GCF_002188365.1 - 34 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_KZ195574.1 (Streptomyces sp. CS113)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	T1PKS,NRPS,NRP-metallophore,NRPS-like	1	85,413	Low	polyoxypeptin	NRPS:Type I+PKS
Region 1.2	other	154,025	194,912
Region 1.3	NRP-metallophore,NRPS	421,770	480,213	High	coelichelin	NRPS:Type I
Region 1.4	terpene-precursor	523,685	546,220
Region 1.5	RiPP-like	719,343	729,558	Low	informatipeptin	ribosomal:RiPP:Lanthipeptide
Region 1.6	T1PKS,PKS-like	821,869	869,586	High	Bisenarsan	PKS:Type I
Region 1.7	terpene	1,212,242	1,238,972	High	hopene	terpene
Region 1.8	lanthipeptide-class-iii	1,313,495	1,336,224	High	SapB	ribosomal:RiPP:Lanthipeptide
Region 1.9	terpene	1,669,637	1,697,914	High	isorenieratene	terpene
Region 1.10	hydrogen-cyanide	1,728,974	1,741,883	Low	aborycin	ribosomal:RiPP
Region 1.11	NI-siderophore	1,762,596	1,793,815
Region 1.12	indole	1,936,177	1,957,352	Medium	7-prenylisatin	other:other
Region 1.13	terpene	1,964,800	1,987,010	High	geosmin	terpene:Sesquiterpene
Region 1.14	RiPP-like	1,998,991	2,010,310
Region 1.15	NRPS-like,T1PKS,prodigiosin	2,184,663	2,237,684	High	undecylprodigiosin	NRPS:Type I+PKS
Region 1.16	NI-siderophore,T2PKS	2,306,850	2,391,112	High	hatomarubigin A/hatomarubigin B/hatomarubigin C/hatomarubigin D	PKS
Region 1.17	NRPS	2,712,239	2,774,200	Low	BD-12	NRPS:Type I
Region 1.18	T2PKS	2,866,764	2,939,306	Medium	spore pigment	PKS
Region 1.19	terpene-precursor	2,956,837	2,977,994	Low	echoside A/echoside B/echoside C/echoside D/echoside E	NRPS:Type I
Region 1.20	terpene	2,987,440	3,008,525	High	albaflavenone	terpene
Region 1.21	RRE-containing	3,109,311	3,130,369
Region 1.22	RRE-containing	3,152,187	3,173,425
Region 1.23	NI-siderophore	5,500,883	5,530,667	High	desferrioxamin B/desferrioxamine E	other:other
Region 1.24	melanin	5,614,827	5,625,426	High	melanin	other:other
Region 1.25	ectoine	6,631,530	6,641,928	High	ectoine	other:other
Region 1.26	T2PKS,PKS-like,oligosaccharide	7,043,694	7,116,158	High	antibiotic HKI 10311129/antibiotic A2121-1/cervimycin D/cervimycin C/cervimycin A	PKS+saccharide:hybrid/tailoring
Region 1.27	T3PKS	7,368,065	7,409,189	High	flaviolin/1,3,6,8-tetrahydroxynaphthalene	PKS
Region 1.28	NRP-metallophore,NRPS	7,645,862	7,694,304	High	paenibactin	NRPS:Type I
Region 1.29	terpene	7,883,104	7,904,702
Region 1.30	butyrolactone,T3PKS	7,953,137	8,002,626	High	germicidin	other:other
Region 1.31	terpene	8,136,754	8,171,950	Medium	isorenieratene	terpene
Region 1.32	indole	8,224,630	8,245,748	High	5-dimethylallylindole-3-acetonitrile	other:other
Region 1.33	t3nrps-iterative,NRP-metallophore,NRPS	8,486,545	8,561,200	High	coelibactin	NRPS:Type I
Region 1.34	hglE-KS,lanthipeptide-class-i	8,607,714	8,660,285

No secondary metabolite regions were found in these records:: NZ_KZ195575.1 (Streptomyces sp. CS113); NZ_KZ195576.1 (Streptomyces sp. CS113)

Compact view

NZ_KZ195574.1 - Region 1 - NRP-metallophore,NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 85,413 nt. (total: 85,413 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B9W62_RS00030: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

B9W62_RS00075: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

B9W62_RS00110: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B9W62_RS00125: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS00185: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B9W62_RS00230: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase acylase halogenase

B9W62_RS00050: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B9W62_RS00095: halogenase

smcogs: SMCOG1119: halogenase

B9W62_RS00210: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: esterase

B9W62_RS00020: thioesterase

smcogs: SMCOG1004: thioesterase

B9W62_RS00070: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

B9W62_RS00005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W62_RS00025: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W62_RS00035: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B9W62_RS00040: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W62_RS00045: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B9W62_RS00080: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W62_RS00085: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W62_RS00090: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W62_RS00130: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.99	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	1.92	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	1.92	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.92	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.90	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	1.88	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	1.83	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001273.3	1.82	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	1.80	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	1.80	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.19 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.18 out of 27.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.37 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.57 out of 26.12

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.81 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.00 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 85413:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (D-X - Ser) + (D-Gly - Leu) + (Gly) + (Me-mal) + (Me-ccmal) + (redmal) + (Me-mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 47242:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - Ser) + (D-Gly - Leu) + (Gly) + (Me-mal) + (Me-ccmal) + (redmal) + (Me-mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 0 - 26987:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Me-ccmal) + (redmal) + (Me-mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 14358 - 75875:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (D-X - Ser) + (D-Gly - Leu) + (Gly) + (Me-mal) + (Me-ccmal) + (redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 42704 - 85413:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (D-X - Ser) + (D-Gly - Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B9W62_RS00005: X

AMP-binding (23..281): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NETLHDMMLFGLAA--------------------
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

B9W62_RS00025: X

AMP-binding (485..875): X

nrpys: 3OH-Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDRTHDVLPLEAWLWTGGEVVGHGPTETTVLAAG
Nearest Stachelhaus code(s):: 3OH-Leu DALWWGGVLK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

B9W62_RS00035: mmal

PKS_AT (576..873): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 205.0
Ethylmalonyl-CoA: 196.8
Methoxymalonyl-CoA: 169.8
2-Methylbutyryl-CoA: 153.7
trans-1,2-CPDA: 118.6
Propionyl-CoA: 118.3
CHC-CoA: 113.5
Malonyl-CoA: 110.4
Isobutyryl-CoA: 95.5
Benzoyl-CoA: 72.9
fatty_acid: 45.1
3-Methylbutyryl-CoA: 42.2
Acetyl-CoA: 40.9
inactive: 35.4

B9W62_RS00040: mal

PKS_AT (573..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 66.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 146.1
Methylmalonyl-CoA: 76.0
Methoxymalonyl-CoA: 66.4
inactive: 56.2
Ethylmalonyl-CoA: 45.8
Propionyl-CoA: 36.7
2-Methylbutyryl-CoA: 26.4
trans-1,2-CPDA: 23.4
CHC-CoA: 22.1
Benzoyl-CoA: 14.8
Isobutyryl-CoA: 13.7
Acetyl-CoA: 9.4
fatty_acid: 8.7
3-Methylbutyryl-CoA: 0.0

B9W62_RS00045: mmal

PKS_AT (542..842): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 172.5
Ethylmalonyl-CoA: 168.4
Methoxymalonyl-CoA: 147.1
2-Methylbutyryl-CoA: 106.7
trans-1,2-CPDA: 88.7
Propionyl-CoA: 88.1
Malonyl-CoA: 81.5
CHC-CoA: 79.3
Isobutyryl-CoA: 67.8
Benzoyl-CoA: 39.9
inactive: 39.5
Acetyl-CoA: 31.8
3-Methylbutyryl-CoA: 27.6
fatty_acid: 26.0

B9W62_RS00050: mmal

PKS_AT (539..835): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 182.6
Ethylmalonyl-CoA: 180.9
Methoxymalonyl-CoA: 150.4
2-Methylbutyryl-CoA: 103.2
trans-1,2-CPDA: 96.4
Malonyl-CoA: 86.6
CHC-CoA: 81.7
Propionyl-CoA: 79.7
Isobutyryl-CoA: 53.2
Benzoyl-CoA: 36.8
Acetyl-CoA: 29.2
inactive: 28.1
3-Methylbutyryl-CoA: 23.7
fatty_acid: 19.4

B9W62_RS00080: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (467..841): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAVTFDMANTELQAVVGGEGNWYGPTETTVWSTT
Nearest Stachelhaus code(s):: Ala DMTQIGWTWK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

