GCF_002972405.1 - 7 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NZ_JZOJ01000007.1 (Escherichia coli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	RiPP-like	2,542	11,415	Low	microcin L	ribosomal:RiPP:Microcin

NZ_JZOJ01000072.1 (Escherichia coli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	azole-containing-RiPP	103,213	129,505
Region 29.2	NRP-metallophore,NRPS	429,040	483,994	High	enterobactin	NRPS:Type I
Region 29.3	terpene-precursor	596,430	617,329

NZ_JZOJ01000078.1 (Escherichia coli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 40.1	NRP-metallophore,NRPS,T1PKS,butyrolactone	444,371	512,382	Low	yersiniabactin	NRPS:Type I+PKS
Region 40.2	NRPS,T1PKS	517,864	589,026	High	N-myristoyl-D-asparagine/cis-7-tetradecenoyl-D-asparagine/(R)-N1-((S)-5-oxohexan-2-yl)-2-tetradecanamidosuccinamide/colibactin/precolibactin 1489	NRPS:Type I+PKS:Type I

NZ_JZOJ01000049.1 (Escherichia coli)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 88.1	lassopeptide	1	6,012	High	microcin J25	ribosomal:RiPP:Lasso peptide

No secondary metabolite regions were found in these records:: NZ_JZOJ01000050.1 (Escherichia coli); NZ_JZOJ01000051.1 (Escherichia coli); NZ_JZOJ01000052.1 (Escherichia coli); NZ_JZOJ01000053.1 (Escherichia coli); NZ_JZOJ01000054.1 (Escherichia coli); NZ_JZOJ01000008.1 (Escherichia coli); NZ_JZOJ01000055.1 (Escherichia coli); NZ_JZOJ01000056.1 (Escherichia coli); NZ_JZOJ01000057.1 (Escherichia coli); NZ_JZOJ01000058.1 (Escherichia coli); NZ_JZOJ01000059.1 (Escherichia coli); NZ_JZOJ01000060.1 (Escherichia coli); NZ_JZOJ01000061.1 (Escherichia coli); NZ_JZOJ01000062.1 (Escherichia coli); NZ_JZOJ01000063.1 (Escherichia coli); NZ_JZOJ01000009.1 (Escherichia coli); NZ_JZOJ01000064.1 (Escherichia coli); NZ_JZOJ01000065.1 (Escherichia coli); NZ_JZOJ01000010.1 (Escherichia coli); NZ_JZOJ01000066.1 (Escherichia coli); NZ_JZOJ01000067.1 (Escherichia coli); NZ_JZOJ01000068.1 (Escherichia coli); NZ_JZOJ01000069.1 (Escherichia coli); NZ_JZOJ01000001.1 (Escherichia coli); NZ_JZOJ01000070.1 (Escherichia coli); NZ_JZOJ01000071.1 (Escherichia coli); NZ_JZOJ01000011.1 (Escherichia coli); NZ_JZOJ01000012.1 (Escherichia coli); NZ_JZOJ01000013.1 (Escherichia coli); NZ_JZOJ01000073.1 (Escherichia coli); NZ_JZOJ01000014.1 (Escherichia coli); NZ_JZOJ01000074.1 (Escherichia coli); NZ_JZOJ01000015.1 (Escherichia coli); NZ_JZOJ01000075.1 (Escherichia coli); NZ_JZOJ01000016.1 (Escherichia coli); NZ_JZOJ01000076.1 (Escherichia coli); NZ_JZOJ01000077.1 (Escherichia coli); NZ_JZOJ01000002.1 (Escherichia coli); NZ_JZOJ01000079.1 (Escherichia coli); NZ_JZOJ01000080.1 (Escherichia coli); NZ_JZOJ01000017.1 (Escherichia coli); NZ_JZOJ01000081.1 (Escherichia coli); NZ_JZOJ01000082.1 (Escherichia coli); NZ_JZOJ01000018.1 (Escherichia coli); NZ_JZOJ01000019.1 (Escherichia coli); NZ_JZOJ01000083.1 (Escherichia coli); NZ_JZOJ01000084.1 (Escherichia coli); NZ_JZOJ01000020.1 (Escherichia coli); NZ_JZOJ01000085.1 (Escherichia coli); NZ_JZOJ01000086.1 (Escherichia coli); NZ_JZOJ01000087.1 (Escherichia coli); NZ_JZOJ01000088.1 (Escherichia coli); NZ_JZOJ01000021.1 (Escherichia coli); NZ_JZOJ01000003.1 (Escherichia coli); NZ_JZOJ01000022.1 (Escherichia coli); NZ_JZOJ01000089.1 (Escherichia coli); NZ_JZOJ01000023.1 (Escherichia coli); NZ_JZOJ01000024.1 (Escherichia coli); NZ_JZOJ01000025.1 (Escherichia coli); NZ_JZOJ01000004.1 (Escherichia coli); NZ_JZOJ01000026.1 (Escherichia coli); NZ_JZOJ01000027.1 (Escherichia coli); NZ_JZOJ01000028.1 (Escherichia coli); NZ_JZOJ01000029.1 (Escherichia coli); NZ_JZOJ01000030.1 (Escherichia coli); NZ_JZOJ01000031.1 (Escherichia coli); NZ_JZOJ01000005.1 (Escherichia coli); NZ_JZOJ01000032.1 (Escherichia coli); NZ_JZOJ01000033.1 (Escherichia coli); NZ_JZOJ01000034.1 (Escherichia coli); NZ_JZOJ01000035.1 (Escherichia coli); NZ_JZOJ01000036.1 (Escherichia coli); NZ_JZOJ01000037.1 (Escherichia coli); NZ_JZOJ01000038.1 (Escherichia coli); NZ_JZOJ01000039.1 (Escherichia coli); NZ_JZOJ01000040.1 (Escherichia coli); NZ_JZOJ01000041.1 (Escherichia coli); NZ_JZOJ01000042.1 (Escherichia coli); NZ_JZOJ01000043.1 (Escherichia coli); NZ_JZOJ01000044.1 (Escherichia coli); NZ_JZOJ01000045.1 (Escherichia coli); NZ_JZOJ01000046.1 (Escherichia coli); NZ_JZOJ01000047.1 (Escherichia coli); NZ_JZOJ01000048.1 (Escherichia coli); NZ_JZOJ01000006.1 (Escherichia coli)

