNASLLLPCSHSTVSLLAC

32

48.4%

NC_019673.1:

Lanthipeptides: BN6_RS44805_lanthipeptide

15

ASLLLPCSHSSASLVLC

31

SLLLPCSHSSASL+LC

15

VSLLLPCSHSSASLLLC

31

48.4%

NZ_CP095376.1:

Lanthipeptides: MUY14_RS34840_lanthipeptide

3

GHGGGGSTTASSASLLLPCSHSSASLVLC

31

GHGGG S+ SLL C+HS+ SL+ C

1

GHGGG----TSNLSLLAACAHSTLSLLTC

25

48.4%

NZ_FNON01000002.1:

Lanthipeptides: BLV57_RS10465_lanthipeptide

2

SGHGGGGSTTASSASLLLPCSHSSASLVLC

31

SGHGGG S+ SLL C++S+ SL+ C

1

SGHGGG---EPSNLSLLASCTNSTISLLTC

27

47.1%

NZ_LWLC01000002.1:

Lanthipeptides: A6A25_RS42770_lanthipeptide

12

ASSASLLLPCSHSSASLVLC

31

AS+ASLLLPCSHS+ SL+LC

15

ASNASLLLPCSHSTVSLILC

34

45.2%

NZ_CP080519.1:

Lanthipeptides: K1T34_RS20225_lanthipeptide

3

GHGGGGSTTASSASLLLPCSHSSASLVLC

31

GHG G S+ SLL C+HS+ SL+ C

3

GHGHGA---PSNLSLLASCAHSTLSLLTC

28

45.2%

NZ_CP097289.1:

Lanthipeptides: M4V62_RS29260_lanthipeptide

6

GGGSTTASSASLLLPCSHSSASLVLC

31

GGG +TAS LL C S SLV+C

1

GGGQSTAS----LLLC-WSEVSLVIC

21

45.2%

NZ_FMZZ01000019.1:

Lanthipeptides: BLS56_RS27445_lanthipeptide

3

GHGGGGSTTASSASLLLPCSHSSASLVLC

31

GHGG AS+ SLL C++S+ SL+ C

1

GHGG-----ASNLSLLASCANSTVSLLTC

24

MIBiG 4.0 matches for CLV43_RS41575

38.7%

Lanthipeptide: SRO15-2212

11

TASSASLLLPCSHSSASLVLC

31

T S SLL+ C +SS S+VLC

1

TGSQVSLLV-CEYSSLSVVLC

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.90 out of 29.72

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.07 out of 23.43

Confidence: medium

Additional weak hits (16):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.10 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.16 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.50 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.78 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.71 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.08 out of 21.55

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.83 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.56 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.85 out of 26.12

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.63 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.42 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.71 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.62 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.04 out of 24.78

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

CLV43_RS41575 - Class III

Cleavage pHMM score: 9.00

RODEO score: 0

Monoisotopic mass: 2616.3 Da

Molecular weight: 2617.9 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2635.9 Da N = 1; 2653.9 Da N = 2; 2671.9 Da N = 3; 2689.9 Da N = 4; 2708.0 Da N = 5; 2726.0 Da N = 6; 2744.0 Da N = 7; 2762.0 Da N = 8; 2780.0 Da N = 9

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
MexT	Global virulence regulator
NtrC	Nitrogen regulatory protein C

NZ_PVTF01000018.1 - Region 3 - T1PKS

Download region SVG

Location: 144,569 - 166,491 nt. (total: 21,923 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

CLV43_RS41730: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Lyases: cyclase

CLV43_RS41675: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: synthase

CLV43_RS41740: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002171.2	0.47	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.47	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002171.2	0.47	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.47	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

Additional weak hits (11):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.28 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.37 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.10 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.35 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.08 out of 30.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.86 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.68 out of 23.43

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.99 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.37 out of 26.06

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_PVTF01000021.1 - Region 1 - T1PKS

Download region SVG

Location: 65,019 - 161,070 nt. (total: 96,052 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

CLV43_RS43735: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

CLV43_RS43740: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS43750: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS43795: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

CLV43_RS43805: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

CLV43_RS43810: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

CLV43_RS43825: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: acylase glycosyltransferase methyltransferase