B9W62_RS00085: Gly - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (466..840): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAATFDIAALELQAVVGGEGNWYGPTETTVWSTT
Nearest Stachelhaus code(s):: Gly DILQLGMVWK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1985..2375): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GRLTFDVSAFETSTVFAGEVNAYGQSESFYATTH
Nearest Stachelhaus code(s):: Leu DVFSVAAYAK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W62_RS00090: X - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (465..863): X

nrpys: Piz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GELTFDVSVFESSGVFAGDVNSYGQSESFYATMF
Nearest Stachelhaus code(s):: Piz DVFSVASYAK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2022..2403): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEHNLYGPTEAAVDVTH
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match); Ala or Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W62_RS00130: X

AMP-binding (323..721): X

nrpys: Piz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMFGITETTVHVTA
Nearest Stachelhaus code(s):: Piz DFWNVGMVHK (100% 8Å match); Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 2 - other

Download region GenBank file

Download region SVG

Location: 154,025 - 194,912 nt. (total: 40,888 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

B9W62_RS00560: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

B9W62_RS00610: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000523.3	0.41	ribosomal	lactocin S	Lactobacillus sakei
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000597.4	0.40	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001210.5	0.39	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002635.2	0.39	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001887.3	0.39	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0000487.5	0.39	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000523.3	0.41	ribosomal	lactocin S	Lactobacillus sakei
BGC0001660.3	0.40	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000597.4	0.40	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001210.5	0.39	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002635.2	0.39	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001887.3	0.39	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0000487.5	0.39	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.29 out of 23.79

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.18 out of 27.55

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.26 out of 24.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

Additional weak hits (10):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.54 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.27 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.89 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.67 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.45 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.33 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.62 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 3 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 421,770 - 480,213 nt. (total: 58,444 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B9W62_RS01730: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

B9W62_RS01775: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS01795: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: formyltransferase kinase

B9W62_RS01735: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

B9W62_RS01785: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: esterase

B9W62_RS01690: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Ligases: ligase

B9W62_RS01700: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	1.17	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.69	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.58	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.57	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.56	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	0.83	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.67	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 35.53 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.30 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.02 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.54 out of 23.79

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

Additional weak hits (20):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.65 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.02 out of 27.04

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.84 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.39 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.24 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.07 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.79 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.63 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.57 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.74 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.65 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 421769 - 480213:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B9W62_RS01700: Fo-OH-Orn - Thr - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (150..548): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISINELYLWCGGEYHGYGPAETTIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1633..2047): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTHFDFAVWEGNQIFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3084..3486): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C

NZ_KZ195574.1 - Region 4 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 523,685 - 546,220 nt. (total: 22,536 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

B9W62_RS02070: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Ligases: synthetase

B9W62_RS02045: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

B9W62_RS02055: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.42	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.40	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001456.3	0.38	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.37	terpene	carotenoid	Dietzia sp. CQ4
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.37	terpene	carotenoid	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.42	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.40	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001456.3	0.38	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.37	terpene	carotenoid	Dietzia sp. CQ4
BGC0001227.3	0.37	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.37	terpene	carotenoid	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

B9W62_RS02045: PT_FPPS_like

Domain 1 (48 - 346): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

B9W62_RS02055: PT_FPPS_like

Domain 1 (49 - 333): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (1):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 5 - RiPP-like

Download region GenBank file

Download region SVG

Location: 719,343 - 729,558 nt. (total: 10,216 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.46	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.42	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000617.5	0.38	ribosomal	coagulin	Bacillus coagulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.46	ribosomal	microcin L	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.42	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000617.5	0.38	ribosomal	coagulin	Bacillus coagulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (3):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.56 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_KZ195574.1 - Region 6 - PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 821,869 - 869,586 nt. (total: 47,718 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxidase oxidoreductase

B9W62_RS03535: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

B9W62_RS03565: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS03590: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

B9W62_RS03610: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: kinase

B9W62_RS03480: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Isomerases: racemase

B9W62_RS03510: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase

B9W62_RS03575: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B9W62_RS03580: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transporter

B9W62_RS03525: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001283.3	1.33	PKS	Bisenarsan	Streptomyces lividans 1326
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001283.3	0.87	PKS	Bisenarsan	Streptomyces lividans 1326
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.40 out of 20.97

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.75 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.01 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.06 out of 27.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.42 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.91 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.03 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.05 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.62 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 821868 - 869586:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 821868 - 868519:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 828545 - 869586:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B9W62_RS03575: mmal

PKS_AT (548..845): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Propionyl-CoA: 79.2%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 166.7
Ethylmalonyl-CoA: 154.9
Methoxymalonyl-CoA: 140.3
2-Methylbutyryl-CoA: 115.3
Malonyl-CoA: 103.8
trans-1,2-CPDA: 100.6
Propionyl-CoA: 87.4
Isobutyryl-CoA: 87.2
Benzoyl-CoA: 86.9
CHC-CoA: 67.0
Acetyl-CoA: 56.3
inactive: 41.4
3-Methylbutyryl-CoA: 41.4
fatty_acid: 21.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A

NZ_KZ195574.1 - Region 7 - terpene

Download region GenBank file

Download region SVG

Location: 1,212,242 - 1,238,972 nt. (total: 26,731 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W62_RS05295: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B9W62_RS05335: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

B9W62_RS05260: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B9W62_RS05340: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthase synthetase

B9W62_RS05265: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

B9W62_RS05290: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.90	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000664.5	0.50	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.90	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000664.5	0.50	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

B9W62_RS05285: T2TS

Domain 1 (33 - 658): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

B9W62_RS05290: PT_FPPS_like

Domain 1 (60 - 353): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

B9W62_RS05305: PT_phytoene_like

Domain 1 (17 - 309): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

B9W62_RS05310: PT_phytoene_like

Domain 1 (19 - 280): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

Additional weak hits (16):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.46 out of 29.51

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.29 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.49 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.23 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.68 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.27 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.49 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.55 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.06 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_KZ195574.1 - Region 8 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 1,313,495 - 1,336,224 nt. (total: 22,730 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase

B9W62_RS05755: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.91	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.53	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.91	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.53	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for B9W62_RS05700

B9W62_RS05695

Leader:

MNLFDLQSMETPKEEAMGDVE

Core:

TGSRASLLLCGDSSLSITTCN

Core with dehydrations:

DhbGDhaRADhaLLLCysGDDhaDhaLDhaIDhbDhbCysN

antiSMASH-DB 4.0 matches for B9W62_RS05695

100.0%

NZ_BBOK01000011.1and 23 others:

NZ_BEWD01000001.1 Lanthipeptides: Sru02f_RS01660_lanthipeptideNZ_BMSL01000016.1 Lanthipeptides: IE215_RS23330_lanthipeptideNZ_BMUC01000023.1 Lanthipeptides: IE172_RS32210_lanthipeptideNZ_BMVQ01000005.1 Lanthipeptides: IE283_RS17035_lanthipeptideNZ_BMWI01000025.1 Lanthipeptides: IE253_RS33945_lanthipeptideNZ_CP012382.1 Lanthipeptides: SAM23877_RS30085_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS29010_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS34495_lanthipeptideNZ_CP043959.1 Lanthipeptides: F3L20_RS19105_lanthipeptideNZ_CP045547.1 Lanthipeptides: GEV49_RS05730_lanthipeptideNZ_CP054939.1 Lanthipeptides: HUT14_RS29815_lanthipeptideNZ_CP094918.1 Lanthipeptides: MTR79_RS16715_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS05020_lanthipeptideNZ_JAAIFS010000001.1 Lanthipeptides: GUR47_RS02255_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS05695_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS34110_lanthipeptideNZ_MQUH01000025.1 Lanthipeptides: BSZ07_RS33280_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS10360_lanthipeptideNZ_RSEG01000006.1 Lanthipeptides: EIA57_RS12710_lanthipeptideNZ_SOAV01000001.1 Lanthipeptides: EV562_RS04520_lanthipeptideNZ_VIUV01000020.1 Lanthipeptides: FB570_RS34060_lanthipeptideNZ_WHZR01000001.1 Lanthipeptides: STPH1_RS04005_lanthipeptideNZ_WXVT01000001.1 Lanthipeptides: STPH2_RS03995_lanthipeptide

Lanthipeptides: APK71_RS25550_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

TGSRASLLLCGDSSLSITTCN

1

TGSRASLLLCGDSSLSITTCN

21

95.2%

NC_018750.1and 67 others:

NC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNZ_BBNO01000003.1 Lanthipeptides: TU31_RS37940_lanthipeptideNZ_BMTO01000007.1 Lanthipeptides: IE136_RS15615_lanthipeptideNZ_BMUN01000001.1 Lanthipeptides: IE238_RS00740_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS05015_lanthipeptideNZ_CP015866.1 Lanthipeptides: Spa2297_RS27800_lanthipeptideNZ_CP017157.1 Lanthipeptides: SL103_RS15895_lanthipeptideNZ_CP019457.1 Lanthipeptides: BXT88_RS03410_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS35355_lanthipeptideNZ_CP019779.1 Lanthipeptides: STRMOE7_RS03775_lanthipeptideNZ_CP023691.1 Lanthipeptides: CP981_RS03050_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS04700_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34970_lanthipeptideNZ_CP029042.1 Lanthipeptides: DDE74_RS03525_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029541.1 Lanthipeptides: DKG71_RS05245_lanthipeptideNZ_CP034353.1 Lanthipeptides: D1J63_RS04900_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35250_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS09720_lanthipeptideNZ_CP046905.1 Lanthipeptides: GPZ77_RS32930_lanthipeptideNZ_CP047140.1 Lanthipeptides: GLX30_RS11420_lanthipeptideNZ_CP050976.1 Lanthipeptides: HEP86_RS04470_lanthipeptideNZ_CP054920.1 Lanthipeptides: HUT15_RS04615_lanthipeptideNZ_CP060825.1 Lanthipeptides: IAG43_RS32355_lanthipeptideNZ_CP074111.1 Lanthipeptides: KE639_RS31630_lanthipeptideNZ_CP084681.1 Lanthipeptides: KI385_RS00885_lanthipeptideNZ_CP085300.1 Lanthipeptides: LJA35_RS05220_lanthipeptideNZ_CP086217.1 Lanthipeptides: LJ741_RS03435_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS09690_lanthipeptideNZ_CP098437.1 Lanthipeptides: NCG97_RS34740_lanthipeptideNZ_CP099468.1 Lanthipeptides: NFX46_RS16770_lanthipeptideNZ_CP101137.1 Lanthipeptides: M6G08_RS24535_lanthipeptideNZ_CP102609.1 Lanthipeptides: NUT86_RS03980_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33560_lanthipeptideNZ_CP114202.1 Lanthipeptides: STRLI_RS35870_lanthipeptideNZ_CP114203.1 Lanthipeptides: STRNI_RS37360_lanthipeptideNZ_CP114205.1 Lanthipeptides: STRTU_RS33380_lanthipeptideNZ_JACHJE010000006.1 Lanthipeptides: FHS32_RS15850_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00800_lanthipeptideNZ_JAFEJA010000002.1 Lanthipeptides: JE024_RS34830_lanthipeptideNZ_JAGPYC010000033.1 Lanthipeptides: KBZ00_RS31440_lanthipeptideNZ_JAHLXF010000022.1 Lanthipeptides: KQY13_RS30555_lanthipeptideNZ_JAIHBQ010000001.1 Lanthipeptides: K4902_RS04515_lanthipeptideNZ_JAJJMU010000026.1 Lanthipeptides: LOC25_RS31275_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAPKNL010000004.1 Lanthipeptides: OSI21_RS07750_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0131905_lanthipeptideNZ_KN039948.1 Lanthipeptides: FM21_RS29525_lanthipeptideNZ_LIPF01000004.1 Lanthipeptides: AMK11_RS16660_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVX01000004.1 Lanthipeptides: AMK29_RS15650_lanthipeptideNZ_LIWB01000010.1 Lanthipeptides: AMK33_RS24360_lanthipeptideNZ_MPOH02000012.1 Lanthipeptides: BM536_RS17150_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_RAIF01000032.1 Lanthipeptides: EBH09_RS35480_lanthipeptideNZ_SOPG01000008.1 Lanthipeptides: E0I08_RS17090_lanthipeptide

Lanthipeptides: SVEN_RS32110_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

TGSRASLLLCGDSSLS+TTCN

1

TGSRASLLLCGDSSLSVTTCN

21

95.2%

NZ_GG657758.1and 1 other:

NZ_JACHEM010000005.1 Lanthipeptides: HNQ79_RS11445_lanthipeptide

Lanthipeptides: SSRG_RS03855_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

+GSRASLLLCGDSSLSITTCN

1

SGSRASLLLCGDSSLSITTCN

21

with 71 more sequence matches

Only the first 10 are displayed here.

90.5%

NZ_BMSV01000002.1and 18 others:

NZ_BMTP01000009.1 Lanthipeptides: IE109_RS18470_lanthipeptideNZ_CP007699.2 Lanthipeptides: T261_RS39185_lanthipeptideNZ_CP020042.1 Lanthipeptides: B4U46_RS32710_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS23100_lanthipeptideNZ_CP023692.1 Lanthipeptides: CP980_RS04735_lanthipeptideNZ_CP028158.1 Lanthipeptides: C6361_RS04660_lanthipeptideNZ_CP028159.1 Lanthipeptides: C6W10_RS01185_lanthipeptideNZ_CP034279.1 Lanthipeptides: EIZ62_RS28660_lanthipeptideNZ_CP102332.1 Lanthipeptides: NRO40_RS01140_lanthipeptideNZ_FNHI01000003.1 Lanthipeptides: BLT82_RS06465_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09875_lanthipeptideNZ_JAGGOI010000031.1 Lanthipeptides: J7E87_RS22160_lanthipeptideNZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10785_lanthipeptideNZ_JAPNLM010000003.1 Lanthipeptides: OTB16_RS07305_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIYH01000004.1 Lanthipeptides: AMK26_RS17765_lanthipeptideNZ_NBCN01000003.1 Lanthipeptides: BKD26_RS06570_lanthipeptide

Lanthipeptides: IE106_RS06150_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GSRASLLLCGDSSLS+TTCN

1

GSRASLLLCGDSSLSVTTCN

20

90.5%

NZ_BMTU01000009.1and 1 other:

NZ_JACHJI010000005.1 Lanthipeptides: FHS37_RS15430_lanthipeptide

Lanthipeptides: IE118_RS22890_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

+GSRASLLLCGDSSLS+TTCN

1

SGSRASLLLCGDSSLSVTTCN

21

90.5%

NZ_BNCA01000002.1and 1 other:

NZ_CP049782.1 Lanthipeptides: G7Z12_RS34445_lanthipeptide

Lanthipeptides: IE314_RS02760_lanthipeptide

1

TGSRASLLLCGDSSLSITTCN

21

TGSRASLLLCGDSSLS++TCN

1

TGSRASLLLCGDSSLSVSTCN

21

85.7%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS17975_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GS ASLLLCGDSSLS+TTCN

2

GSEASLLLCGDSSLSLTTCN

21

85.7%

NZ_CP048835.1:

Lanthipeptides: C8250_RS00390_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GSRASLLLCG+SSLS+TTCN

2

GSRASLLLCGNSSLSVTTCN

21

85.7%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GS+ASLLLCGDSSLS+TTCN

2

GSQASLLLCGDSSLSVTTCN

21

83.3%

NZ_BMVE01000003.1and 22 others:

NZ_BMVL01000005.1 Lanthipeptides: IE257_RS16230_lanthipeptideNZ_CM002280.1 Lanthipeptides: M877_RS44575_lanthipeptideNZ_CP011664.1 Lanthipeptides: M444_RS30240_lanthipeptideNZ_CP018047.1 Lanthipeptides: BBN63_RS03065_lanthipeptideNZ_CP020039.1 Lanthipeptides: B4U39_RS34445_lanthipeptideNZ_CP020555.1 Lanthipeptides: B6R96_RS03515_lanthipeptideNZ_CP023701.1 Lanthipeptides: CP968_RS29065_lanthipeptideNZ_CP029189.1 Lanthipeptides: DEJ51_RS31910_lanthipeptideNZ_CP030286.1 Lanthipeptides: DRB89_RS16930_lanthipeptideNZ_CP033581.1 Lanthipeptides: EES41_RS31595_lanthipeptideNZ_CP034350.1 Lanthipeptides: D1J60_RS32970_lanthipeptideNZ_CP043638.1 Lanthipeptides: F1D59_RS34930_lanthipeptideNZ_CP048397.1 Lanthipeptides: SSPS47_RS31455_lanthipeptideNZ_CP115936.1 Lanthipeptides: PET44_RS28650_lanthipeptideNZ_CP116355.1 Lanthipeptides: KPP03845_RS32700_lanthipeptideNZ_JAFLQY010000003.1 Lanthipeptides: J0X20_RS29030_lanthipeptideNZ_JAINUL010000001.1 Lanthipeptides: K7B10_RS06210_lanthipeptideNZ_JANAVF010000017.1 Lanthipeptides: NLX94_RS31205_lanthipeptideNZ_LIVP01000027.1 Lanthipeptides: AMK15_RS28680_lanthipeptideNZ_LWLD01000038.1 Lanthipeptides: A6A28_RS28600_lanthipeptideNZ_ML123038.1 Lanthipeptides: EES37_RS30340_lanthipeptideNZ_NNBM01000002.1 Lanthipeptides: CG724_RS07855_lanthipeptide