Compact view

NZ_JZOJ01000007.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 2,542 - 11,415 nt. (total: 8,874 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

No matches found.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.70 out of 32.93

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.97 out of 32.93

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 28.19

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.61 out of 30.22

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.16 out of 27.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.24 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
LexA variant 3	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JZOJ01000072.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 103,213 - 129,505 nt. (total: 26,293 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

VE62_RS13560: flavodoxin

smcogs: SMCOG1134: flavodoxin

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001285.5	0.34	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0002300.2	0.30	NRPS	albomycin delta2, albomycin delta1, albomycin epsilon	Streptomyces sp. ATCC 700974
BGC0001441.5	0.28	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002439.3	0.28	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000781.3	0.28	saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000070.5	0.27	PKS	griseofulvin, epidechlorogriseofulvin	Penicillium aethiopicum
BGC0000784.3	0.27	saccharide	O-antigen	Pseudomonas aeruginosa
BGC0001302.5	0.27	other (other)	lomofungin	Streptomyces lomondensis
BGC0000981.3	0.26	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E6
BGC0002012.4	0.25	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001285.5	0.34	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0002300.2	0.30	NRPS	albomycin delta2, albomycin delta1, albomycin epsilon	Streptomyces sp. ATCC 700974
BGC0001441.5	0.28	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002439.3	0.28	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000781.3	0.28	saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000070.5	0.27	PKS	griseofulvin, epidechlorogriseofulvin	Penicillium aethiopicum
BGC0000784.3	0.27	saccharide	O-antigen	Pseudomonas aeruginosa
BGC0001302.5	0.27	other (other)	lomofungin	Streptomyces lomondensis
BGC0000981.3	0.26	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E6
BGC0002012.4	0.25	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.32 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 28.19

Confidence: medium

Additional weak hits (5):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.73 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.12 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.81 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.82 out of 29.38

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
ZuR variant 1	Zinc-responsive repressor

Core peptide predictions

No core peptides found.