CLV43_RS43715: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

CLV43_RS43800: methyltransferase

smcogs: SMCOG1089: methyltransferase

CLV43_RS43835: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

CLV43_RS43840: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: phosphatase

CLV43_RS43720: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Lyases: dehydratase

CLV43_RS43820: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

CLV43_RS43755: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS43790: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS48300: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transporter

CLV43_RS43675: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.78	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.65	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000278.3	0.61	PKS	urdamycin	Streptomyces fradiae
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000037.4	0.59	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.78	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.65	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000278.3	0.61	PKS	urdamycin	Streptomyces fradiae
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000037.4	0.59	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (16):

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.07 out of 30.98

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.27 out of 20.01

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.25 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.32 out of 36.54

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 36.54

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.84 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.42 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.81 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.93 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.30 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.38 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.47 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 65018 - 161070:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ohmal - ohmal - Me-mal) + (Me-ohmal - Me-ohmal - ccmal) + (Me-ccmal - Me-redmal - Me-ohmal - Me-ccmal) + (Me-ccmal)
Non-colinear ordering:: CLV43_RS43715 + CLV43_RS43755 + CLV43_RS48300 + CLV43_RS43790

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS43715: mmal - mmal - mal - mmal

PKS_AT (97..395): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 134.8
Ethylmalonyl-CoA: 134.6
2-Methylbutyryl-CoA: 127.5
Propionyl-CoA: 119.0
Methoxymalonyl-CoA: 117.6
CHC-CoA: 81.8
trans-1,2-CPDA: 75.6
Isobutyryl-CoA: 64.3
Malonyl-CoA: 62.7
Acetyl-CoA: 45.1
Benzoyl-CoA: 38.5
3-Methylbutyryl-CoA: 29.9
fatty_acid: 28.8
inactive: 25.1

PKS_AT (1050..1333): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 195.8
Ethylmalonyl-CoA: 179.8
2-Methylbutyryl-CoA: 151.1
Methoxymalonyl-CoA: 149.1
Propionyl-CoA: 114.3
trans-1,2-CPDA: 111.3
CHC-CoA: 91.1
Malonyl-CoA: 85.6
Isobutyryl-CoA: 61.8
Benzoyl-CoA: 48.4
Acetyl-CoA: 36.3
inactive: 30.0
fatty_acid: 14.3
3-Methylbutyryl-CoA: 13.3

PKS_AT (2404..2679): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.7
inactive: 96.9
Methoxymalonyl-CoA: 69.8
Methylmalonyl-CoA: 50.6
Propionyl-CoA: 34.5
Isobutyryl-CoA: 25.8
Ethylmalonyl-CoA: 23.9
CHC-CoA: 19.5
Acetyl-CoA: 16.6
Benzoyl-CoA: 16.1
fatty_acid: 15.3
2-Methylbutyryl-CoA: 10.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3731..4023): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 196.9
Ethylmalonyl-CoA: 189.5
Methoxymalonyl-CoA: 164.8
2-Methylbutyryl-CoA: 137.0
trans-1,2-CPDA: 116.6
CHC-CoA: 112.6
Propionyl-CoA: 108.2
Benzoyl-CoA: 84.3
Isobutyryl-CoA: 79.5
Malonyl-CoA: 76.3
Acetyl-CoA: 51.9
3-Methylbutyryl-CoA: 49.5
fatty_acid: 30.5
inactive: 20.3

CLV43_RS43755: mmal - mmal - mal

PKS_AT (566..855): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.2
Ethylmalonyl-CoA: 190.3
Methoxymalonyl-CoA: 163.7
2-Methylbutyryl-CoA: 123.1
trans-1,2-CPDA: 109.7
CHC-CoA: 103.5
Propionyl-CoA: 100.8
Malonyl-CoA: 93.1
Isobutyryl-CoA: 61.8
Benzoyl-CoA: 56.8
Acetyl-CoA: 42.3
3-Methylbutyryl-CoA: 34.0
inactive: 29.7
fatty_acid: 27.2

PKS_AT (2018..2313): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 187.2
Ethylmalonyl-CoA: 183.4
Methoxymalonyl-CoA: 161.6
trans-1,2-CPDA: 119.7
2-Methylbutyryl-CoA: 117.8
Propionyl-CoA: 94.6
Malonyl-CoA: 83.3
CHC-CoA: 80.6
Benzoyl-CoA: 61.7
Isobutyryl-CoA: 56.6
fatty_acid: 47.9
3-Methylbutyryl-CoA: 43.7
Acetyl-CoA: 27.3
inactive: 20.5