Lanthipeptides: IE248_RS10435_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

GSRASLLLCGDSSLSITTCN

5

GSRASLLLCGDSSLSITTCN

24

81.0%

NZ_CP024087.1and 1 other:

NZ_JAAALO010000001.1 Lanthipeptides: GVV04_RS02250_lanthipeptide

Lanthipeptides: CSH63_RS05810_lanthipeptide

5

ASLLLCGDSSLSITTCN

21

ASLLLCGDSSLSITTCN

1

ASLLLCGDSSLSITTCN

17

81.0%

NZ_CP077658.1:

Lanthipeptides: KQY30_RS33045_lanthipeptide

2

GSRASLLLCGDSSLSITTCN

21

SRASLLLCGDSSLS+ TCN

1

ASRASLLLCGDSSLSVVTCN

20

81.0%

NZ_CP092183.1:

Lanthipeptides: COUCH_RS09775_lanthipeptide

4

RASLLLCGDSSLSITTCN

21

RASLLLCGDSSLS+TTCN

1

RASLLLCGDSSLSVTTCN

18

MIBiG 4.0 matches for B9W62_RS05695

54.5%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

TGSRASLLLCGDSSLSITTCN

21

TGS+ SLL+C SSLS+ C

1

TGSQVSLLVCEYSSLSVVLCT

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.66 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.10 out of 20.01

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.41 out of 33.14

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

B9W62_RS05695 - Class III

Cleavage pHMM score: 32.20

RODEO score: 0

Monoisotopic mass: 1954.0 Da

Molecular weight: 1955.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1973.2 Da N = 1; 1991.2 Da N = 2; 2009.2 Da N = 3; 2027.3 Da N = 4; 2045.3 Da N = 5; 2063.3 Da N = 6

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 9 - terpene

Download region GenBank file

Download region SVG

Location: 1,669,637 - 1,697,914 nt. (total: 28,278 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W62_RS07210: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B9W62_RS07240: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B9W62_RS07275: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

B9W62_RS07230: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

B9W62_RS07205: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.82	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.74	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.71	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.71	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.82	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.74	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.71	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.71	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

B9W62_RS07205: PT_FPPS_like

Domain 1 (62 - 348): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

B9W62_RS07215: PT_phytoene_like

Domain 1 (16 - 315): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

B9W62_RS07235: Lycopene_cycl

Domain 1 (10 - 384): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.40 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.87 out of 20.01

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_KZ195574.1 - Region 10 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 1,728,974 - 1,741,883 nt. (total: 12,910 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

B9W62_RS07485: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

B9W62_RS07495: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000617.5	0.42	ribosomal	coagulin	Bacillus coagulans
BGC0000571.3	0.41	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001552.3	0.41	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001551.4	0.41	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001549.3	0.40	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0002579.2	0.40	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000619.3	0.39	ribosomal	gassericin T	Lactobacillus gasseri
BGC0001388.3	0.39	ribosomal	gassericin E	Lactobacillus gasseri
BGC0001602.3	0.39	ribosomal	gassericin-T	Lactobacillus gasseri

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000617.5	0.42	ribosomal	coagulin	Bacillus coagulans
BGC0000571.3	0.41	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001552.3	0.41	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001551.4	0.41	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001549.3	0.40	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0002579.2	0.40	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000619.3	0.39	ribosomal	gassericin T	Lactobacillus gasseri
BGC0001388.3	0.39	ribosomal	gassericin E	Lactobacillus gasseri
BGC0001602.3	0.39	ribosomal	gassericin-T	Lactobacillus gasseri

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.56 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.35 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.47 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 11 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1,762,596 - 1,793,815 nt. (total: 31,220 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

B9W62_RS07705: aminotransferase

smcogs: SMCOG1019: aminotransferase

Isomerases: mutase

B9W62_RS07715: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Translocases: transporter

B9W62_RS07660: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000295.5	0.49	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001513.3	0.43	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001948.3	0.43	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002387.2	0.41	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000947.5	0.40	other (other)	vibrioferrin	Vibrio alginolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.49	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000295.5	0.49	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001513.3	0.43	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001948.3	0.43	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002387.2	0.41	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000947.5	0.40	other (other)	vibrioferrin	Vibrio alginolyticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.49 out of 27.04

Confidence: medium

Additional weak hits (9):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.67 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.11 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.19 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.85 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_KZ195574.1 - Region 12 - indole

Download region GenBank file

Download region SVG

Location: 1,936,177 - 1,957,352 nt. (total: 21,176 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

B9W62_RS08490: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: back translocase

B9W62_RS08430: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Translocases: transport transporter

B9W62_RS08485: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

B9W62_RS08500: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.75	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001483.4	0.48	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002128.3	0.43	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002285.2	0.43	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002643.2	0.42	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002049.3	0.39	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0001364.3	0.39	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002284.3	0.39	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000772.5	0.39	saccharide	lipopolysaccharide	Brucella melitensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.75	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001483.4	0.48	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002128.3	0.43	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002285.2	0.43	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002643.2	0.42	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002049.3	0.39	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0001364.3	0.39	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002284.3	0.39	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000772.5	0.39	saccharide	lipopolysaccharide	Brucella melitensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.98 out of 20.97

Confidence: medium

Additional weak hits (2):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A

NZ_KZ195574.1 - Region 13 - terpene

Download region GenBank file

Download region SVG

Location: 1,964,800 - 1,987,010 nt. (total: 22,211 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucanase peptidase

B9W62_RS08550: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

B9W62_RS08560: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: cyclase

B9W62_RS08575: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.90	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000849.4	0.46	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000850.5	0.41	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001285.5	0.36	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0000937.5	0.35	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001840.2	0.34	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.90	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000849.4	0.46	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001197.5	0.45	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000850.5	0.41	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001285.5	0.36	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0000937.5	0.35	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001840.2	0.34	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

B9W62_RS08575: T1TS + T1TS

Domain 1 (1 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (327 - 695): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.08 out of 25.31

Confidence: medium

Additional weak hits (8):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.84 out of 36.53

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.42 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.44 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.22 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.14 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_KZ195574.1 - Region 14 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,998,991 - 2,010,310 nt. (total: 11,320 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

B9W62_RS08690: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000498.5	0.33	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.33	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000351.5	0.32	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000565.5	0.31	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0002303.3	0.30	ribosomal	pristinin A3	Streptomyces pristinaespiralis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000498.5	0.33	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.33	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000351.5	0.32	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000565.5	0.31	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0002303.3	0.30	ribosomal	pristinin A3	Streptomyces pristinaespiralis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.16 out of 26.85

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.08 out of 19.26

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.38 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KZ195574.1 - Region 15 - NRPS-like,T1PKS,prodigiosin

Download region GenBank file

Download region SVG

Location: 2,184,663 - 2,237,684 nt. (total: 53,022 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
prodigiosin: (PPDK_N and AMP-binding and PP-binding and PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W62_RS09555: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase acyltransferase methyltransferase

B9W62_RS09455: acyltransferase

smcogs: SMCOG1141: acyltransferase

B9W62_RS09475: methyltransferase

smcogs: SMCOG1089: methyltransferase

B9W62_RS09535: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase

B9W62_RS09480: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

B9W62_RS09485: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

B9W62_RS09490: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W62_RS09495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W62_RS09500: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

B9W62_RS09510: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B9W62_RS09520: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W62_RS09560: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

B9W62_RS09450: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001063.5	2.10	NRPS, PKS	undecylprodigiosin	Streptomyces coelicolor A3(2)
BGC0000091.5	1.25	PKS	marineosin A, marineosin B	Streptomyces sp. CNQ-617
BGC0002090.3	1.17	NRPS, PKS	undecylprodigiosin, metacycloprodigiosin	Streptomyces griseoaurantiacus
BGC0001164.3	1.12	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.12	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.92	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.90	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.90	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.90	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.89	PKS	YWA1	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001063.5	0.89	NRPS, PKS	undecylprodigiosin	Streptomyces coelicolor A3(2)
BGC0000091.5	0.73	PKS	marineosin A, marineosin B	Streptomyces sp. CNQ-617
BGC0002090.3	0.71	NRPS, PKS	undecylprodigiosin, metacycloprodigiosin	Streptomyces griseoaurantiacus
BGC0001164.3	0.70	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.70	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.00 out of 29.72