NZ_JZOJ01000072.1 - Region 2 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 429,040 - 483,994 nt. (total: 54,955 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

VE62_RS15225: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

VE62_RS15230: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

VE62_RS15260: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

VE62_RS15280: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

VE62_RS15385: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Transferases: PPTase aminotransferase

VE62_RS15255: aminotransferase

smcogs: SMCOG1019: aminotransferase

VE62_RS15350: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

VE62_RS15275: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

VE62_RS15285: isochorismatase

smcogs: SMCOG1027: isochorismatase

VE62_RS15340: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Isomerases: isomerase

VE62_RS15235: disulfide isomerase/thiol-disulfide oxidase

smcogs: SMCOG1233: disulfide isomerase/thiol-disulfide oxidase

VE62_RS15295: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

VE62_RS15290: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

VE62_RS15330: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

VE62_RS15370: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Translocases: permease

VE62_RS15395: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002476.2	1.62	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002075.3	0.86	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.73	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002413.3	0.67	NRPS	frederiksenibactin	Yersinia frederiksenii ATCC 33641
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001185.5	0.65	NRPS	bacillibactin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002476.2	0.93	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.69	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002413.3	0.67	NRPS	frederiksenibactin	Yersinia frederiksenii ATCC 33641
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001185.5	0.66	NRPS	bacillibactin	Bacillus velezensis FZB42

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.84 out of 29.38

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.40 out of 21.55

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.40 out of 30.25

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.70 out of 26.85

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.00 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.50 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.06 out of 28.19

Confidence: medium

Additional weak hits (19):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.06 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.18 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.71 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.46 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.06 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.52 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.34 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.09 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.38 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.24 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.02 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.36 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.34 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.08 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.41 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.06 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 429039 - 483994:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

VE62_RS15290: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (34..437): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SRSIYAMSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz AMPAQGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

VE62_RS15330: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (461..863): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVSW
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CRP	Cyclic AMP receptor protein
ColR	Phenol-responsive regulator
FuR variant 1	Ferric Uptake Regulator
RutR	Regulator of the pyrimidine and purine metabolism
ZuR variant 1	Zinc-responsive repressor

NZ_JZOJ01000072.1 - Region 3 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 596,430 - 617,329 nt. (total: 20,900 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase synthase

VE62_RS16065: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

VE62_RS16090: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Hydrolases: synthase

VE62_RS16090: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Ligases: synthase synthetase

VE62_RS16055: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

VE62_RS16060: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.50	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.50	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

VE62_RS16055: PT_FPPS_like

Domain 1 (32 - 299): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.79 out of 27.78

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.49 out of 26.85

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.75 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.63 out of 26.06

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.74 out of 29.72

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.94 out of 30.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.88 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
RutR	Regulator of the pyrimidine and purine metabolism

NZ_JZOJ01000078.1 - Region 1 - NRP-metallophore,NRPS,T1PKS,butyrolactone

Download region GenBank file

Download region SVG

Location: 444,371 - 512,382 nt. (total: 68,012 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

VE62_RS22165: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

VE62_RS22175: thioesterase

smcogs: SMCOG1004: thioesterase

Isomerases: isomerase

VE62_RS22135: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

VE62_RS22160: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

VE62_RS22180: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

VE62_RS22270: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

VE62_RS22290: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001055.5	1.76	NRPS, PKS	yersiniabactin	Escherichia coli
BGC0000467.5	1.55	NRPS	yersiniabactin	Yersinia enterocolitica
BGC0001641.4	0.89	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.89	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.89	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.88	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002570.2	0.64	NRPS, PKS	yersiniabactin	Pseudomonas syringae pv. tomato str. DC3000
BGC0001843.2	0.63	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0001363.5	0.56	NRPS, PKS	ralsolamycin	Ralstonia solanacearum GMI1000
BGC0002715.2	0.54	NRPS, PKS	HTTPCA, prepiscibactin, piscibactin	Photorhabdus laumondii subsp. laumondii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000467.5	0.79	NRPS	yersiniabactin	Yersinia enterocolitica
BGC0001055.5	0.79	NRPS, PKS	yersiniabactin	Escherichia coli
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002570.2	0.54	NRPS, PKS	yersiniabactin	Pseudomonas syringae pv. tomato str. DC3000
BGC0001843.2	0.54	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0002474.2	0.52	NRPS	agrobactin	Agrobacterium tumefaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.22 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.53 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.91 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.67 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.09 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.08 out of 26.06

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.29 out of 27.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.80 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.86 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.01 out of 26.06