PKS_AT (3505..3795): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.6
inactive: 96.9
Methoxymalonyl-CoA: 55.6
Methylmalonyl-CoA: 48.6
Propionyl-CoA: 36.0
CHC-CoA: 21.6
2-Methylbutyryl-CoA: 18.3
Acetyl-CoA: 15.6
Benzoyl-CoA: 14.7
Isobutyryl-CoA: 13.4
fatty_acid: 9.3
Ethylmalonyl-CoA: 8.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

CLV43_RS48300: mmal - mmal - mmal - mmal

PKS_AT (548..837): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.3
Ethylmalonyl-CoA: 207.3
Methoxymalonyl-CoA: 177.4
2-Methylbutyryl-CoA: 149.5
trans-1,2-CPDA: 121.4
Propionyl-CoA: 113.9
CHC-CoA: 107.1
Malonyl-CoA: 104.3
Isobutyryl-CoA: 70.9
Benzoyl-CoA: 58.7
Acetyl-CoA: 53.2
fatty_acid: 42.9
inactive: 32.3
3-Methylbutyryl-CoA: 28.2

PKS_AT (2237..2535): mmal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 79.2%; Methylmalonyl-CoA: 79.2%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 170.2
Ethylmalonyl-CoA: 167.0
Methoxymalonyl-CoA: 152.2
2-Methylbutyryl-CoA: 103.5
Malonyl-CoA: 102.3
trans-1,2-CPDA: 99.5
Propionyl-CoA: 95.2
CHC-CoA: 88.1
Isobutyryl-CoA: 76.8
Benzoyl-CoA: 48.9
3-Methylbutyryl-CoA: 46.7
fatty_acid: 46.6
Acetyl-CoA: 46.5
inactive: 40.3

PKS_AT (4252..4541): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.8
Ethylmalonyl-CoA: 186.9
Methoxymalonyl-CoA: 166.4
2-Methylbutyryl-CoA: 119.2
trans-1,2-CPDA: 115.6
Propionyl-CoA: 108.1
CHC-CoA: 98.4
Malonyl-CoA: 97.6
Isobutyryl-CoA: 74.1
Benzoyl-CoA: 69.0
Acetyl-CoA: 42.3
inactive: 38.1
3-Methylbutyryl-CoA: 35.2
fatty_acid: 33.5

PKS_AT (5736..6025): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.9
Ethylmalonyl-CoA: 188.9
Methoxymalonyl-CoA: 160.2
2-Methylbutyryl-CoA: 121.4
trans-1,2-CPDA: 118.2
CHC-CoA: 112.6
Propionyl-CoA: 101.1
Malonyl-CoA: 101.0
Isobutyryl-CoA: 69.0
Benzoyl-CoA: 63.7
Acetyl-CoA: 40.2
fatty_acid: 38.5
3-Methylbutyryl-CoA: 37.6
inactive: 29.2

CLV43_RS43790: mmal

PKS_AT (543..836): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 79.2%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 170.9
Ethylmalonyl-CoA: 146.6
Methoxymalonyl-CoA: 138.7
2-Methylbutyryl-CoA: 115.9
trans-1,2-CPDA: 99.4
CHC-CoA: 91.3
Malonyl-CoA: 82.6
Propionyl-CoA: 75.2
Isobutyryl-CoA: 53.0
3-Methylbutyryl-CoA: 46.8
Benzoyl-CoA: 39.6
fatty_acid: 33.0
Acetyl-CoA: 22.3
inactive: 10.1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_PVTF01000022.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 49,894 nt. (total: 49,894 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: hydratase

CLV43_RS43880: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: synthase

CLV43_RS43860: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS43865: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

CLV43_RS43940: pseudouridine synthase

smcogs: SMCOG1279: pseudouridine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000067.5	0.54	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001051.5	0.52	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000143.5	0.51	PKS	salinomycin	Streptomyces albus
BGC0001065.5	0.50	PKS	herboxidiene	Streptomyces chromofuscus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000067.5	0.54	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001051.5	0.52	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0000143.5	0.51	PKS	salinomycin	Streptomyces albus
BGC0001065.5	0.50	PKS	herboxidiene	Streptomyces chromofuscus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