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.20 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 21, location 2184662 - 2237684:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B9W62_RS09490: NH2 - mal

CAL_domain (51..499): NH2

minowa: NH2

Prediction, score:

NH2: 111.7
fatty_acid: 35.5
shikimic_acid: 0.0
AHBA: 0.0
Acetyl-CoA: -1.6

PKS_AT (1321..1625): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 158.2
inactive: 103.7
Methoxymalonyl-CoA: 77.6
Methylmalonyl-CoA: 73.3
Ethylmalonyl-CoA: 43.6
Propionyl-CoA: 33.9
Isobutyryl-CoA: 33.1
CHC-CoA: 24.2
Benzoyl-CoA: 24.2
2-Methylbutyryl-CoA: 24.0
trans-1,2-CPDA: 23.0
Acetyl-CoA: 16.6
3-Methylbutyryl-CoA: 13.9
fatty_acid: 10.5

B9W62_RS09495: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (15..427): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLSTFDTYSLFAGEYNLYGPTETNVCTYH
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 16 - NI-siderophore,T2PKS

Download region GenBank file

Download region SVG

Location: 2,306,850 - 2,391,112 nt. (total: 84,263 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC
T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

B9W62_RS09935: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

B9W62_RS09985: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

B9W62_RS10025: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

B9W62_RS10035: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

B9W62_RS10050: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS10060: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS10065: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

B9W62_RS10085: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS10090: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

B9W62_RS10095: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

B9W62_RS10110: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS10175: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W62_RS10185: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase aminotransferase carboxylase kinase methyltransferase transferase

B9W62_RS09980: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B9W62_RS10005: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

B9W62_RS10075: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

B9W62_RS10100: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

B9W62_RS10135: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

B9W62_RS10155: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: hydrolase

B9W62_RS09945: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

B9W62_RS10105: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

B9W62_RS10130: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Isomerases: mutase

B9W62_RS09930: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

B9W62_RS10120: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B9W62_RS10125: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.59	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002469.2	0.42	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002047.2	0.37	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002683.2	0.37	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.37	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002499.2	0.36	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus
BGC0001366.5	0.35	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0001895.4	0.34	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0002470.2	0.34	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.84	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.83	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000272.3	0.60	PKS	spore pigment	Streptomyces collinus
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002047.2	0.58	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0001513.3	0.56	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0002504.2	0.56	PKS	nocardiopsistin A, nocardiopsistin B, nocardiopsistin C	Nocardiopsis sp.
BGC0000217.5	0.56	PKS	daunorubicin	Streptomyces sp.
BGC0000218.5	0.55	PKS	doxorubicin	Streptomyces peucetius
BGC0001197.5	0.55	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.70 out of 20.97

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.90 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 26.06 out of 27.18

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (16):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.28 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.25 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.53 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.68 out of 20.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.58 out of 26.12

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.89 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.21 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.87 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.79 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.45 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 2318620 to 2391112
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 710.6; E-value: 1.1e-216)
Product class(es):: angucycline
Product molecular weight(s):: acetyl-CoA_8: 390 Da
acetyl-CoA_9: 432 Da

B9W62_RS09985: KR (Score: 44.4; E-value: 3.8e-14)
B9W62_RS10025: DIMER (Score: 297.1; E-value: 2.8e-91)
B9W62_RS10045: KR (Score: 36.6; E-value: 8.8e-12)
B9W62_RS10050: KR (Score: 120.2; E-value: 2.9e-37)
B9W62_RS10060: KR C15 (Score: 384.0; E-value: 6.9e-118)
B9W62_RS10075: MET (Score: 280.3; E-value: 5e-86)
B9W62_RS10085: KR (Score: 150.1; E-value: 2.1e-46)
B9W62_RS10090: OXY (Score: 538.6; E-value: 3.4e-164)
B9W62_RS10095: OXY (Score: 554.5; E-value: 5e-169)
B9W62_RS10105: CYC C7-C12 (Score: 506.2; E-value: 6e-155)
B9W62_RS10110: KR C9 (Score: 484.7; E-value: 1.4e-148)
B9W62_RS10115: ACP (Score: 126.2; E-value: 9.1e-40)
B9W62_RS10120: CLF 8|9 (Score: 710.6; E-value: 1.1e-216)
B9W62_RS10125: KS (Score: 779.1; E-value: 2.2e-237)
B9W62_RS10130: CYC C4-C17/C2-C19 (Score: 198.5; E-value: 2.4e-61)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 17 - NRPS

Download region GenBank file

Download region SVG

Location: 2,712,239 - 2,774,200 nt. (total: 61,962 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B9W62_RS11710: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS11720: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

B9W62_RS11725: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: carbamoyltransferase

B9W62_RS11760: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: deaminase esterase

B9W62_RS11715: thioesterase

smcogs: SMCOG1004: thioesterase

B9W62_RS11750: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: hydratase

B9W62_RS11845: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

B9W62_RS11730: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B9W62_RS11740: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W62_RS11745: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

B9W62_RS11755: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W62_RS11785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W62_RS11790: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.71	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.74	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.71	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

Additional weak hits (12):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.14 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.30 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.89 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.81 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.86 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.06 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.14 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.68 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.67 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 25, location 2712238 - 2774200:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (X - X - X - Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B9W62_RS11755: X - X

AMP-binding (9..406): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWTTFDAAALEAQGFSAGEWNTYGPTECSVDVTA
Nearest Stachelhaus code(s):: Arg DALFFGLVDK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1057..1447): X

nrpys: D-Ala, Asn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLVVPNAKLVVAGELNEYGPTETTVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (74% 8Å match); Asn DLTKVGEVGK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

B9W62_RS11785: X - X - X

AMP-binding (518..928): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDMSVWEGNQSFGGEANLYGITETCVHTTF
Nearest Stachelhaus code(s):: Ser DMWNTGLVHK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1591..1980): X

nrpys: D-Ala, Asn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLVVPNAKLVVAGELNEYGPTETTVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (74% 8Å match); Asn DLTKVGEVGK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2624..3014): X

nrpys: D-Ala, Asn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLVVPNAKLVVAGELNEYGPTETTVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (74% 8Å match); Asn DLTKVGEVGK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

B9W62_RS11790: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (9..411): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: MSMTFDVSTAELQAVTTGESNLYGPTEATVWCTG
Nearest Stachelhaus code(s):: Ala DVATVTAIWK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_KZ195574.1 - Region 18 - T2PKS

Download region GenBank file

Download region SVG

Location: 2,866,764 - 2,939,306 nt. (total: 72,543 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B9W62_RS12405: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Lyases: cyclase decarboxylase

B9W62_RS12355: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

B9W62_RS12435: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

B9W62_RS12440: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: synthase

B9W62_RS12345: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

B9W62_RS12420: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W62_RS12425: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.70	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.69	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000883.5	0.57	other (other)	arginomycin	Streptomyces arginensis
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001197.5	0.54	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000275.4	0.54	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.70	PKS	spore pigment	Streptomyces avermitilis
BGC0000215.5	0.69	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000883.5	0.57	other (other)	arginomycin	Streptomyces arginensis
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001197.5	0.54	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000275.4	0.54	PKS	tetracenomycin C	Streptomyces glaucescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.76 out of 24.78

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.41 out of 29.72

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (19):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.62 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.48 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.16 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.19 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.91 out of 30.22

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.84 out of 32.38

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.69 out of 27.04

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.26 out of 36.54

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.93 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.29 out of 24.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.54 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.86 out of 26.85

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.25 out of 20.01

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 2866763 to 2939306
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

B9W62_RS12310: MET (Score: 22.1; E-value: 1.7e-07)
B9W62_RS12405: OXY (Score: 242.3; E-value: 2.6e-74)
B9W62_RS12415: CYC C5-C18 (Score: 218.2; E-value: 6.5e-68)
B9W62_RS12420: KS (Score: 715.0; E-value: 6.1e-218)
B9W62_RS12425: CLF (Score: 552.3; E-value: 1.4e-168)
B9W62_RS12430: ACP (Score: 74.2; E-value: 1.4e-23)
B9W62_RS12435: CYC C9-C14 (Score: 249.7; E-value: 1.9e-77)
B9W62_RS12440: CYC C4-C21/C2-C23|C2-C19 (Score: 154.8; E-value: 1.5e-48)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 19 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 2,956,837 - 2,977,994 nt. (total: 21,158 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W62_RS12665: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase

B9W62_RS12700: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

B9W62_RS12730: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.44	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000340.5	0.42	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.44	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000340.5	0.42	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

B9W62_RS12730: PT_FPPS_like

Domain 1 (94 - 383): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.09 out of 23.43

Confidence: medium

Additional weak hits (9):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.47 out of 26.85