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.34 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.50 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.23 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.51 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.39 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.64 out of 26.06

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.72 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.81 out of 28.19

Confidence: medium

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 27.10 out of 33.14

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.54 out of 27.04

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.11 out of 28.19

Confidence: medium

Additional weak hits (24):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.94 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.12 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.54 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.36 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 28.67 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 30.51 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.62 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.52 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.69 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.13 out of 26.06

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.21 out of 32.93

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.41 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.72 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.78 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.71 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.75 out of 39.62

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.57 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.71 out of 30.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.88 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.25 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.25 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 444370 - 507570:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (Me-ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 444370 - 497991:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (Me-ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 458078 - 507570:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (Me-ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

VE62_RS22160: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (573..966): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSMLSGDIAMGGATEASIWSNA
Nearest Stachelhaus code(s):: Cys DLYNMSMIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

VE62_RS22165: mal

PKS_AT (552..842): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 132.8
Methoxymalonyl-CoA: 50.0
inactive: 45.6
Methylmalonyl-CoA: 44.0
Benzoyl-CoA: 42.7
Propionyl-CoA: 34.5
Isobutyryl-CoA: 31.1
fatty_acid: 25.6
Acetyl-CoA: 25.3
2-Methylbutyryl-CoA: 24.6
3-Methylbutyryl-CoA: 19.5
CHC-CoA: 16.3
trans-1,2-CPDA: 11.2
Ethylmalonyl-CoA: 7.1

VE62_RS22180: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (20..422): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFPLACPGGALQAGGAQQVFGMAEGLLCFTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVLCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
DasR	N-acetylglucosamine dependent repressor
FuR variant 1	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor
ZuR variant 2	Zinc-responsive repressor

NZ_JZOJ01000078.1 - Region 2 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 517,864 - 589,026 nt. (total: 71,163 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

VE62_RS22470: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

VE62_RS22480: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: PPTase acylase

VE62_RS22465: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

VE62_RS22505: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: amidase esterase hydrolase

VE62_RS22420: thioesterase

smcogs: SMCOG1004: thioesterase

VE62_RS22425: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

VE62_RS22445: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase synthase

VE62_RS22430: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

VE62_RS22435: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

VE62_RS22450: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

VE62_RS22455: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

VE62_RS22460: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

VE62_RS22485: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

VE62_RS22490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000972.5	1.39	NRPS, PKS	N-myristoyl-D-asparagine, cis-7-tetradecenoyl-D-asparagine, (R)-N1-((S)-5-oxohexan-2-yl)-2-tetradecanamidosuccinamide, colibactin, precolibactin 1489	Escherichia coli
BGC0002135.2	0.83	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.81	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.77	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000972.5	0.89	NRPS, PKS	N-myristoyl-D-asparagine, cis-7-tetradecenoyl-D-asparagine, (R)-N1-((S)-5-oxohexan-2-yl)-2-tetradecanamidosuccinamide, colibactin, precolibactin 1489	Escherichia coli
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.85 out of 25.88

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 28.09 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 28.57 out of 29.38

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.44 out of 20.97

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 28.19

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.30 out of 25.31

Confidence: medium

Additional weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.47 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.11 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.38 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.69 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.06 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 24.50 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.02 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.32 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 517863 - 589026:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - redmal) + (X) + (mal) + (Gly - Cys) + (Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

VE62_RS22435: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (453..844): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YFASFDLTITTAKLVVGGEYNEYGPTEATVGCMI
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

VE62_RS22450: Gly - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (507..894): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LDMTFDISFLELQALAGGEWNLYGPTETTIWSLK
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1555..1950): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDANALLSGDISLGGATECAIWSVY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

VE62_RS22455: mal

PKS_AT (531..813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 135.2
inactive: 78.0
Methoxymalonyl-CoA: 66.0
Methylmalonyl-CoA: 56.3
Isobutyryl-CoA: 28.5
Propionyl-CoA: 26.3
Ethylmalonyl-CoA: 20.5
2-Methylbutyryl-CoA: 14.2
Benzoyl-CoA: 11.6
trans-1,2-CPDA: 11.4
CHC-CoA: 9.8
3-Methylbutyryl-CoA: 6.9
fatty_acid: 0.0
Acetyl-CoA: 0.0