Additional weak hits (12):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.20 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.44 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.04 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.51 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.90 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.78 out of 32.74

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.88 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.66 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 49894:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ohmal - ccmal - ohmal - ccmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

CLV43_RS43865: mal - mal - mal - mal - mal - mal

PKS_AT (659..945): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.3
inactive: 104.8
Methoxymalonyl-CoA: 83.2
Methylmalonyl-CoA: 75.3
Isobutyryl-CoA: 43.8
Propionyl-CoA: 37.1
Ethylmalonyl-CoA: 30.8
Benzoyl-CoA: 27.3
Acetyl-CoA: 19.1
CHC-CoA: 11.6
fatty_acid: 10.7
trans-1,2-CPDA: 10.1
2-Methylbutyryl-CoA: 9.9
3-Methylbutyryl-CoA: 6.2

PKS_AT (2123..2402): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.7
inactive: 103.1
Methylmalonyl-CoA: 76.6
Methoxymalonyl-CoA: 75.2
Propionyl-CoA: 47.4
Ethylmalonyl-CoA: 42.8
Isobutyryl-CoA: 32.2
Acetyl-CoA: 24.5
2-Methylbutyryl-CoA: 21.6
Benzoyl-CoA: 21.4
CHC-CoA: 21.1
trans-1,2-CPDA: 20.2
fatty_acid: 19.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (3583..3842): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.3
inactive: 93.2
Methoxymalonyl-CoA: 66.5
Methylmalonyl-CoA: 62.7
Propionyl-CoA: 45.4
Isobutyryl-CoA: 31.3
Ethylmalonyl-CoA: 27.8
Acetyl-CoA: 23.6
CHC-CoA: 22.9
Benzoyl-CoA: 19.4
2-Methylbutyryl-CoA: 16.0
trans-1,2-CPDA: 14.0
fatty_acid: 6.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (5212..5477): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.0
inactive: 101.8
Methoxymalonyl-CoA: 69.1
Methylmalonyl-CoA: 62.5
Propionyl-CoA: 43.6
Ethylmalonyl-CoA: 33.4
Isobutyryl-CoA: 32.9
2-Methylbutyryl-CoA: 28.8
Benzoyl-CoA: 22.4
Acetyl-CoA: 21.0
trans-1,2-CPDA: 18.4
CHC-CoA: 13.5
fatty_acid: 9.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (6613..6869): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.7
inactive: 92.7
Methoxymalonyl-CoA: 72.4
Methylmalonyl-CoA: 63.7
Propionyl-CoA: 47.5
Ethylmalonyl-CoA: 33.5
Isobutyryl-CoA: 32.1
CHC-CoA: 26.5
Benzoyl-CoA: 23.9
trans-1,2-CPDA: 22.9
Acetyl-CoA: 22.3
2-Methylbutyryl-CoA: 19.8
fatty_acid: 11.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8239..8518): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.9
inactive: 82.4
Methoxymalonyl-CoA: 62.3
Methylmalonyl-CoA: 58.8
Propionyl-CoA: 44.1
Acetyl-CoA: 21.9
Ethylmalonyl-CoA: 21.2
trans-1,2-CPDA: 17.5
CHC-CoA: 17.0
Benzoyl-CoA: 17.0
2-Methylbutyryl-CoA: 15.0
Isobutyryl-CoA: 14.1
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor

NZ_PVTF01000023.1 - Region 1 - RiPP-like

Download region SVG

Location: 86,760 - 97,575 nt. (total: 10,816 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

CLV43_RS44870: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.33	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002788.2	0.21	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001574.5	0.20	NRPS	SF2768	Streptomyces thioluteus
BGC0001138.5	0.18	other (nucleoside)	a201a	Marinactinospora thermotolerans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.34	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.33	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002788.2	0.21	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001574.5	0.20	NRPS	SF2768	Streptomyces thioluteus
BGC0001138.5	0.18	other (nucleoside)	a201a	Marinactinospora thermotolerans

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

Additional weak hits (3):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.81 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.52 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_PVTF01000025.1 - Region 1 - terpene