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.94 out of 29.65

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.47 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.74 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 20 - terpene

Download region GenBank file

Download region SVG

Location: 2,987,440 - 3,008,525 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B9W62_RS12865: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

B9W62_RS12875: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

B9W62_RS12870: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.92	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002012.4	0.35	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001315.3	0.34	terpene	cucurbitacin C	Cucumis sativus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.92	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002012.4	0.35	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001315.3	0.34	terpene	cucurbitacin C	Cucumis sativus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

B9W62_RS12870: T1TS

Domain 1 (5 - 339): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.16 out of 27.04

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.12 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

Additional weak hits (1):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.19 out of 30.22

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes

NZ_KZ195574.1 - Region 21 - RRE-containing

Download region GenBank file

Download region SVG

Location: 3,109,311 - 3,130,369 nt. (total: 21,059 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002488.3	0.44	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002656.2	0.42	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002115.3	0.40	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000585.5	0.39	ribosomal	microcin C7	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002488.3	0.44	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002656.2	0.42	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002115.3	0.40	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000585.5	0.39	ribosomal	microcin C7	Escherichia coli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.73 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.98 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.93 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.14 out of 26.06

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 1 - 85; Score: 45.0

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_KZ195574.1 - Region 22 - RRE-containing

Download region GenBank file

Download region SVG

Location: 3,152,187 - 3,173,425 nt. (total: 21,239 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W62_RS13575: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS13615: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase

B9W62_RS13590: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.46	ribosomal	microcin C7	Escherichia coli
BGC0002496.3	0.43	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001850.4	0.37	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001187.4	0.36	NRPS, PKS	xenolozoyenone	Glarea lozoyensis
BGC0000194.5	0.35	PKS	actinorhodin	Streptomyces coelicolor A3(2)
BGC0001245.3	0.35	PKS	lasiodiplodin	Lasiodiplodia theobromae
BGC0000631.5	0.35	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000197.5	0.35	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0002712.2	0.34	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.46	ribosomal	microcin C7	Escherichia coli
BGC0002496.3	0.43	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001850.4	0.37	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001187.4	0.36	NRPS, PKS	xenolozoyenone	Glarea lozoyensis
BGC0000194.5	0.35	PKS	actinorhodin	Streptomyces coelicolor A3(2)
BGC0001245.3	0.35	PKS	lasiodiplodin	Lasiodiplodia theobromae
BGC0000631.5	0.35	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000197.5	0.35	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0002712.2	0.34	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.87 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.65 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.13 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.35 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.00 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.31 out of 32.93

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 5 - 102; Score: 93.0

TFBS definitions

Regulator	Description

NZ_KZ195574.1 - Region 23 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 5,500,883 - 5,530,667 nt. (total: 29,785 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B9W62_RS24695: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

B9W62_RS24715: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B9W62_RS24740: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase transferase

B9W62_RS24725: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

B9W62_RS24730: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: decarboxylase

B9W62_RS24700: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

B9W62_RS24720: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Translocases: transporter

B9W62_RS24630: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.91	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.91	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.62 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 36.53 out of 36.53

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.66 out of 30.11

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.64 out of 23.79

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 23.43

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.94 out of 36.53

Confidence: medium

Additional weak hits (7):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.89 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.83 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.00 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.84 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.16 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 24 - melanin

Download region GenBank file

Download region SVG

Location: 5,614,827 - 5,625,426 nt. (total: 10,600 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W62_RS25170: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: glycosyltransferase

B9W62_RS25120: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.87	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.68	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.47	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.42	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.42	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.36	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001624.3	0.36	other (other)	iso-A82775C	Pestalotiopsis fici
BGC0001592.5	0.35	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.87	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.68	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.47	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.42	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.42	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.36	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001624.3	0.36	other (other)	iso-A82775C	Pestalotiopsis fici
BGC0001592.5	0.35	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.29 out of 27.55

Confidence: medium

Additional weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.68 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.93 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.26 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.23 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.51 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes

NZ_KZ195574.1 - Region 25 - ectoine

Download region GenBank file

Download region SVG

Location: 6,631,530 - 6,641,928 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

B9W62_RS29770: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

B9W62_RS29785: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B9W62_RS29795: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.08 out of 26.85

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (4):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.15 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism

NZ_KZ195574.1 - Region 26 - PKS-like,T2PKS,oligosaccharide

Download region GenBank file

Download region SVG

Location: 7,043,694 - 7,116,158 nt. (total: 72,465 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
PKS-like: (t2pks2 or ksIII)
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

B9W62_RS31875: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

B9W62_RS31925: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS31935: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

B9W62_RS32005: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

B9W62_RS32040: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acylase aminotransferase carboxylase formyltransferase glycosyltransferase methyltransferase transferase

B9W62_RS31765: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

B9W62_RS31815: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

B9W62_RS31915: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

B9W62_RS31930: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B9W62_RS31940: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

B9W62_RS31945: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B9W62_RS31965: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B9W62_RS31970: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B9W62_RS31985: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B9W62_RS31990: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

B9W62_RS32020: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

B9W62_RS31910: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase dehydratase hydratase

B9W62_RS31865: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

B9W62_RS31950: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B9W62_RS32015: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B9W62_RS32025: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

B9W62_RS31760: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

B9W62_RS31895: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W62_RS31900: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B9W62_RS31920: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: permease

B9W62_RS31850: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001439.5	2.24	PKS, saccharide	antibiotic HKI 10311129, antibiotic A2121-1, cervimycin D, cervimycin C, cervimycin A	Streptomyces sp. CS113
BGC0000231.5	1.09	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.89	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000272.3	0.82	PKS	spore pigment	Streptomyces collinus
BGC0000278.3	0.82	PKS	urdamycin	Streptomyces fradiae
BGC0001723.5	0.76	PKS	oviedomycin	Streptomyces antibioticus
BGC0001197.5	0.69	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001817.5	0.68	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000217.5	0.67	PKS	daunorubicin	Streptomyces sp.
BGC0000221.5	0.65	PKS	erdacin	uncultured soil bacterium V167

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001439.5	0.95	PKS, saccharide	antibiotic HKI 10311129, antibiotic A2121-1, cervimycin D, cervimycin C, cervimycin A	Streptomyces sp. CS113
BGC0000231.5	0.69	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000278.3	0.64	PKS	urdamycin	Streptomyces fradiae
BGC0000234.5	0.63	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0001257.3	0.61	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

Additional weak hits (17):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.20 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.15 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.70 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.84 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.42 out of 26.85

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.29 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.15 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.03 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.08 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.94 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.24 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.72 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.88 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

B9W62_RS32020: mal

PKS_AT (15..296): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 72.8
Methylmalonyl-CoA: 40.5
Methoxymalonyl-CoA: 40.1
Propionyl-CoA: 27.7
inactive: 15.3
Ethylmalonyl-CoA: 10.2
fatty_acid: 9.6
2-Methylbutyryl-CoA: 8.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 7043693 to 7116158
Starter unit(s):: malonamyl-CoA (Score: 844.0; E-value: 0)
propionyl-CoA (Score: 370.0; E-value: 2.83e-131)
Malonyl elongations:: 8|9 (Score: 683.9; E-value: 1.4e-208)
Product class(es):: anthracycline
aureolic acid
tetracycline
Product molecular weight(s):: malonamyl-CoA_8: 1292 Da
malonamyl-CoA_9: 1334 Da
propionyl-CoA_8: 1263 Da
propionyl-CoA_9: 1305 Da

B9W62_RS31895: KS (Score: 732.4; E-value: 3.2e-223)
B9W62_RS31900: CLF 8|9 (Score: 683.9; E-value: 1.4e-208)
B9W62_RS31905: ACP (Score: 99.7; E-value: 1.6e-31)
B9W62_RS31910: AMID (Score: 1085.4; E-value: 0.0); AMID ADE34521.1_SF2575_malonamyl-CoA (Score: 844.0; E-value: 0.0)
B9W62_RS31925: KR (Score: 192.3; E-value: 2.8e-59)
B9W62_RS31930: GT (Score: 411.5; E-value: 1.1e-125)
B9W62_RS31940: MET C11O (Score: 435.9; E-value: 2e-133)
B9W62_RS31945: GT (Score: 390.3; E-value: 3e-119)
B9W62_RS31965: GT (Score: 381.5; E-value: 1.4e-116)
B9W62_RS31970: GT (Score: 432.3; E-value: 5.3e-132)
B9W62_RS31985: GT (Score: 325.4; E-value: 1.5e-99)
B9W62_RS32020: AT (Score: 421.7; E-value: 4.6e-129); AT BAB72049.1_Aklavinone_propionyl-CoA (Score: 370.0; E-value: 2.83e-131)
B9W62_RS32025: CYC C7-C12 (Score: 379.2; E-value: 2.7e-116)
B9W62_RS32030: CYC C1-C18|C2-C19 (Score: 200.1; E-value: 3.1e-62)
B9W62_RS32035: CYC C5-C14/C3-C16 (Score: 450.4; E-value: 4.2e-138)
B9W62_RS32040: OXY (Score: 422.0; E-value: 8.1e-129)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 27 - T3PKS