VE62_RS22460: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (24..422): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFSSGEINLYGPTEAAIDVSH
Nearest Stachelhaus code(s):: Ser DVWHFSLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (992..1384): X

nrpys: Sam

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSFTSASFVGEPSTLCGGEVNGYGLTESGICSTY
Nearest Stachelhaus code(s):: Sam ASGSLGGICK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

VE62_RS22465: mal

PKS_AT (7..296): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 57.2
Methoxymalonyl-CoA: 41.1
Methylmalonyl-CoA: 34.3
inactive: 30.1
Ethylmalonyl-CoA: 18.1
Propionyl-CoA: 16.0
Acetyl-CoA: 14.6
Benzoyl-CoA: 12.9
2-Methylbutyryl-CoA: 12.5
CHC-CoA: 9.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

VE62_RS22490: Ala - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (502..890): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LGDCFDVSVFESWFTVGGETNGYGPTENTIFTTA
Nearest Stachelhaus code(s):: Ala DVFWTGGIFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1604..1895): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 155.9
inactive: 95.9
Methoxymalonyl-CoA: 53.4
Methylmalonyl-CoA: 38.8
Propionyl-CoA: 26.7
Isobutyryl-CoA: 21.1
fatty_acid: 18.9
CHC-CoA: 16.9
2-Methylbutyryl-CoA: 11.0
Benzoyl-CoA: 10.3
Ethylmalonyl-CoA: 9.3
Acetyl-CoA: 8.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_JZOJ01000049.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 6,012 nt. (total: 6,012 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: Hydrolysis

VE62_RS28925: Hydrolysis

MITE: MITE0000056Hydrolysis (identity: 97.60%)

VE62_RS28930: Hydrolysis

MITE: MITE0000056Hydrolysis (identity: 99.00%)

Ligases: Macrolactam formation

VE62_RS06225: Macrolactam formation

MITE: MITE0000055Macrolactam formation (identity: 99.10%)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000581.6	0.89	ribosomal	microcin J25	Escherichia coli AY25
BGC0002312.2	0.69	ribosomal	ubonodin	Burkholderia ubonensis
BGC0002322.3	0.54	ribosomal	citrocin	Citrobacter pasteurii
BGC0001639.3	0.52	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002747.3	0.36	ribosomal	lentinulin A	Lentinula edodes
BGC0000322.3	0.31	NRPS	chloroeremomycin	Amycolatopsis orientalis
BGC0001801.5	0.26	NRPS	thiazostatin, watasemycin A, watasemycin B, 2-hydroxyphenylthiazoline enantiopyochelin, isopyochelin	Streptomyces venezuelae ATCC 10712
BGC0000347.5	0.24	NRPS	equibactin	Streptococcus equi subsp. equi
BGC0000125.5	0.24	PKS	pimaricin	Streptomyces natalensis
BGC0001709.5	0.23	PKS	nystatin	Streptomyces albulus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000581.6	0.89	ribosomal	microcin J25	Escherichia coli AY25
BGC0002312.2	0.69	ribosomal	ubonodin	Burkholderia ubonensis
BGC0002322.3	0.54	ribosomal	citrocin	Citrobacter pasteurii
BGC0001639.3	0.52	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002747.3	0.36	ribosomal	lentinulin A	Lentinula edodes
BGC0000322.3	0.31	NRPS	chloroeremomycin	Amycolatopsis orientalis
BGC0001801.5	0.26	NRPS	thiazostatin, watasemycin A, watasemycin B, 2-hydroxyphenylthiazoline enantiopyochelin, isopyochelin	Streptomyces venezuelae ATCC 10712
BGC0000347.5	0.24	NRPS	equibactin	Streptococcus equi subsp. equi
BGC0000125.5	0.24	PKS	pimaricin	Streptomyces natalensis
BGC0001709.5	0.23	PKS	nystatin	Streptomyces albulus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for VE62_RS06215

VE62_RS06215

Leader:

MIKHIHFDKLSSGKKNNVPHPAKGVIQIKKSASQLTK

Full core:

GGAGHVPEYFVGIGTPISFYG

Putative macrolactam:

GGAGHVPE

antiSMASH-DB 4.0 matches for VE62_RS06215

100.0%

NZ_AP021947.1and 16 others:

NZ_CAJGEM010000015.1 Lassopeptides: JMT87_RS21655_lassopeptideNZ_CAJGGU010000008.1 Lassopeptides: JMU20_RS21490_lassopeptideNZ_CP010127.1 Lassopeptides: RG30_RS26380_lassopeptideNZ_CP031107.1 Lassopeptides: DUT84_RS26055_lassopeptideNZ_CP074577.1 Lassopeptides: KHZ70_RS24010_lassopeptideNZ_CP091672.1 Lassopeptides: L6L68_RS00080_lassopeptideNZ_CP097722.1 Lassopeptides: M9O79_RS23190_lassopeptideNZ_CP117571.1 Lassopeptides: PS035_RS23020_lassopeptideNZ_CP117612.1 Lassopeptides: PS038_RS23585_lassopeptideNZ_CP117622.1 Lassopeptides: PS039_RS24320_lassopeptideNZ_FZFT01000070.1 Lassopeptides: CPG75_RS26760_lassopeptideNZ_JABMLY010000084.1 Lassopeptides: HRQ70_RS23615_lassopeptideNZ_JZNY01000005.1 Lassopeptides: VE51_RS00690_lassopeptideNZ_JZOJ01000049.1 Lassopeptides: VE62_RS06215_lassopeptideNZ_MRDN01000066.1 Lassopeptides: BSF34_RS29250_lassopeptideNZ_OW968329.1 Lassopeptides: LQ108_RS23255_lassopeptide

Lassopeptides: H7R07_RS25795_lassopeptide

1

GGAGHVPEYFVGIGTPISFYG

21

GGAGHVPEYFVGIGTPISFYG

1

GGAGHVPEYFVGIGTPISFYG

21

52.4%

NZ_CP016898.1:

Lassopeptides: BEN76_RS17395_lassopeptide

1

GGAGHVPEYFVGIGTPISFYG

21

GG G +PEYF+ +G +FYG

1

GGKGPLPEYFL-MGGGGNFYG

20

33.3%

NZ_CP077406.1:

Lassopeptides: I6L51_RS27045_lassopeptide

1

GGAGHVPEYFVG

12

GG G + EYF+G

1

GGVGKIIEYFIG

12

with 5 more sequence matches

30.8%

NZ_VYKJ01000032.1:

Lassopeptides: FJU30_RS26370_lassopeptide

1

GGAGHVPEYFVGIGTPIS

18

GG G +PEYF P

1

GGDGGIPEYFEHSNPPTD

18

28.6%

NZ_JADPRT010000002.1:

Lassopeptides: I2501_RS04910_lassopeptide

1

GGAGHVPEYFVGIG

14

GG G VP++F +

1

GGLGTVPDWFFNMN

14

28.6%

NZ_JAERJD010000009.1:

Lassopeptides: allorf_022741_022872_lassopeptide

1

GGAGHVPEYFV

11

GG G + EYF

1

GGGGQIVEYFT

11

22.2%

NZ_RBZW01000021.1:

Lassopeptides: D8Y22_RS22300_lassopeptide

6

VPEYFVGIGTPIS

18

V E +GTPI+

11

VTEATAAVGTPIT

23

21.9%

NZ_CP031746.1:

Lanthipeptides: allorf_1813979_1814164_lanthipeptide

1

GGAGHVPEYFVGIGTPISF

19

G A VP +G G P+++

6

GCARWVPCSLLGAGCPVTW

24

MIBiG 4.0 matches for VE62_RS06215

100.0%

BGC0000581.6 (AAD28494.1):

Lasso peptide: microcin J25

1

GGAGHVPEYFVGIGTPISFYG

21

GGAGHVPEYFVGIGTPISFYG

1

GGAGHVPEYFVGIGTPISFYG

21

33.3%

BGC0002322.3 (CEJ66604.1):

Lasso peptide: citrocin

1

GGAGHVPEYFVG

12

GG G + EYF+G

1

GGVGKIIEYFIG

12

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.44 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.32 out of 29.38

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

VE62_RS06215 - Class II: Cleavage pHMM score: 5.40; RODEO score: 20; Monoisotopic mass: 2106.0 Da; Molecular weight: 2107.3 Da; Number of bridges: 0

RRE predictions

: RRE type: Lasso_Fused_RRE; Location: 3 - 68; Score: 45.8

TFBS definitions

Regulator	Description