Download region GenBank file

Download region SVG

Location: 7,368,065 - 7,409,189 nt. (total: 41,125 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase reductase

B9W62_RS33330: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B9W62_RS33340: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W62_RS33355: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B9W62_RS33370: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

B9W62_RS33380: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B9W62_RS33385: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B9W62_RS33390: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase

B9W62_RS33260: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: deformylase

B9W62_RS33320: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

B9W62_RS33345: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.92	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.64	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001336.5	0.49	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001078.5	0.47	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000652.5	0.46	terpene	napyradiomycin	Streptomyces sp. CNQ525

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.92	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.64	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001336.5	0.49	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001078.5	0.47	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0000652.5	0.46	terpene	napyradiomycin	Streptomyces sp. CNQ525

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.43 out of 23.79

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.56 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

Additional weak hits (13):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.76 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.13 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.65 out of 23.43

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.35 out of 27.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.50 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.03 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.63 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.49 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.21 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 30.11

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 28 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 7,645,862 - 7,694,304 nt. (total: 48,443 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

B9W62_RS34535: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B9W62_RS34570: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B9W62_RS34575: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

B9W62_RS34585: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

B9W62_RS34625: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: dehalogenase esterase hydrolase

B9W62_RS34550: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

B9W62_RS34600: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

B9W62_RS34610: isochorismatase

smcogs: SMCOG1027: isochorismatase

B9W62_RS34635: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Isomerases: isomerase

B9W62_RS34620: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

B9W62_RS34605: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W62_RS34615: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.87	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.78	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001185.5	0.78	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000401.5	0.67	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.71	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001185.5	0.71	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000401.5	0.67	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.19 out of 36.53

Confidence: medium

Additional weak hits (14):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.42 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.46 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.24 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.22 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.08 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.92 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.60 out of 26.06

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.10 out of 20.01

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.48 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.00 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.66 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.74 out of 29.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 38, location 7645861 - 7694304:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B9W62_RS34605: X

AMP-binding (459..855): X

nrpys: Ala, Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVTH
Nearest Stachelhaus code(s):: Ala or Ser DVWHFSLVDK (100% 8Å match); Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W62_RS34615: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (35..443): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SGSLFPMSSPGGGLLVGGAMQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor

NZ_KZ195574.1 - Region 29 - terpene

Download region GenBank file

Download region SVG

Location: 7,883,104 - 7,904,702 nt. (total: 21,599 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W62_RS35640: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: protease

B9W62_RS35550: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

B9W62_RS35560: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: dehydratase

B9W62_RS35645: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.49	ribosomal	megacin	Bacillus megaterium
BGC0000597.4	0.49	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001735.5	0.45	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000772.5	0.42	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000595.3	0.40	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001484.3	0.36	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0002535.2	0.34	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001865.4	0.34	PKS	elsinochrome C	Parastagonospora nodorum SN15
BGC0000842.5	0.34	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000444.5	0.34	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000622.5	0.49	ribosomal	megacin	Bacillus megaterium
BGC0000597.4	0.49	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001735.5	0.45	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000772.5	0.42	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000595.3	0.40	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001484.3	0.36	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0002535.2	0.34	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001865.4	0.34	PKS	elsinochrome C	Parastagonospora nodorum SN15
BGC0000842.5	0.34	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000444.5	0.34	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

B9W62_RS35580: PT_phytoene_like

Domain 1 (6 - 217): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 22.22 out of 23.05

Confidence: strong

Additional weak hits (4):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.18 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.24 out of 31.73

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.90 out of 36.53

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_KZ195574.1 - Region 30 - T3PKS,butyrolactone

Download region GenBank file

Download region SVG

Location: 7,953,137 - 8,002,626 nt. (total: 49,490 nt) Show pHMM detection rules used

butyrolactone: AfsA
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

B9W62_RS35895: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS35900: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS35920: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

B9W62_RS35940: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

B9W62_RS35965: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

B9W62_RS35970: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

B9W62_RS35985: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

B9W62_RS35990: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: transferase

B9W62_RS35980: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthase

B9W62_RS36020: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001454.5	0.67	other (other)	germicidin	Streptomyces argillaceus
BGC0000849.4	0.46	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002578.2	0.33	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.26	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0002496.3	0.24	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000749.3	0.22	saccharide	capsular polysaccharide	Escherichia coli
BGC0000850.5	0.21	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002303.3	0.21	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0002130.3	0.21	ribosomal	cacaoidin	Streptomyces cacaoi CA-170360
BGC0000248.5	0.20	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001454.5	0.87	other (other)	germicidin	Streptomyces argillaceus
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000749.3	0.55	saccharide	capsular polysaccharide	Escherichia coli
BGC0000850.5	0.54	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.52	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000842.5	0.46	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0002130.3	0.44	ribosomal	cacaoidin	Streptomyces cacaoi CA-170360
BGC0001302.5	0.44	other (other)	lomofungin	Streptomyces lomondensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.80 out of 23.43

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.91 out of 27.04

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.47 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.38 out of 23.79

Confidence: medium

Additional weak hits (20):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.90 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.24 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.44 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.01 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.18 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.67 out of 30.22

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.80 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.65 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.23 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.95 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.70 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.17 out of 33.14

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.83 out of 27.04

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.83 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.74 out of 26.85

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195574.1 - Region 31 - terpene

Download region GenBank file

Download region SVG

Location: 8,136,754 - 8,171,950 nt. (total: 35,197 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B9W62_RS36810: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

B9W62_RS36850: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B9W62_RS36855: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS36870: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

B9W62_RS36820: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.65	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.64	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.64	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.61	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.59	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002218.2	0.48	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000641.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.65	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.64	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.64	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.61	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.59	terpene	isorenieratene	Streptomyces argillaceus
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002218.2	0.48	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000641.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

B9W62_RS36820: PT_FPPS_like

Domain 1 (59 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

B9W62_RS36865: Lycopene_cycl

Domain 1 (5 - 386): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

B9W62_RS36875: PT_phytoene_like

Domain 1 (28 - 335): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.09 out of 23.79

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.13 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.16 out of 30.11

Confidence: medium

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.07 out of 21.55

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.09 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.84 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.52 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.83 out of 36.53

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_KZ195574.1 - Region 32 - indole

Download region GenBank file

Download region SVG

Location: 8,224,630 - 8,245,748 nt. (total: 21,119 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B9W62_RS37230: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Ligases: ligase

B9W62_RS37245: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.86	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001294.5	0.47	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001483.4	0.46	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001840.2	0.42	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001911.3	0.40	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002805.2	0.39	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0002701.2	0.38	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0001887.3	0.38	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0002710.2	0.38	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.86	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001294.5	0.47	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0001483.4	0.46	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001840.2	0.42	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001911.3	0.40	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002805.2	0.39	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0002701.2	0.38	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0001887.3	0.38	ribosomal	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0002710.2	0.38	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (7):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.58 out of 27.78

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.86 out of 27.18

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 26.85

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.77 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.74 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production

NZ_KZ195574.1 - Region 33 - NRP-metallophore,NRPS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 8,486,545 - 8,561,200 nt. (total: 74,656 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B9W62_RS38570: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W62_RS38690: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

B9W62_RS38445: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

B9W62_RS38625: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: esterase

B9W62_RS38575: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: decarboxylase

B9W62_RS38500: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Isomerases: isomerase

B9W62_RS38595: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

B9W62_RS38545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W62_RS38550: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

B9W62_RS38410: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	1.93	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0002286.3	0.91	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.91	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.90	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.90	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.90	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.89	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.89	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.89	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.88	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	0.86	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.63	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.69 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.49 out of 28.19

Confidence: medium

Additional weak hits (33):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.04 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.35 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.30 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.64 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.43 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.09 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.36 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.23 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.76 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.96 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.10 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.73 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.00 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.23 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.47 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.43 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.18 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.89 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.67 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.51 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.03 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.17 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.63 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.03 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.49 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.74 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 45, location 8486544 - 8561200:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B9W62_RS38545: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..451): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NACLFAFACPGGSLQVGGAQQVFGMAEGLINLTR
Nearest Stachelhaus code(s):: Sal ALPSQGVLNK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

B9W62_RS38550: Thr - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (585..980): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: arg (Arg)
Single AA prediction:: arg (Arg)

Stachelhaus prediction details:

Stachelhaus sequence:: TAMSFDLATWDTQCLLGGDVALGGMTEAAVHSTV
Nearest Stachelhaus code(s):: Thr DLWQLGLVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1647..2054): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLVSGDVAMGGATEAAIWSNT
Nearest Stachelhaus code(s):: Cys DLYNLSMIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W62_RS38555: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (543..942): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLISGDISLGGATEGSIWSIA
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_KZ195574.1 - Region 34 - hglE-KS,lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 8,607,714 - 8,660,285 nt. (total: 52,572 nt) Show pHMM detection rules used

hglE-KS: (hglE or hglD)
lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W62_RS38945: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS38950: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS38970: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W62_RS39085: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acylase methyltransferase

B9W62_RS39005: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B9W62_RS39110: methyltransferase

smcogs: SMCOG1248: methyltransferase

Lyases: cyclase dehydratase hydratase

B9W62_RS39000: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B9W62_RS39020: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

B9W62_RS39025: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

B9W62_RS39070: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: synthase

B9W62_RS39010: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W62_RS39015: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: permease

B9W62_RS39065: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.89	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.45	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0000863.3	0.41	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002316.2	0.34	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000541.5	0.34	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.33	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000861.5	0.32	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000560.5	0.32	ribosomal	subtilomycin	Bacillus subtilis
BGC0001928.2	0.32	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000863.3	0.62	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for B9W62_RS39025

B9W62_RS39030

Leader:

MRTEMILSHEAPELDLDLDLRVSDIPEQAE

Core:

SFGQGTFTSPSSYAIGTRCPICC

Core with dehydrations:

DhaFGQGDhbFDhbDhaPDhaDhaYAIGDhbRCysPICysCys

antiSMASH-DB 4.0 matches for B9W62_RS39030

95.8%

NZ_BMUN01000001.1and 9 others:

NZ_CP012382.1 Lanthipeptides: SAM23877_RS36835_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS33360_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34825_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35110_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33410_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33410_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00945_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS39030_lanthipeptideNZ_MQUH01000030.1 Lanthipeptides: BSZ07_RS37165_lanthipeptide

Lanthipeptides: IE238_RS00870_lanthipeptide

1

SFGQGTFTSPSSYAIGTRCPICC

23

SFGQGTFTSPSSYAIGTRCPICC

2

SFGQGTFTSPSSYAIGTRCPICC

24

91.7%

NZ_BMVQ01000001.1and 4 others:

NZ_BMWI01000001.1 Lanthipeptides: IE253_RS05465_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS01285_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS36720_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS01655_lanthipeptide

Lanthipeptides: IE283_RS00890_lanthipeptide

1

SFGQGTFTSPSSYAIGTRCPICC

23

SFG+GTFTSPSSYAIGTRCPICC

2

SFGEGTFTSPSSYAIGTRCPICC

24

91.7%

NZ_CP054939.1and 2 others:

NZ_FKJH01000076.1 Lanthipeptides: STEPF7_RS31605_lanthipeptideNZ_GG657758.1 Lanthipeptides: SSRG_RS36710_lanthipeptide

Lanthipeptides: HUT14_RS33610_lanthipeptide

1

SFGQGTFTSPSSYAIGTRCPICC

23

SFGQGT+TSPSSYAIGTRCPICC

2

SFGQGTYTSPSSYAIGTRCPICC

24

with 15 more sequence matches

Only the first 10 are displayed here.

87.5%

NZ_BEWD01000004.1:

Lanthipeptides: Sru02f_RS16280_lanthipeptide

2

FGQGTFTSPSSYAIGTRCPICC

23

FG+GTFTSPSSYAIGTRCPICC

3

FGEGTFTSPSSYAIGTRCPICC

24

87.5%

NZ_CP043959.1and 5 others:

NZ_CP104864.1 Lanthipeptides: N7E53_RS01070_lanthipeptideNZ_JMLN01000003.1 Lanthipeptides: BR33_RS35695_lanthipeptideNZ_KL503830.1 Lanthipeptides: DJ64_RS34550_lanthipeptideNZ_VIUV01000001.1 Lanthipeptides: FB570_RS00565_lanthipeptideNZ_WUUF01000042.1 Lanthipeptides: GSE51_RS09870_lanthipeptide

Lanthipeptides: F3L20_RS18420_lanthipeptide

1

SFGQGTFTSPSSYAIGTRCPICC

23

SFGQGT+TSPSSYAIGTRCP+CC

2

SFGQGTYTSPSSYAIGTRCPVCC

24

82.6%

NZ_CP058273.1:

Lanthipeptides: AY578_RS00390_lanthipeptide

3

GQGTFTSPSSYAIGTRCPICC

23

GQGT+TSPSSYAIGTRCP+CC

1

GQGTYTSPSSYAIGTRCPVCC

21

82.6%

NZ_KB891308.1and 2 others:

NZ_KZ819159.1 Lanthipeptides: DBP19_RS30055_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS32200_lanthipeptide

Lanthipeptides: B061_RS37915_lanthipeptide

1

SFGQGTFTSPSSYAIGTRCPICC

23

FG GT+TSPSSYAIGTRCP+CC

1

EFGAGTYTSPSSYAIGTRCPVCC

23

78.3%

NZ_NNBO01000011.1:

Lanthipeptides: CG736_RS24265_lanthipeptide

5

GTFTSPSSYAIGTRCPICC

23

GTFTSPSSYAIGTRCP+CC

1

GTFTSPSSYAIGTRCPVCC

19

73.9%

NZ_CP113837.1and 1 other:

NZ_LISX01000001.1 Lanthipeptides: AMK19_RS02530_lanthipeptide

Lanthipeptides: OU787_RS28205_lanthipeptide

5

GTFTSPSSYAIGTRCPICC

23

GT+TSPSSYAIGTRCP+CC

1

GTYTSPSSYAIGTRCPVCC

19

69.6%

NZ_KK853997.1:

Lanthipeptides: KCH_RS38645_lanthipeptide

8

TSPSSYAIGTRCPICC

23

TSPSSYAIGTRCPICC

1

TSPSSYAIGTRCPICC

16

65.2%

NZ_NNBP01000006.1:

Lanthipeptides: CG747_RS11965_lanthipeptide

8

TSPSSYAIGTRCPICC

23

TSPSSYAIGTRCP CC

1

TSPSSYAIGTRCPTCC

16

47.8%

NZ_CP050693.1:

Lanthipeptides: HC362_RS33495_lanthipeptide

2

FGQGTFTSPSSYAIGTRCPICC

23

F G +TSPS+Y G+ C +CC

1

FASGGYTSPSTY--GSPCNLCC

20

29.6%

NZ_BIFH01000040.1:

Lanthipeptides: EMA17_RS40630_lanthipeptide

3

GQGTFTSPSSYAIGTRCPICC

23

G SPS+ + +RC +CC

6

GASVTLSPSTRGVQSRCWVCC

26

MIBiG 4.0 matches for B9W62_RS39030

21.7%

BGC0000503.5 (cinA):

Lanthipeptide: cinnamycin

1

SFGQGTFT

8

SFG TF

6

SFGPFTFV

13

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

Additional weak hits (11):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.70 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.64 out of 31.73

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.13 out of 39.62

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.47 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.65 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.99 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.48 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.13 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

B9W62_RS39030 - Class I

Cleavage pHMM score: -7.10

RODEO score: 19

Monoisotopic mass: 2256.0 Da

Molecular weight: 2257.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2275.6 Da N = 1; 2293.6 Da N = 2; 2311.6 Da N = 3; 2329.6 Da N = 4

Predicted core structure(s)

For candidate cluster 46, location 8607713 - 8660285:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B9W62_RS39010: mal

PKS_AT (575..874): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 111.6
inactive: 40.8
Methoxymalonyl-CoA: 37.9
Methylmalonyl-CoA: 31.3
Isobutyryl-CoA: 20.4
Ethylmalonyl-CoA: 13.4
CHC-CoA: 13.2
Propionyl-CoA: 9.3
2-Methylbutyryl-CoA: 5.5
fatty_acid: 2.9
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

B9W62_RS39015: mmal

PKS_AT (880..1165): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 25.9
Propionyl-CoA: 25.8
Methoxymalonyl-CoA: 25.1
2-Methylbutyryl-CoA: 21.1
Isobutyryl-CoA: 9.0
Ethylmalonyl-CoA: 7.4
CHC-CoA: 5.3
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Malonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 157 - 240; Score: 70.1

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence