GCF_002188345.1 - 37 region(s)

Download region SVG

Location: 69,772 - 122,713 nt. (total: 52,942 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B9W61_RS00340: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W61_RS00465: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: acylase

B9W61_RS00425: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Translocases: transporter

B9W61_RS00480: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.58	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002631.2	0.41	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001310.5	0.37	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001948.3	0.35	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001844.4	0.33	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0002103.2	0.30	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001841.2	0.29	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0000423.5	0.29	NRPS	scabichelin	Streptomyces scabiei 87.22

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001844.4	0.48	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001841.2	0.44	NRPS, PKS	detoxin P1, detoxin P2, detoxin P3	Amycolatopsis jejuensis
BGC0000423.5	0.44	NRPS	scabichelin	Streptomyces scabiei 87.22

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (18):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.28 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.31 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.63 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.50 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.83 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.20 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.81 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.24 out of 25.88

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.88 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.83 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.29 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 69771 - 122713:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - ohmal - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS00425: NH2 - mal - X

CAL_domain (141..459): NH2

minowa: NH2

Prediction, score:

NH2: 41.4
fatty_acid: 36.6
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1279..1563): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 119.1
Methoxymalonyl-CoA: 66.3
Methylmalonyl-CoA: 64.8
inactive: 45.9
Propionyl-CoA: 33.0
Ethylmalonyl-CoA: 26.9
Isobutyryl-CoA: 24.9
fatty_acid: 24.4
2-Methylbutyryl-CoA: 15.2
trans-1,2-CPDA: 13.5
Benzoyl-CoA: 13.3
CHC-CoA: 10.7
Acetyl-CoA: 10.3
3-Methylbutyryl-CoA: 0.0

AMP-binding (2756..3175): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWAAFDASVRQASSHVGGEANLYGPTEATINTSC
Nearest Stachelhaus code(s):: Gln DACSTGVINK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195572.1 - Region 2 - NRPS-like,lanthipeptide-class-iv,transAT-PKS

Download region SVG

Location: 174,668 - 247,113 nt. (total: 72,446 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

B9W61_RS00850: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W61_RS00855: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS00860: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

B9W61_RS00935: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

B9W61_RS00885: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

B9W61_RS00875: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: ligase synthase

B9W61_RS00845: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS36615: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000175.5	1.12	PKS	cycloheximide	Streptomyces sp. YIM 56141
BGC0002337.2	0.78	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0002099.3	0.72	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001310.5	0.58	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000384.6	0.56	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0002127.3	0.51	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001948.3	0.45	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001075.5	0.43	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001197.5	0.43	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001928.2	0.42	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000175.5	0.84	PKS	cycloheximide	Streptomyces sp. YIM 56141
BGC0000107.3	0.62	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002337.2	0.60	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0000083.5	0.55	PKS	lactimidomycin, 8,9-dihydrolactimidomycin, 8-hydroxy-8,9-dihydrolactidomycin, 17-hydroxy-8-desmethoxy-isomigrastatin	Streptomyces amphibiosporus
BGC0002083.3	0.55	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0000177.5	0.52	PKS	iso-migrastatin, migrastatin, dorrigocin A, dorrigocin B, 13-epi-dorrigocin A	Streptomyces platensis subsp. rosaceus
BGC0001310.5	0.51	PKS	naringenin	Streptomyces clavuligerus ATCC 27064

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

Additional weak hits (16):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.26 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.46 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.65 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.71 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.06 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.54 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.45 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.24 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.98 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 2, location 174667 - 247113:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - mal - ccmal - mal) + (Me-ccmal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 174667 - 218114:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - mal - ccmal - mal) + (Me-ccmal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 183137 - 247113:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - mal - ccmal - mal) + (Me-ccmal) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS00845: X

AMP-binding (62..490): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AGFLHLAGRYAGTMFVGTAYTGYGSTEAGGVLLD
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

B9W61_RS00885: mal

PKS_AT (4..277): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.3
inactive: 36.9
Methylmalonyl-CoA: 29.0
Methoxymalonyl-CoA: 28.8
Propionyl-CoA: 19.0
2-Methylbutyryl-CoA: 15.8
Isobutyryl-CoA: 10.0
CHC-CoA: 7.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
IolR	Regulator of the inositol catabolism

NZ_KZ195572.1 - Region 3 - NRPS,T3PKS

Download region SVG

Location: 272,346 - 378,612 nt. (total: 106,267 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

B9W61_RS01090: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B9W61_RS01135: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

B9W61_RS01275: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: methyltransferase

B9W61_RS01280: Methylation

MITE: MITE0000155Methylation (identity: 94.30%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Hydrolases: hydrolase

B9W61_RS01160: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

B9W61_RS01175: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS01180: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS01185: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS01285: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transporter

B9W61_RS01120: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	1.47	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.46	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002135.2	0.43	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.41	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002071.2	0.41	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001758.4	0.41	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.39	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.38	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.37	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.36	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.90	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002071.2	0.73	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.69	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.73 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.19 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.20 out of 23.79

Confidence: medium

Additional weak hits (10):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.53 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.15 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.83 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.54 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.97 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 272345 - 378612:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Gly - Thr - Ser - D-X) + (Thr - D-His - Val - D-X) + (D-X - Gly - D-Ser - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 272345 - 361129:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Gly - Thr - Ser - D-X) + (Thr - D-His - Val - D-X) + (D-X - Gly - D-Ser - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 337559 - 378612:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Gly - Thr - Ser - D-X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS01175: X - Gly - Ser - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (474..869): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWAAFDVTLAENVIIVGTEFNAYGPTEAVVNSAT
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWIIGAVNK (62% 8Å match); Trp or Pro DVMFIGAVNK (50% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1992..2372): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LAITFDIAALEVQALSGGELNLYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3032..3430): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFVASGEHNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4564..4972): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDASWQPWEVGVGGEVNLYGPTEGTVDAMV
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS01180: Thr - His - Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (480..896): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTTHFDFSVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1558..1956): His

nrpys: His

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTLAFDTSVWEMTVIVAGEFNSYGPTETTVDATL
Nearest Stachelhaus code(s):: His DTWTIASVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3058..3467): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSSFDAATHEGWFWTGGDVNGYGPTETTTFATA
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4135..4531): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWTAFDVSVWEGHFFSGGEVNQYGPTEAAVDVTA
Nearest Stachelhaus code(s):: His DYWHFGAVDK (82% 8Å match); Ser DVWHFSLVDK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

B9W61_RS01185: Gly - Gly - Thr - Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (471..941): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LAMTFDIAALEVQALSGGEVNLYGPTETTIWSTS
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1640..2034): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FCLTFDIAVLELQALAGGEVNLYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2685..3097): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVLGGEVNMYGITETTVHVTT
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3750..4147): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWATFDVSVWEWHFLASGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4797..5193): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVMEMLIIVGGEVNAYGPTEATACVTM
Nearest Stachelhaus code(s):: Leu DAMLVGAACK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_KZ195572.1 - Region 4 - melanin,terpene-precursor

Download region SVG

Location: 393,522 - 421,974 nt. (total: 28,453 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

B9W61_RS01455: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

B9W61_RS01565: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase

B9W61_RS01510: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

B9W61_RS01515: sugar transferase

smcogs: SMCOG1146: sugar transferase

B9W61_RS01535: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

B9W61_RS01505: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: synthetase

B9W61_RS01500: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.64	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.51	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.30	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.26	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000800.5	0.26	saccharide	xanthan	Xanthomonas campestris
BGC0001529.5	0.21	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000786.3	0.21	saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000908.3	0.17	other (other)	melanin	Streptomyces avermitilis
BGC0000790.3	0.17	saccharide	O-antigen	Escherichia coli
BGC0000742.3	0.16	saccharide	capsular polysaccharide	Streptococcus agalactiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.86	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.79	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0000908.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.48	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000800.5	0.47	saccharide	xanthan	Xanthomonas campestris
BGC0000742.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

B9W61_RS01500: PT_FPPS_like

Domain 1 (58 - 341): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

Additional weak hits (4):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.00 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.35 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.20 out of 21.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.55 out of 25.88

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes

NZ_KZ195572.1 - Region 5 - RiPP-like

Download region SVG

Location: 422,757 - 434,124 nt. (total: 11,368 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.71	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000571.3	0.37	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002289.2	0.35	ribosomal	Leepeptin	Streptomyces leeuwenhoekii
BGC0001863.4	0.35	ribosomal, terpene	bacillicn CER074	Bacillus mycoides

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.71	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001579.4	0.40	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000616.4	0.39	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000571.3	0.37	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002289.2	0.35	ribosomal	Leepeptin	Streptomyces leeuwenhoekii
BGC0001863.4	0.35	ribosomal, terpene	bacillicn CER074	Bacillus mycoides

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.87 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.88 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.45 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_KZ195572.1 - Region 6 - NRPS,T1PKS,t3nrps-iterative

Download region SVG

Location: 453,018 - 569,697 nt. (total: 116,680 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

B9W61_RS01810: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

B9W61_RS01835: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS01895: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B9W61_RS01935: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

B9W61_RS36265: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acyltransferase carbamoyltransferase transketolase

B9W61_RS01800: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

B9W61_RS01905: transketolase

smcogs: SMCOG1204: transketolase

B9W61_RS02015: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

B9W61_RS02095: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: deaminase hydrolase

B9W61_RS01880: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

B9W61_RS02025: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase dehydratase

B9W61_RS01890: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

B9W61_RS36640: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: mutase

B9W61_RS01885: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

B9W61_RS02090: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

B9W61_RS01730: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

B9W61_RS01795: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS01805: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS01815: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS01820: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS01910: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

B9W61_RS01940: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS01945: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS01995: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W61_RS02000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS02020: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.49	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.45	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.42	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.41	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	1.36	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	1.33	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	1.32	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	1.29	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	1.27	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	1.27	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.71	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (16):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.04 out of 19.26

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.05 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 21.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.87 out of 36.53

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.91 out of 32.74

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.86 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.89 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.17 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.04 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.67 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.25 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.81 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 13, location 453017 - 569697:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Asp - X - ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS01800: X

AMP-binding (675..1068): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAAFDVAFFEICLLCGTEFNAYGPTEATVNSTL
Nearest Stachelhaus code(s):: Ac-OH-Orn DVFALGAVNK (79% 8Å match); OH-Orn DVFILGAVNK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

B9W61_RS01805: Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (449..722): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAASFDASVEEVDLIIGGEINTYGPTEATVVATA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS01820: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (15..398): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGLYQLPLTNTGEFRMYGLSECKRVSIL
Nearest Stachelhaus code(s):: Asp DYYPTTMRVK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS01945: X

AMP-binding (143..306): X

No predictions made

B9W61_RS01995: Asp - X - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (16..424): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YSTTADLGYTVNKTIAGGELNHYGPAETCIGVAL
Nearest Stachelhaus code(s):: Asp DLTKIGHIGK (62% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1068..1461): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDVSVWEGQTVCGGEVNAYGPTETTVDATR
Nearest Stachelhaus code(s):: Dab DVWHVGAVDK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

PKS_AT (2205..2481): mal

ATSignature: 2-Rhyd-Malonyl-CoA, Malonyl-CoA

Top 3 matches:: 2-Rhyd-Malonyl-CoA: 54.2%; Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 55.0
Methoxymalonyl-CoA: 35.8
Methylmalonyl-CoA: 26.3
inactive: 20.5
Isobutyryl-CoA: 13.4
Propionyl-CoA: 10.4
2-Methylbutyryl-CoA: 9.7
fatty_acid: 9.4
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

B9W61_RS02000: X

AMP-binding (482..876): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAMAFDASLQNLDCVLGGEVNVYGPTEFTVNATA
Nearest Stachelhaus code(s):: Gln DAQDLGVVDK (71% 8Å match); Dpr DAQDLAVVNK (68% 8Å match); Ile DAQDLGVVDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor

NZ_KZ195572.1 - Region 7 - T1PKS

Download region SVG

Location: 588,409 - 634,240 nt. (total: 45,832 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

B9W61_RS02230: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

B9W61_RS02265: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

B9W61_RS02310: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS02380: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Transferases: acylase methyltransferase

B9W61_RS02275: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B9W61_RS02305: methyltransferase

smcogs: SMCOG1248: methyltransferase

Lyases: cyclase dehydratase

B9W61_RS02225: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B9W61_RS02235: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B9W61_RS37185: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: synthase

B9W61_RS02210: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Translocases: permease

B9W61_RS02375: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.55	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.55	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

Additional weak hits (8):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.68 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.95 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.34 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.64 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.94 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.93 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.43 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

B9W61_RS02275: mal

PKS_AT (614..841): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Propionyl-CoA: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 67.6
Methoxymalonyl-CoA: 49.8
Methylmalonyl-CoA: 40.5
inactive: 34.4
Ethylmalonyl-CoA: 18.3
Isobutyryl-CoA: 16.5
Propionyl-CoA: 11.1
2-Methylbutyryl-CoA: 9.2
trans-1,2-CPDA: 8.3
CHC-CoA: 4.2
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A

NZ_KZ195572.1 - Region 8 - RiPP-like

Download region SVG

Location: 732,057 - 742,854 nt. (total: 10,798 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W61_RS02820: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Hydrolases: hydrolase

B9W61_RS02825: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: decarboxylase

B9W61_RS02840: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.39	other (other)	showdomycin	Streptomyces showdoensis
BGC0001882.3	0.34	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000729.3	0.34	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000728.5	0.34	saccharide	capsular polysaccharide	Klebsiella pneumoniae subsp. ozaenae
BGC0002633.2	0.34	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001285.5	0.34	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001575.4	0.34	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0000791.3	0.33	saccharide	O-antigen	Cronobacter sakazakii
BGC0001891.3	0.32	other (other)	closthioamide	Ruminiclostridium cellulolyticum H10
BGC0000730.3	0.30	saccharide	capsular polysaccharide	Klebsiella pneumoniae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.39	other (other)	showdomycin	Streptomyces showdoensis
BGC0001882.3	0.34	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000729.3	0.34	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000728.5	0.34	saccharide	capsular polysaccharide	Klebsiella pneumoniae subsp. ozaenae
BGC0002633.2	0.34	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001285.5	0.34	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001575.4	0.34	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0000791.3	0.33	saccharide	O-antigen	Cronobacter sakazakii
BGC0001891.3	0.32	other (other)	closthioamide	Ruminiclostridium cellulolyticum H10
BGC0000730.3	0.30	saccharide	capsular polysaccharide	Klebsiella pneumoniae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.67 out of 20.01

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.83 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.33 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KZ195572.1 - Region 9 - NRPS,T1PKS

Download region SVG

Location: 809,843 - 916,085 nt. (total: 106,243 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase synthase

B9W61_RS03400: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W61_RS03470: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

B9W61_RS03505: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W61_RS03510: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B9W61_RS03515: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B9W61_RS03520: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B9W61_RS03580: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

B9W61_RS03605: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS35750: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: acyltransferase aminotransferase

B9W61_RS03270: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

B9W61_RS03445: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

B9W61_RS03535: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: esterase synthase

B9W61_RS03380: thioesterase

smcogs: SMCOG1004: thioesterase

B9W61_RS35750: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Lyases: dehydratase

B9W61_RS03285: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

B9W61_RS03365: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS03370: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W61_RS03375: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS03415: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W61_RS03420: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS03425: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS03430: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS03525: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transport

B9W61_RS03565: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	1.78	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	1.64	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001273.3	1.54	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	1.53	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	1.51	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001132.4	1.47	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.41	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.40	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.40	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	1.35	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	0.89	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	0.86	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000996.5	0.75	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.74	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.36 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.19 out of 20.97

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 28.35 out of 35.63

Confidence: medium

Additional weak hits (31):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.62 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.74 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.98 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.05 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.04 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.90 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.65 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.32 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.70 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.33 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.24 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.88 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.38 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.33 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.45 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.01 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.28 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.32 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.82 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.20 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.25 out of 36.53

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.39 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.28 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.13 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 809842 - 916085:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Fo-OH-Orn) + (mal) + (Cys - Cys) + (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 17, location 809842 - 884180:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Fo-OH-Orn) + (mal) + (Cys - Cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 18, location 866545 - 916085:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS03365: Ala - fatty_acid

Search NORINE for peptide: strict or relaxed

AMP-binding (467..774): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: TWLRLLSAVHAWFLHTDGGLHRLWPLEAGGYVAA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CAL_domain (1011..1424): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 20.3
Acetyl-CoA: 14.1
AHBA: 3.8
shikimic_acid: 0.0
NH2: -0.2

B9W61_RS03370: mal

PKS_AT (542..825): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 112.9
Methoxymalonyl-CoA: 51.0
inactive: 48.3
Methylmalonyl-CoA: 47.0
Propionyl-CoA: 32.7
Ethylmalonyl-CoA: 22.9
Isobutyryl-CoA: 15.3
Benzoyl-CoA: 8.4
fatty_acid: 7.1
2-Methylbutyryl-CoA: 3.2
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

B9W61_RS03375: Fo-OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (524..922): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISVNELYIWCGGEYHGYGPAETTIGISC
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS03415: mal

PKS_AT (548..832): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 149.3
inactive: 67.9
Methoxymalonyl-CoA: 58.3
Methylmalonyl-CoA: 50.1
Propionyl-CoA: 38.0
fatty_acid: 24.0
Ethylmalonyl-CoA: 19.3
Isobutyryl-CoA: 17.7
Acetyl-CoA: 13.6
2-Methylbutyryl-CoA: 12.3
trans-1,2-CPDA: 9.7
Benzoyl-CoA: 9.7
CHC-CoA: 8.4
3-Methylbutyryl-CoA: 0.0

B9W61_RS03425: Cys - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (227..627): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: THVSFDLSIWDGLGILGGDVGLGGNTEASILSCT
Nearest Stachelhaus code(s):: Leu DLLHLGLILK (35% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1298..1694): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: AETTHDMSVFDGNSFMGGDVSVGGPTETTLWNIW
Nearest Stachelhaus code(s):: Cys DMFNFGVLWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS03430: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (15..406): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FWASFDLSVFEANTNLAGEHNLYGPSEDTTYSTW
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS03525: pk - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (554..850): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; CE-Malonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 126.0
Methoxymalonyl-CoA: 120.1
Malonyl-CoA: 115.7
Ethylmalonyl-CoA: 97.8
Isobutyryl-CoA: 93.7
Propionyl-CoA: 73.1
Acetyl-CoA: 72.7
2-Methylbutyryl-CoA: 72.4
trans-1,2-CPDA: 63.7
Benzoyl-CoA: 57.7
CHC-CoA: 50.1
fatty_acid: 48.6
3-Methylbutyryl-CoA: 40.1
inactive: 33.0

AMP-binding (2354..2766): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAFDVFTGDREFVVGSDVNSYGLTEATIDSAY
Nearest Stachelhaus code(s):: Orn DVGEVGSIDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
NrtR	NAD synthesis repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195572.1 - Region 10 - NRPS,NRPS-like

Download region SVG

Location: 956,418 - 1,007,712 nt. (total: 51,295 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B9W61_RS03870: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase sulfotransferase transketolase

B9W61_RS03875: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

B9W61_RS03920: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

B9W61_RS03925: methyltransferase

smcogs: SMCOG1089: methyltransferase

B9W61_RS03935: methyltransferase

smcogs: SMCOG1089: methyltransferase

B9W61_RS03980: transketolase

smcogs: SMCOG1204: transketolase

Hydrolases: amidase

B9W61_RS03970: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase

B9W61_RS03880: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS03895: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.76	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.66	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (12):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.01 out of 23.43

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.35 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.61 out of 30.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.99 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.59 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.46 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.19 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.06 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 19, location 956417 - 1007712:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Lys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 20, location 956417 - 1004232:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Lys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 21, location 966059 - 1007712:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Lys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS03880: X - Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (445..807): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MRSTFDISVWEAQVVSIGEWNAYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQVGVIWK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1582..1963): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: lys (Lys)

Stachelhaus prediction details:

Stachelhaus sequence:: LAFPFDAAFGDPDTMVGGDHNHYGPTEATVCATS
Nearest Stachelhaus code(s):: CysA DATKMGHVGK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

B9W61_RS03895: X

AMP-binding (4..375): X

nrpys: Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDVAVADMCMIVAGEINAYGPTETTACATM
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (68% 8Å match); Tyr DAAIIAAVCK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description

NZ_KZ195572.1 - Region 11 - terpene

Download region SVG

Location: 1,037,325 - 1,063,900 nt. (total: 26,576 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W61_RS04200: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B9W61_RS04235: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

B9W61_RS04175: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B9W61_RS04240: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

B9W61_RS04250: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

B9W61_RS04195: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002508.2	0.48	other (other)	8-azaguanine	Streptomyces pathocidini

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002508.2	0.48	other (other)	8-azaguanine	Streptomyces pathocidini

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

B9W61_RS04190: T2TS

Domain 1 (25 - 652): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

B9W61_RS04195: PT_FPPS_like

Domain 1 (74 - 366): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

B9W61_RS04205: PT_phytoene_like

Domain 1 (6 - 289): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

B9W61_RS04210: PT_phytoene_like

Domain 1 (16 - 277): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.09 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

Additional weak hits (10):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.37 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.35 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.72 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.59 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.38 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.12 out of 26.06

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.51 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator

NZ_KZ195572.1 - Region 12 - terpene

Download region SVG

Location: 1,430,612 - 1,451,937 nt. (total: 21,326 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

B9W61_RS05825: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS05900: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: methyltransferase

B9W61_RS05855: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

B9W61_RS05845: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

B9W61_RS05860: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.90	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000866.5	0.48	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000671.3	0.41	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001590.5	0.41	PKS	formicamycin A, formicamycin B, formicamycin C, formicamycin D, formicamycin E, formicamycin F, formicamycin G, formicamycin H, formicamycin I, formicamycin J, formicamycin K, formicamycin L, formicamycin M, fasamycin C, fasamycin D, fasamycin E	Streptomyces sp. KY5
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000495.5	0.40	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000204.5	0.40	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.90	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000866.5	0.48	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000671.3	0.41	terpene	momilactone B	Oryza sativa Japonica Group
BGC0001590.5	0.41	PKS	formicamycin A, formicamycin B, formicamycin C, formicamycin D, formicamycin E, formicamycin F, formicamycin G, formicamycin H, formicamycin I, formicamycin J, formicamycin K, formicamycin L, formicamycin M, fasamycin C, fasamycin D, fasamycin E	Streptomyces sp. KY5
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000495.5	0.40	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000204.5	0.40	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

B9W61_RS05860: T1TS

Domain 1 (8 - 435): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.18 out of 23.79

Confidence: medium

Additional weak hits (5):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.42 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.55 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

NZ_KZ195572.1 - Region 13 - RiPP-like

Download region SVG

Location: 1,663,068 - 1,674,459 nt. (total: 11,392 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002298.2	0.34	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000351.5	0.33	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002579.2	0.31	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0002490.2	0.30	other (other)	yersinopine	Yersinia pestis CO92
BGC0000502.5	0.30	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0001427.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001424.4	0.29	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001421.4	0.29	NRPS, PKS	myxochromide B	Myxococcus sp.
BGC0001423.4	0.29	NRPS, PKS	myxochromide C	Myxococcus hansupus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002298.2	0.34	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000351.5	0.33	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002579.2	0.31	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0002490.2	0.30	other (other)	yersinopine	Yersinia pestis CO92
BGC0000502.5	0.30	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0001427.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001424.4	0.29	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001421.4	0.29	NRPS, PKS	myxochromide B	Myxococcus sp.
BGC0001423.4	0.29	NRPS, PKS	myxochromide C	Myxococcus hansupus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.74 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.10 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.30 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KZ195572.1 - Region 14 - NRPS,T2PKS,oligosaccharide

Download region SVG

Location: 1,750,870 - 1,830,299 nt. (total: 79,430 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

B9W61_RS07200: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W61_RS07225: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

B9W61_RS07250: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

B9W61_RS07280: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS07305: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

B9W61_RS07355: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

B9W61_RS07415: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B9W61_RS36120: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS36125: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acyltransferase aminotransferase glycosyltransferase transferase

B9W61_RS07180: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

B9W61_RS07190: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B9W61_RS07195: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B9W61_RS07205: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B9W61_RS07240: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

B9W61_RS07260: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

B9W61_RS07345: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

B9W61_RS37205: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: cyclase dehydratase

B9W61_RS07175: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B9W61_RS07235: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B9W61_RS07245: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B9W61_RS07275: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

B9W61_RS07300: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: ligase synthase

B9W61_RS07290: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B9W61_RS07295: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W61_RS07330: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS07360: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS07370: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: permease transporter

B9W61_RS07145: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

B9W61_RS07420: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001438.5	1.92	PKS, saccharide	warkmycin CS1, warkmycin CS2	Streptomyces sp. CS057
BGC0000231.5	1.14	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.96	PKS	oviedomycin	Streptomyces antibioticus
BGC0000278.3	0.94	PKS	urdamycin	Streptomyces fradiae
BGC0000234.5	0.93	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002135.2	0.89	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.78	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.77	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001438.5	0.97	PKS, saccharide	warkmycin CS1, warkmycin CS2	Streptomyces sp. CS057
BGC0000231.5	0.83	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.77	PKS	oviedomycin	Streptomyces antibioticus
BGC0000278.3	0.77	PKS	urdamycin	Streptomyces fradiae
BGC0000234.5	0.76	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.32 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.93 out of 26.85

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.13 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (17):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.16 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.44 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.37 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.88 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.64 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.60 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.93 out of 19.26

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.94 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.06 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.78 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.65 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.69 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 25, location 1750869 - 1830299:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 26, location 1750869 - 1823400:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 28, location 1775562 - 1830299:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Pro)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS07330: X - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (477..871): X

nrpys: Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHAFDNFCSELTLEVGGEFNTYGPTETTVDATS
Nearest Stachelhaus code(s):: bOH-Tyr DASTIAAVDK (65% 8Å match); Lys DADDAGTVDK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1535..1946): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWNSFDISEHESHAMQAGEHNHYGPSETHIVTGY
Nearest Stachelhaus code(s):: Hpr DIQFSAHVVK (71% 8Å match); Pro DVQHIAHVVK (59% 8Å match); Gly DIFHMGMIWK (53% 8Å match); cohOhi DVHIIAYIVK (50% 8Å match)
Stachelhaus code match:: 60% (weak)

B9W61_RS07360: X

AMP-binding (450..853): X

nrpys: OH-Asp, Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVSTDLGNTAPKIVMGGEYNHYGPSETTVGVLC
Nearest Stachelhaus code(s):: OH-Asp DLTKVGHVGK (76% 8Å match); Asp DLTKVGHVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Type II PKS gene cluster prediction details

Cluster section:: 1750869 to 1823400
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 680.6; E-value: 1.4e-207)
Product class(es):: angucycline
Product molecular weight(s):: acetyl-CoA_8: 1106 Da
acetyl-CoA_9: 1148 Da

B9W61_RS07190: GT (Score: 362.2; E-value: 1e-110)
B9W61_RS07195: GT (Score: 355.9; E-value: 8.2e-109)
B9W61_RS07205: GT (Score: 416.4; E-value: 3.4e-127)
B9W61_RS07250: KR (Score: 177.5; E-value: 9.1e-55)
B9W61_RS07275: CYC C7-C12 (Score: 485.7; E-value: 1e-148)
B9W61_RS07280: KR C9 (Score: 470.5; E-value: 3.1e-144)
B9W61_RS07285: ACP (Score: 109.7; E-value: 1.2e-34)
B9W61_RS07290: CLF 8|9 (Score: 680.6; E-value: 1.4e-207)
B9W61_RS07295: KS (Score: 773.7; E-value: 9.4e-236)
B9W61_RS07300: CYC C4-C17/C2-C19 (Score: 186.4; E-value: 1.2e-57)
B9W61_RS07305: OXY (Score: 608.8; E-value: 1.7e-185)
B9W61_RS07405: OXY (Score: 52.1; E-value: 1.3e-16)
B9W61_RS36120: KR C15 (Score: 463.4; E-value: 4e-142)
B9W61_RS36125: OXY (Score: 553.8; E-value: 8.2e-169)
B9W61_RS37205: GT (Score: 338.6; E-value: 1.5e-103)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_KZ195572.1 - Region 15 - hydrogen-cyanide

Download region SVG

Location: 1,906,371 - 1,919,223 nt. (total: 12,853 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

B9W61_RS07795: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

B9W61_RS07800: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B9W61_RS37210: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: deaminase

B9W61_RS07765: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000595.3	0.29	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000135.5	0.23	PKS	reveromycin A	Streptomyces sp. SN-593
BGC0000378.5	0.22	NRPS	Kutzneride 1, Kutzneride 2, Kutzneride 3, Kutzneride 4, Kutzneride 5, Kutzneride 6, Kutzneride 7, Kutzneride 8	Kutzneria sp. 744

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000595.3	0.29	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000135.5	0.23	PKS	reveromycin A	Streptomyces sp. SN-593
BGC0000378.5	0.22	NRPS	Kutzneride 1, Kutzneride 2, Kutzneride 3, Kutzneride 4, Kutzneride 5, Kutzneride 6, Kutzneride 7, Kutzneride 8	Kutzneria sp. 744

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.35 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.93 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.01 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.81 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KZ195572.1 - Region 16 - NI-siderophore

Download region SVG

Location: 2,040,232 - 2,072,953 nt. (total: 32,722 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B9W61_RS08285: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

B9W61_RS08330: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

B9W61_RS08280: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.03 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.17 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (10):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.25 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.39 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.95 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.88 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_KZ195572.1 - Region 17 - terpene

Download region SVG

Location: 2,475,865 - 2,496,842 nt. (total: 20,978 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

B9W61_RS10145: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: cyclase hydratase

B9W61_RS10120: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

B9W61_RS10155: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002651.2	0.35	terpene	sordaricin B	Rosellinia necatrix
BGC0000885.3	0.29	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001866.4	0.29	PKS	viriditoxin	Byssochlamys spectabilis
BGC0000518.3	0.28	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002196.2	0.27	PKS	clavatol	Penicillium crustosum
BGC0002553.2	0.27	other (other)	tunicamycin	Rathayibacter iranicus
BGC0000913.3	0.26	other (other)	MK-8	Enterobacter cloacae
BGC0002034.3	0.25	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000875.4	0.25	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0000157.5	0.25	PKS	tautomycetin	Streptomyces sp. CK4412

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002651.2	0.35	terpene	sordaricin B	Rosellinia necatrix
BGC0000885.3	0.29	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001866.4	0.29	PKS	viriditoxin	Byssochlamys spectabilis
BGC0000518.3	0.28	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002196.2	0.27	PKS	clavatol	Penicillium crustosum
BGC0002553.2	0.27	other (other)	tunicamycin	Rathayibacter iranicus
BGC0000913.3	0.26	other (other)	MK-8	Enterobacter cloacae
BGC0002034.3	0.25	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000875.4	0.25	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0000157.5	0.25	PKS	tautomycetin	Streptomyces sp. CK4412

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

B9W61_RS10120: T1TS

Domain 1 (1 - 305): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (13):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.84 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.07 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.03 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.61 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.75 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.11 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.83 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.31 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.65 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_KZ195572.1 - Region 18 - triceptide

Download region SVG

Location: 2,687,480 - 2,708,876 nt. (total: 21,397 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.39	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000043.5	0.36	PKS	curacin A	Moorea producens 19L
BGC0000515.4	0.33	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.32	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000556.5	0.32	ribosomal	streptin	Streptococcus pyogenes
BGC0000536.3	0.31	ribosomal	nisin Q	Lactococcus lactis
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000535.4	0.31	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000559.4	0.31	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000537.3	0.31	ribosomal	nisin U	Streptococcus uberis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.39	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000043.5	0.36	PKS	curacin A	Moorea producens 19L
BGC0000515.4	0.33	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.32	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000556.5	0.32	ribosomal	streptin	Streptococcus pyogenes
BGC0000536.3	0.31	ribosomal	nisin Q	Lactococcus lactis
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000535.4	0.31	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000559.4	0.31	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000537.3	0.31	ribosomal	nisin U	Streptococcus uberis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.61 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.59 out of 23.43

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.19 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.62 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.17 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.86 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_KZ195572.1 - Region 19 - terpene-precursor

Download region SVG

Location: 2,736,956 - 2,757,999 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

B9W61_RS11180: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

B9W61_RS11215: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.35	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.35	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000644.3	0.34	terpene	carotenoid	Dietzia sp. CQ4
BGC0000666.5	0.34	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.35	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.35	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000678.5	0.35	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000644.3	0.34	terpene	carotenoid	Dietzia sp. CQ4
BGC0000666.5	0.34	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

B9W61_RS11215: PT_FPPS_like

Domain 1 (58 - 344): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.11 out of 23.79

Confidence: medium

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 26.86 out of 30.98

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

Additional weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.03 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.56 out of 27.04

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.12 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.43 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.28 out of 23.43

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.67 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
NuR	Nickel-responsive regulator
ToxT	Regulator of MSHA biosynthesis

NZ_KZ195572.1 - Region 20 - lanthipeptide-class-iii

BGC0000553.3 (SSGG_RS09925):

Download region SVG

Location: 2,894,156 - 2,916,786 nt. (total: 22,631 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase aminotransferase

B9W61_RS11905: aminotransferase

smcogs: SMCOG1019: aminotransferase

B9W61_RS11960: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: glucosidase

B9W61_RS11975: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.90	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.71	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.54	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.90	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.71	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.54	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for B9W61_RS11945

B9W61_RS11940

Leader:

MALLDLQAMDTPAEDSFGELAT

Core:

GSQVSLLVCEYSSLSVVLCTP

Core with dehydrations:

GDhaQVDhaLLVCysEYDhaDhaLDhaVVLCysDhbP

antiSMASH-DB 4.0 matches for B9W61_RS11940

100.0%

NC_010572.1and 60 others:

NC_021177.1 Lanthipeptides: SFUL_RS24355_lanthipeptideNZ_AQRK01000102.1 Lanthipeptides: YUW_RS30025_lanthipeptideNZ_ARPF01000003.1 Lanthipeptides: B083_RS0107255_lanthipeptideNZ_BMRY01000001.1 Lanthipeptides: IE140_RS02070_lanthipeptideNZ_BMSP01000003.1 Lanthipeptides: IE150_RS06495_lanthipeptideNZ_BMSZ01000003.1 Lanthipeptides: IE135_RS07550_lanthipeptideNZ_BMTW01000017.1 Lanthipeptides: IE134_RS28550_lanthipeptideNZ_BMUG01000009.1 Lanthipeptides: IE264_RS25430_lanthipeptideNZ_BMVK01000002.1 Lanthipeptides: IE272_RS07115_lanthipeptideNZ_BNBJ01000002.1 Lanthipeptides: IE304_RS05195_lanthipeptideNZ_CM003601.1 Lanthipeptides: JI76_RS25200_lanthipeptideNZ_CP010833.1 Lanthipeptides: TK78_RS10875_lanthipeptideNZ_CP011522.1 Lanthipeptides: ABE83_RS11805_lanthipeptideNZ_CP013738.1 Lanthipeptides: WQO_RS23525_lanthipeptideNZ_CP015362.1 Lanthipeptides: A6E92_RS09975_lanthipeptideNZ_CP020563.1 Lanthipeptides: B7C62_RS24450_lanthipeptideNZ_CP020570.1 Lanthipeptides: B1H20_RS34690_lanthipeptideNZ_CP024957.1 Lanthipeptides: CVT27_RS22730_lanthipeptideNZ_CP029361.1 Lanthipeptides: DIJ69_RS10225_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS22865_lanthipeptideNZ_CP061072.1 Lanthipeptides: HYC88_RS10560_lanthipeptideNZ_CP079114.1 Lanthipeptides: KV381_RS24895_lanthipeptideNZ_CP084357.1 Lanthipeptides: LEL86_RS29435_lanthipeptideNZ_CP086102.1 Lanthipeptides: LK895_RS11660_lanthipeptideNZ_CP090837.1 Lanthipeptides: LZ559_RS24025_lanthipeptideNZ_CP096281.1 Lanthipeptides: MWG59_RS25685_lanthipeptideNZ_CP101397.1 Lanthipeptides: NLU04_RS06465_lanthipeptideNZ_CP110539.1 Lanthipeptides: OH133_RS12690_lanthipeptideNZ_CP112880.1 Lanthipeptides: N7925_RS11185_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS22935_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS24530_lanthipeptideNZ_DS999644.1 Lanthipeptides: SSGG_RS09925_lanthipeptideNZ_GL877172.1 Lanthipeptides: SACT1_RS12960_lanthipeptideNZ_JAAWWP010000002.1 Lanthipeptides: HFV08_RS04115_lanthipeptideNZ_JAGGOV010000004.1 Lanthipeptides: J7E92_RS02930_lanthipeptideNZ_JAHHWT010000009.1 Lanthipeptides: KM153_RS24430_lanthipeptideNZ_JALDPQ010000064.1 Lanthipeptides: MQC87_RS23965_lanthipeptideNZ_JAMFLF010000002.1 Lanthipeptides: M1212_RS07295_lanthipeptideNZ_JANRMN010000004.1 Lanthipeptides: NW249_RS08610_lanthipeptideNZ_JNLT01000003.1 Lanthipeptides: CD02_RS0108685_lanthipeptideNZ_KB890925.1 Lanthipeptides: B053_RS0113845_lanthipeptideNZ_KL573549.1 Lanthipeptides: BG84_RS0119125_lanthipeptideNZ_KQ257779.1 Lanthipeptides: IQ60_RS22540_lanthipeptideNZ_KZ195572.1 Lanthipeptides: B9W61_RS11940_lanthipeptideNZ_KZ679082.1 Lanthipeptides: C6W96_RS24050_lanthipeptideNZ_KZ819154.1 Lanthipeptides: DBP12_RS10285_lanthipeptideNZ_KZ819178.1 Lanthipeptides: DBP20_RS23960_lanthipeptideNZ_KZ819182.1 Lanthipeptides: DBP21_RS24660_lanthipeptideNZ_LACR01000009.1 Lanthipeptides: YW5_RS12280_lanthipeptideNZ_LIPB01000001.1 Lanthipeptides: AMK17_RS03280_lanthipeptideNZ_LIPE01000001.1 Lanthipeptides: AMK12_RS03355_lanthipeptideNZ_LIVT01000001.1 Lanthipeptides: AMK24_RS01700_lanthipeptideNZ_LIVW01000001.1 Lanthipeptides: AMK28_RS03165_lanthipeptideNZ_LIXK01000001.1 Lanthipeptides: AMK23_RS04085_lanthipeptideNZ_LMEL01000012.1 Lanthipeptides: ASD29_RS10010_lanthipeptideNZ_LZRD01000054.1 Lanthipeptides: A3Q37_RS33745_lanthipeptideNZ_ML123117.1 Lanthipeptides: EES46_RS10300_lanthipeptideNZ_NNBN01000004.1 Lanthipeptides: CG717_RS12310_lanthipeptideNZ_VEHK01000004.1 Lanthipeptides: FS984_RS13530_lanthipeptideNZ_WWGD01000029.1 Lanthipeptides: GTY72_RS23245_lanthipeptide

Lanthipeptides: SGR_RS11800_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCEYSSLSVVLCTP

1

GSQVSLLVCEYSSLSVVLCTP

21

95.2%

NZ_BDHJ01000008.1and 4 others:

NZ_CP032543.1 Lanthipeptides: D6270_RS22715_lanthipeptideNZ_CP076457.1 Lanthipeptides: KME66_RS09945_lanthipeptideNZ_CP077652.1 Lanthipeptides: KRR37_RS22855_lanthipeptideNZ_WUEJ01000001.1 Lanthipeptides: GRQ63_RS04560_lanthipeptide

Lanthipeptides: BHQ08_RS03045_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCEYSSLSV LCTP

1

GSQVSLLVCEYSSLSVTLCTP

21

95.2%

NZ_CP010519.1and 1 other:

NZ_CP092644.1 Lanthipeptides: MID12_RS21330_lanthipeptide

Lanthipeptides: SLNWT_RS22370_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCEYSSLSVVLC+P

1

GSQVSLLVCEYSSLSVVLCSP

21

with 77 more sequence matches

Only the first 10 are displayed here.

95.2%

NZ_CP045178.1:

Lanthipeptides: GBW32_RS28450_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLL+CEYSSLSVVLCTP

1

GSQVSLLICEYSSLSVVLCTP

21

95.2%

NZ_CP054926.1and 11 others:

NZ_CP068598.1 Lanthipeptides: IFE09_RS23820_lanthipeptideNZ_CP071044.1 Lanthipeptides: JHY03_RS23495_lanthipeptideNZ_CP080029.1 Lanthipeptides: KZO11_RS24935_lanthipeptideNZ_JAJUKK010000008.1 Lanthipeptides: LXH09_RS27635_lanthipeptideNZ_JOJC01000009.1 Lanthipeptides: IO23_RS0108435_lanthipeptideNZ_KB891296.1 Lanthipeptides: B061_RS0103425_lanthipeptideNZ_KZ268499.1 Lanthipeptides: CE422_RS23450_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS22830_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS10975_lanthipeptideNZ_LZQS01000001.1 Lanthipeptides: STIB_RS05225_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS24840_lanthipeptide

Lanthipeptides: HUT09_RS23550_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCE+SSLSVVLCTP

1

GSQVSLLVCEFSSLSVVLCTP

21

95.2%

NZ_CP058556.1and 5 others:

NZ_CP059898.1 Lanthipeptides: H3V39_RS22935_lanthipeptideNZ_CP070242.1 Lanthipeptides: I6J39_RS23755_lanthipeptideNZ_CP070260.1 Lanthipeptides: I6J40_RS10935_lanthipeptideNZ_JAJDST010000047.1 Lanthipeptides: LJC81_RS16960_lanthipeptideNZ_WWGL01000003.1 Lanthipeptides: GTY38_RS03410_lanthipeptide

Lanthipeptides: HXS80_RS11105_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVS+LVCEYSSLSVVLCTP

1

GSQVSVLVCEYSSLSVVLCTP

21

90.5%

NZ_CM001165.1and 4 others:

NZ_CP021118.1 Lanthipeptides: CAC01_RS28155_lanthipeptideNZ_CP049945.1 Lanthipeptides: G9U55_RS17850_lanthipeptideNZ_CP119149.1 Lanthipeptides: P0D76_RS02270_lanthipeptideNZ_RWGV01000033.1 Lanthipeptides: EJA11_RS20985_lanthipeptide

Lanthipeptides: STTU_RS29395_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLL+CEYSSLSV LCTP

1

GSQVSLLICEYSSLSVTLCTP

21

85.7%

NC_020990.1and 26 others:

NZ_AMPN02000002.1 Lanthipeptides: SM8_RS12785_lanthipeptideNZ_AP025692.1 Lanthipeptides: MTP06_RS18190_lanthipeptideNZ_CM002273.1 Lanthipeptides: B590_RS12280_lanthipeptideNZ_CP009802.1 Lanthipeptides: SFR_RS12925_lanthipeptideNZ_CP014485.1 Lanthipeptides: Salbus254_RS12710_lanthipeptideNZ_CP016824.1 Lanthipeptides: BEN82_RS18165_lanthipeptideNZ_CP026490.1 Lanthipeptides: C3K23_RS19520_lanthipeptideNZ_CP031742.1 Lanthipeptides: D0C37_RS13445_lanthipeptideNZ_CP047147.1 Lanthipeptides: GR131_RS18520_lanthipeptideNZ_CP053539.1 Lanthipeptides: HN026_RS11800_lanthipeptideNZ_CP056773.1 Lanthipeptides: HWN34_RS12245_lanthipeptideNZ_CP063844.1 Lanthipeptides: IPZ55_RS12410_lanthipeptideNZ_CP064783.1 Lanthipeptides: IT782_RS12060_lanthipeptideNZ_CP076385.1 Lanthipeptides: KNZ81_RS12450_lanthipeptideNZ_CP079112.1 Lanthipeptides: STALF2_RS18135_lanthipeptideNZ_CP091820.1 Lanthipeptides: L2I08_RS02835_lanthipeptideNZ_CP106650.1 Lanthipeptides: B591_RS12385_lanthipeptideNZ_CP113103.1 Lanthipeptides: OSU72_RS17905_lanthipeptideNZ_JAHUVY010000001.1 Lanthipeptides: STALF3_RS17905_lanthipeptideNZ_JALLPQ010000001.1 Lanthipeptides: MWG58_RS12385_lanthipeptideNZ_KB890715.1 Lanthipeptides: B048_RS0115750_lanthipeptideNZ_KN549183.1 Lanthipeptides: D076_RS30740_lanthipeptideNZ_KZ195583.1 Lanthipeptides: B9W68_RS12440_lanthipeptideNZ_MNPQ01000004.1 Lanthipeptides: BGV78_RS11170_lanthipeptideNZ_OX371412.1 Lanthipeptides: OZE77_RS18215_lanthipeptideNZ_VOGX01000092.1 Lanthipeptides: FRZ02_RS31600_lanthipeptide

Lanthipeptides: XNR_RS11575_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQ+SLL+CEYSSLSV LCTP

1

GSQISLLICEYSSLSVTLCTP

21

85.7%

NZ_AQRJ01000051.1and 1 other:

NZ_LFBV01000002.1 Lanthipeptides: AB852_RS09920_lanthipeptide

Lanthipeptides: YW7_RS14945_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSL+VCEYSSLS +LCTP

1

GSQVSLIVCEYSSLSALLCTP

21

85.7%

NZ_CP045702.1:

Lanthipeptides: F0344_RS33200_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCE+SSLS+ LCTP

1

GSQVSLLVCEHSSLSLTLCTP

21

85.7%

NZ_ML123034.1:

Lanthipeptides: EES43_RS19795_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLL+CE+SSLSV LCTP

1

GSQVSLLICEFSSLSVTLCTP

21

81.0%

NZ_LWLE01000019.1:

Lanthipeptides: A6A29_RS44250_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLL+CE+SSLS+ LCTP

1

GSQVSLLICEHSSLSLTLCTP

21

61.9%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCT

20

GSQ SLL+C SSLSV C

2

GSQASLLLCGDSSLSVTTCN

21

MIBiG 4.0 matches for B9W61_RS11940

95.5%

Lanthipeptide: SRO15-2212

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCEYSSLSVVLCTP

2

GSQVSLLVCEYSSLSVVLCTP

22

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.11 out of 23.79

Confidence: medium

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.37 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.51 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.91 out of 20.01

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.57 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.69 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.10 out of 35.63

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

B9W61_RS11940 - Class III

Cleavage pHMM score: 31.80

RODEO score: 0

Monoisotopic mass: 2075.1 Da

Molecular weight: 2076.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2094.4 Da N = 1; 2112.4 Da N = 2; 2130.5 Da N = 3; 2148.5 Da N = 4

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_KZ195572.1 - Region 21 - melanin

Download region SVG

Location: 2,957,643 - 2,968,065 nt. (total: 10,423 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: esterase

B9W61_RS12205: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.91	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.59	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.55	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.34	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.33	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.30	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.91	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.59	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.55	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.34	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.33	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.30	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

Additional weak hits (1):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195572.1 - Region 22 - azole-containing-RiPP

Download region SVG

Location: 2,989,077 - 3,017,962 nt. (total: 28,886 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B9W61_RS12365: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase glycosyltransferase methyltransferase transferase

B9W61_RS12410: methyltransferase

smcogs: SMCOG1248: methyltransferase

B9W61_RS12415: methyltransferase

smcogs: SMCOG1089: methyltransferase

B9W61_RS12420: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B9W61_RS12425: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

B9W61_RS12430: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

B9W61_RS12440: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Lyases: dehydratase

B9W61_RS12435: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

B9W61_RS12350: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.55	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000749.3	0.53	saccharide	capsular polysaccharide	Escherichia coli
BGC0000791.3	0.52	saccharide	O-antigen	Cronobacter sakazakii
BGC0000898.5	0.52	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000813.3	0.51	other (other)	K-252a	Nonomuraea longicatena
BGC0000825.5	0.51	other (other)	staurosporine	Streptomyces sp. TP-A0274
BGC0000278.3	0.51	PKS	urdamycin	Streptomyces fradiae
BGC0001146.5	0.50	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000193.3	0.50	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000826.5	0.50	other (other)	staurosporine	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.55	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000749.3	0.53	saccharide	capsular polysaccharide	Escherichia coli
BGC0000791.3	0.52	saccharide	O-antigen	Cronobacter sakazakii
BGC0000898.5	0.52	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000813.3	0.51	other (other)	K-252a	Nonomuraea longicatena
BGC0000825.5	0.51	other (other)	staurosporine	Streptomyces sp. TP-A0274
BGC0000278.3	0.51	PKS	urdamycin	Streptomyces fradiae
BGC0001146.5	0.50	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000193.3	0.50	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000826.5	0.50	other (other)	staurosporine	Streptomyces clavuligerus ATCC 27064

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

Additional weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.78 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.88 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.47 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.12 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.75 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.71 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.16 out of 30.97

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.65 out of 19.26

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.19 out of 24.78

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.74 out of 29.72

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.54 out of 26.85

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 0 - 82; Score: 33.3

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_KZ195572.1 - Region 23 - NRPS-like,T1PKS

Download region SVG

Location: 3,024,127 - 3,079,352 nt. (total: 55,226 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

B9W61_RS12515: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

B9W61_RS12580: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS12645: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

Transferases: acylase

B9W61_RS36870: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

B9W61_RS12575: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: lyase

B9W61_RS12595: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

B9W61_RS12585: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

B9W61_RS12500: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.68	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.88 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.91 out of 23.79

Confidence: medium

Additional weak hits (18):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.31 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.61 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.79 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.29 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.36 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.11 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.94 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.33 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.76 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.75 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.83 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.67 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.45 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.78 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.25 out of 20.01

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.92 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.07 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 37, location 3024126 - 3079352:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (aThr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 38, location 3024126 - 3067663:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (aThr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 39, location 3036712 - 3079352:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (aThr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS36870: mal

PKS_AT (616..898): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 120.6
inactive: 74.1
Methoxymalonyl-CoA: 56.7
Methylmalonyl-CoA: 56.6
Isobutyryl-CoA: 39.7
Propionyl-CoA: 37.8
Ethylmalonyl-CoA: 35.3
CHC-CoA: 32.4
fatty_acid: 23.4
Benzoyl-CoA: 19.0
trans-1,2-CPDA: 15.7
Acetyl-CoA: 14.2
2-Methylbutyryl-CoA: 13.8
3-Methylbutyryl-CoA: 12.1

B9W61_RS12585: aThr

Search NORINE for peptide: strict or relaxed

AMP-binding (299..683): aThr

nrpys: aThr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAVHFDFSVWEGSQVLGGEVNMYGITETTVHVTA
Nearest Stachelhaus code(s):: aThr DFWSVGMVHK (94% 8Å match); Thr DFWSVGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195572.1 - Region 24 - NRPS,T1PKS,arylpolyene,butyrolactone,ectoine,terpene-precursor

Download region SVG

Location: 3,997,845 - 4,136,010 nt. (total: 138,166 nt) Show pHMM detection rules used

ectoine: ectoine_synt
butyrolactone: AfsA
arylpolyene: (APE_KS1 or APE_KS2)
terpene-precursor: (PT_FPPS_like and not PT_HPP)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

B9W61_RS16865: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B9W61_RS16915: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS16935: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

B9W61_RS17045: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B9W61_RS17055: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B9W61_RS17075: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W61_RS17115: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

B9W61_RS17180: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

B9W61_RS17230: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B9W61_RS17235: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase acylase methyltransferase transferase

B9W61_RS16885: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

B9W61_RS16970: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

B9W61_RS16980: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B9W61_RS17100: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

B9W61_RS17185: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: esterase hydrolase

B9W61_RS17080: thioesterase

smcogs: SMCOG1004: thioesterase

B9W61_RS17240: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase synthetase

B9W61_RS16850: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS16975: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

B9W61_RS17000: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W61_RS17005: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W61_RS17010: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W61_RS17025: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B9W61_RS17060: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS17065: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS17070: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS17190: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W61_RS17195: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS17210: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS17215: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS17220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002676.2	1.56	NRPS	skyllamycin D, skyllamycin E	Streptomyces anulatus
BGC0000429.4	1.56	NRPS, PKS	skyllamycin A, skyllamycin B	Streptomyces sp. Acta 2897
BGC0001164.3	1.42	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	1.40	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002276.2	1.23	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002135.2	1.13	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.09	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	1.08	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	1.07	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	1.04	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002676.2	0.89	NRPS	skyllamycin D, skyllamycin E	Streptomyces anulatus
BGC0000429.4	0.88	NRPS, PKS	skyllamycin A, skyllamycin B	Streptomyces sp. Acta 2897
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

B9W61_RS16975: PT_FPPS_like

Domain 1 (55 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.16 out of 23.79

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.40 out of 27.55

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.34 out of 20.01

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.22 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.91 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.13 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.24 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.49 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.37 out of 27.04

Confidence: medium

Additional weak hits (44):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.16 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.74 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.81 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.77 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.42 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.31 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.32 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.33 out of 30.22

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.24 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.78 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.90 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.74 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.86 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.47 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.73 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.85 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.05 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.77 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 26.85

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.21 out of 32.93

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.97 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.26 out of 29.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.93 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.57 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.65 out of 23.43

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.49 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.83 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.56 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.77 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.12 out of 36.53

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.96 out of 32.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 40, location 3997844 - 4049145:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Ala - X - D-Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 43, location 4008011 - 4049145:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Ala - X - D-Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 45, location 4017881 - 4136010:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Ala - X - D-Gly) + (Phe - Pro - X - D-Trp) + (Gly - D-Leu - Leu) + (mal) + (Fo-OH-Orn) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 46, location 4017881 - 4098019:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Ala - X - D-Gly) + (Phe - Pro - X - D-Trp) + (Gly - D-Leu - Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 47, location 4082296 - 4136010:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Fo-OH-Orn) + (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS16850: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (1..382): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FWASFDLALLDTQGVFTGEHNVFGCTETNDSFIQ
Nearest Stachelhaus code(s):: bPhe DAFQVTVIMK (38% 8Å match); Gly DILQVGVIWK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

B9W61_RS16980: mal

PKS_AT (8..293): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 91.5
Methoxymalonyl-CoA: 42.9
Methylmalonyl-CoA: 39.5
inactive: 28.9
Propionyl-CoA: 11.4
2-Methylbutyryl-CoA: 9.9
trans-1,2-CPDA: 6.4
Isobutyryl-CoA: 5.4
Acetyl-CoA: 5.2
Ethylmalonyl-CoA: 4.7
Benzoyl-CoA: 4.4
CHC-CoA: 3.6
3-Methylbutyryl-CoA: 0.0
fatty_acid: -0.2

B9W61_RS17060: Thr - Ala - X - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (461..877): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1538..1939): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEASAVLAGEANFYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAFVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2599..3004): X

nrpys: bMe-Asp, Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWSSFDLTVTATKAMLGGEYNGYGPTETTVNCTQ
Nearest Stachelhaus code(s):: bMe-Asp or Asp DLTKMGGVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3664..4060): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FDMTFDIAALEVQALVGGERNMYGPTETTVWSTT
Nearest Stachelhaus code(s):: Gly DILQLGMVWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS17065: Phe - Pro - X - Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (461..856): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDAAFWEMTIVVAGEINAYGPSETTVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1514..1923): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVSAQESYAAQAGEHNHYGPSETHVVTAH
Nearest Stachelhaus code(s):: Pro DVQYAAHVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2582..2976): X

nrpys: omeTyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FIRAFDAAIWEANIILAGELNAYGPTEATVCVTV
Nearest Stachelhaus code(s):: omeTyr DAWNIAAVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3639..4036): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSHVFDVSVGDMMLVSGGEINAYGPTETTVAATL
Nearest Stachelhaus code(s):: Trp DVGMVGAVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS17070: Gly - Leu - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (462..858): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LDMTFDISALEVQALVGGESNVYGPTETTVWSTT
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1519..1917): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSCSFDASVLEMLIVVGGDVNAYGPTEATVAVTM
Nearest Stachelhaus code(s):: Leu DALLVGAVAK (100% 8Å match); 3OH-Leu DALLVGAVAK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3060..3457): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSCSFDASVLEMLIVVGGDVNAYGPTEATVAVTM
Nearest Stachelhaus code(s):: Leu DALLVGAVAK (100% 8Å match); 3OH-Leu DALLVGAVAK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS17110: X

A-OX (0..351): X

No predictions made

B9W61_RS17190: mal

PKS_AT (536..822): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 81.0
Methoxymalonyl-CoA: 58.0
inactive: 56.0
Methylmalonyl-CoA: 30.4
Propionyl-CoA: 23.4
Isobutyryl-CoA: 17.5
Benzoyl-CoA: 15.2
fatty_acid: 9.0
Ethylmalonyl-CoA: 1.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

B9W61_RS17195: Fo-OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (532..935): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISINELYLWCGGEYHGYGPAEATIGVTC
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS17210: X

AMP-binding (560..955): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TCVSFDLSVYDGNCILGGDAGLGGTTEAAIHSTV
Nearest Stachelhaus code(s):: Ser DLYNLGLIHK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

B9W61_RS17215: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (33..442): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NAALYTMNCPGGAIQIGSAQQVFGMAEGLLCLTR
Nearest Stachelhaus code(s):: Hpa TWPSQGVLCK (82% 8Å match); diOH-Bz PLPAQGVLCK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

B9W61_RS17220: X

AMP-binding (15..416): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWTSFDLSTFDGYAAFAGEYNLYGPTETNVCTFE
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195572.1 - Region 25 - ectoine,t3nrps-iterative

Download region SVG

Location: 4,869,105 - 4,913,195 nt. (total: 44,091 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W61_RS20695: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B9W61_RS20730: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase

B9W61_RS20770: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: decarboxylase

B9W61_RS20745: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

B9W61_RS20830: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase

B9W61_RS20760: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

B9W61_RS20665: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.84	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.83	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.75	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.65	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.65	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.64	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.57	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.73	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.73	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.65	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 25.07 out of 27.04

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.25 out of 27.04

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (10):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.94 out of 27.04

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.82 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 39.62

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.83 out of 26.12

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.83 out of 25.88

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.11 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.86 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.97 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

B9W61_RS20760: X

AMP-binding (18..410): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGLYQLAGTNTGAQVMYGLTECKRAAIM
Nearest Stachelhaus code(s):: Asp DYYPTTMRAK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
DasR	N-acetylglucosamine dependent repressor

NZ_KZ195572.1 - Region 26 - NI-siderophore

Download region SVG

Location: 5,666,236 - 5,696,014 nt. (total: 29,779 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B9W61_RS24275: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: methyltransferase

B9W61_RS24330: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

B9W61_RS24250: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: decarboxylase

B9W61_RS24280: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.86	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.75	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.69	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.69	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002464.3	0.62	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.86	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.75	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.69	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.69	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002464.3	0.62	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 35.53 out of 36.53

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.56 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.29 out of 30.11

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 27.04

Confidence: medium

Additional weak hits (11):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.58 out of 30.11

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.28 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.84 out of 26.85

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.62 out of 23.43

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.72 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.72 out of 23.43

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.45 out of 36.53

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.73 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor

NZ_KZ195572.1 - Region 27 - lanthipeptide-class-ii,lanthipeptide-class-iii

Download region SVG

Location: 5,761,580 - 5,793,275 nt. (total: 31,696 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

B9W61_RS24690: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: protease

B9W61_RS24620: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

B9W61_RS24670: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.38	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000496.5	0.37	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.36	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000525.5	0.36	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001226.4	0.36	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000519.4	0.35	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000563.4	0.35	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000501.3	0.35	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000513.3	0.32	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000496.5	0.50	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001226.4	0.49	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000563.4	0.49	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000513.3	0.47	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for B9W61_RS24650

allorf_5767376_5767489

Leader:

MAGPSLPGA

Core:

VRSGGGRSHRESTPACTGPAAVNPAPGP

Core with dehydrations:

VRDhaGGGRDhaHREDhaDhbPACysDhbGPAAVNPAPGP

antiSMASH-DB 4.0 matches for allorf_5767376_5767489

100.0%

NZ_KZ195572.1:

Lanthipeptides: allorf_5767376_5767489_lanthipeptide

1

VRSGGGRSHRESTPACTGPAAVNPAPGP

28

VRSGGGRSHRESTPACTGPAAVNPAPGP

1

VRSGGGRSHRESTPACTGPAAVNPAPGP

28

96.4%

NZ_CP086102.1:

Lanthipeptides: allorf_5763901_5764014_lanthipeptide

1

VRSGGGRSHRESTPACTGPAAVNPAPGP

28

VRSGGGRS+RESTPACTGPAAVNPAPGP

1

VRSGGGRSYRESTPACTGPAAVNPAPGP

28

70.6%

NZ_CP080029.1:

Lanthipeptides: allorf_2646689_2646820_lanthipeptide

1

VRSGG-GRSHRES-----TPACTGPAAVNPAPGP

28

VRSGG GR HR + PACTGPAAVNPAPGP

1

VRSGGVGRVHRAAGQPFGAPACTGPAAVNPAPGP

34

with 13 more sequence matches

Only the first 10 are displayed here.

30.6%

NZ_GL877172.1:

Lanthipeptides: allorf_5847948_5848169_lanthipeptide

13

TPACTGPAAVNPAPGP

28

PA T PAA+NP PGP

19

VPAGTAPAALNPPPGP

34

30.0%

NZ_JALPRT010000019.1and 2 others:

NZ_KB892552.1 Lanthipeptides: allorf_24571_24714_lanthipeptideNZ_KB896162.1 Lanthipeptides: allorf_034222_034365_lanthipeptide

Lanthipeptides: allorf_071464_071607_lanthipeptide

1

VRSGGGRSHRESTPACTGPAAVNPAPG

27

+RS ++R PA GPAA APG

10

IRSAISMTNR---PALVGPAAARHAPG

33

28.6%

NZ_FTML01000041.1:

Lanthipeptides: BW937_RS20030_lanthipeptide

6

GRSHRESTPACTG

18

G ESTPAC G

1

GDVQPESTPACVG

13

25.8%

NZ_BOSE01000001.1:

Lassopeptides: allorf_0813342_0813494_lassopeptide

4

GGGRSHRESTPACT

17

G GRS ES+ AC+

1

GSGRSKTESSSACS

14

25.8%

NZ_JQBU01000033.1and 1 other:

NZ_JQBV01000009.1 Lanthipeptides: IV76_RS12120_lanthipeptide

Lanthipeptides: IV75_RS14620_lanthipeptide

11

ESTPACTGPAAVNPAPG

27

ESTP C G A + + G

6

ESTPICAGFATLMSSIG

22

25.8%

NZ_SDJV01000024.1:

Lanthipeptides: ES032_RS12700_lanthipeptide

6

GRSHRESTPACTGPAAVNPAPG

27

G E+TPAC A++ + G

1

GDVQVETTPACAFTASILVSYG

22

25.0%

NZ_CP059572.1:

Lanthipeptides: AGRA3207_RS17530_lanthipeptide

8

SHRESTPACTGP

19

SH TP CT P

3

SHAVCTPGCTSP

14

25.0%

NZ_JAHHYI010000012.1:

Lanthipeptides: KM925_RS25405_lanthipeptide

6

GRSHRESTPACTG

18

G E+TPAC G

1

GDVQPETTPACVG

13

22.5%

NZ_FPCC01000026.1:

Lanthipeptides: BM377_RS12935_lanthipeptide

6

GRSHRESTPACTGPAAV

22

G E+TPA T AAV

1

GDVDAETTPAITVSAAV

17

21.4%

NZ_AP026721.1and 35 others:

NZ_CP015883.1 Lanthipeptides: A6B47_RS00875_lanthipeptideNZ_CP028286.1 Lanthipeptides: CEQ02_RS16115_lanthipeptideNZ_CP028721.1 Lanthipeptides: C7I32_RS15475_lanthipeptideNZ_CP028835.1 Lanthipeptides: C9432_RS02740_lanthipeptideNZ_CP028837.1 Lanthipeptides: C9432_RS15935_lanthipeptideNZ_CP033787.1 Lanthipeptides: EGX75_RS02740_lanthipeptideNZ_CP039296.1 Lanthipeptides: E7T02_RS02755_lanthipeptideNZ_CP045045.1 Lanthipeptides: F9293_RS12755_lanthipeptideNZ_CP075604.2 Lanthipeptides: KKP64_RS02155_lanthipeptideNZ_CP085289.1 Lanthipeptides: LIT95_RS07630_lanthipeptideNZ_CP085291.1 Lanthipeptides: LIT96_RS04335_lanthipeptideNZ_CP085297.1 Lanthipeptides: LIT97_RS14520_lanthipeptideNZ_CP086726.1 Lanthipeptides: LM507_RS03415_lanthipeptideNZ_CP091901.1 Lanthipeptides: L5I17_RS09010_lanthipeptideNZ_CP091905.1 Lanthipeptides: L5I20_RS14940_lanthipeptideNZ_CP091907.1 Lanthipeptides: L5I26_RS13265_lanthipeptideNZ_CP093957.1 Lanthipeptides: MPM64_RS01385_lanthipeptideNZ_CP116962.1 Lanthipeptides: PO880_RS13030_lanthipeptideNZ_JAASJP010000011.1 Lanthipeptides: HCH27_RS13275_lanthipeptideNZ_JAHZNN010000041.1 Lanthipeptides: K0X81_RS16410_lanthipeptideNZ_JAKTAU010000028.1 Lanthipeptides: MKK46_RS14535_lanthipeptideNZ_JALSCL010000035.1 Lanthipeptides: NEI30_RS13375_lanthipeptideNZ_JAQDOF010000024.1 Lanthipeptides: PGP79_RS14595_lanthipeptideNZ_JAQKZU010000014.1 Lanthipeptides: PMV60_RS12615_lanthipeptideNZ_KB932317.1 Lanthipeptides: Q95_RS09840_lanthipeptideNZ_KB932336.1 Lanthipeptides: Q9C_RS13350_lanthipeptideNZ_KB944697.1 Lanthipeptides: WO3_RS18030_lanthipeptideNZ_KB944708.1 Lanthipeptides: WO5_RS05650_lanthipeptideNZ_KB944753.1 Lanthipeptides: WO9_RS06460_lanthipeptideNZ_KB944762.1 Lanthipeptides: WOA_RS17470_lanthipeptideNZ_KB944819.1 Lanthipeptides: WOK_RS14355_lanthipeptideNZ_KB946767.1 Lanthipeptides: UK1_RS12990_lanthipeptideNZ_KB947483.1 Lanthipeptides: WUI_RS10440_lanthipeptideNZ_KZ845881.1 Lanthipeptides: EB41_RS04380_lanthipeptideNZ_NGMY01000001.1 Lanthipeptides: A5862_RS02370_lanthipeptide

Lanthipeptides: PO855_RS02215_lanthipeptide

6

GRSHRESTPAC

16

G E+TPAC

1

GDVQAETTPAC

11

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.02 out of 27.04

Confidence: medium

Additional weak hits (2):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.75 out of 39.62

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_5767376_5767489 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 2595.3 Da

Molecular weight: 2596.8 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2614.8 Da N = 1; 2632.9 Da N = 2; 2650.9 Da N = 3; 2668.9 Da N = 4

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195572.1 - Region 28 - NRPS,RRE-containing,lanthipeptide-class-ii

Download region SVG

Location: 6,117,991 - 6,187,252 nt. (total: 69,262 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

B9W61_RS26225: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

B9W61_RS26235: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

B9W61_RS26255: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acyltransferase aminotransferase kinase

B9W61_RS26080: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

B9W61_RS26140: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B9W61_RS26200: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

B9W61_RS37330: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase protease

B9W61_RS26110: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

B9W61_RS26165: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

B9W61_RS26170: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase lyase

B9W61_RS26105: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

B9W61_RS26260: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.43	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000919.5	0.43	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0001135.5	0.41	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002458.3	0.39	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0002382.3	0.38	ribosomal	grimoviridin	Grimontia marina
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002633.2	0.38	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.38	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001166.5	0.38	NRPS	HC-toxin	Alternaria jesenskae
BGC0000554.4	0.37	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002458.3	0.71	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

Lanthipeptide predictions

Lanthipeptide(s) for B9W61_RS26105

allorf_6125125_6125298

Leader:

MGPGEGRAPVTPERAWGSLARSRFDLGLAKKVRPRSTAYA

Core:

KLGRPLPPADSERPACS

Core with dehydrations:

KLGRPLPPADDhaERPACysDha

antiSMASH-DB 4.0 matches for allorf_6125125_6125298

100.0%

NZ_CP086102.1and 1 other:

NZ_KZ195572.1 Lanthipeptides: allorf_6125125_6125298_lanthipeptide

Lanthipeptides: allorf_6114239_6114412_lanthipeptide

1

KLGRPLPPADSERPACS

17

KLGRPLPPADSERPACS

1

KLGRPLPPADSERPACS

17

13.0%

NZ_CDME01000002.1:

Lanthipeptides: allorf_0030628_0030822_lanthipeptide

8

PADSERPAC

16

PA SERP C

35

PARSERPRC

43

allorf_6130884_6131057

Leader:

MRLPSGRVRRLPRPDTPRTRYGLSLPAEFRSEPGA

Core:

AQRCRTKAVPALLESLKSPLPE

Core with dehydrations:

AQRCysRDhbKAVPALLEDhaLKDhaPLPE

antiSMASH-DB 4.0 matches for allorf_6130884_6131057

100.0%

NZ_CP086102.1and 1 other:

NZ_KZ195572.1 Lanthipeptides: allorf_6130884_6131057_lanthipeptide

Lanthipeptides: allorf_6119998_6120171_lanthipeptide

1

AQRCRTKAVPALLESLKSPLPE

22

AQRCRTKAVPALLESLKSPLPE

1

AQRCRTKAVPALLESLKSPLPE

22

28.0%

NZ_KB235948.1and 1 other:

NZ_KB235948.1 Lanthipeptides: allorf_4830006_4830125_lanthipeptide

Lanthipeptides: allorf_4830006_4830125_lanthipeptide

2

QRCRTKAVP

10

Q CRT AVP

16

QICRTGAVP

24

allorf_6130947_6131129

Leader:

MCSTRLRPEFGG

Core:

KGKAVAGTGCIRTGEAPHTSGGKSHLYNPSLRGTSAVPRSGRGRSTAV

Core with dehydrations:

KGKAVAGDhbGCysIRDhbGEAPHDhbDhaGGKDhaHLYNPDhaLRGDhbDhaAVPRDhaGRGRDhaDhbAV

antiSMASH-DB 4.0 matches for allorf_6130947_6131129

100.0%

NZ_CP086102.1and 1 other:

NZ_KZ195572.1 Lanthipeptides: allorf_6130947_6131129_lanthipeptide

Lanthipeptides: allorf_6120061_6120243_lanthipeptide

1

KGKAVAGTGCIRTGEAPHTSGGKSHLYNPSLRGTSAVPRSGRGRSTAV

48

KGKAVAGTGCIRTGEAPHTSGGKSHLYNPSLRGTSAVPRSGRGRSTAV

1

KGKAVAGTGCIRTGEAPHTSGGKSHLYNPSLRGTSAVPRSGRGRSTAV

48

14.6%

NZ_CP011130.1and 3 others:

NZ_CP023465.1 Lanthipeptides: allorf_5424882_5424968_lanthipeptideNZ_CP076103.1 Lanthipeptides: allorf_5482973_5483059_lanthipeptideNZ_LMHM01000001.1 Lanthipeptides: allorf_734482_734568_lanthipeptide

Lanthipeptides: allorf_5359517_5359603_lanthipeptide

33

GTSAVPRSGRG

43

GTS +PR RG

6

GTSCMPRKCRG

16

14.6%

NZ_MQUS01000030.1:

Lanthipeptides: allorf_011700_011879_lanthipeptide

9

GCIRTGEAPHTSGGKSHLYNPS

30

GC R+ +GG+ PS

2

GCARSENDAFLTGGRRQALRPS

23

allorf_6138327_6138542

Leader:

MQFLLLDVRPGRRGDRRDQDAAG

Core:

ERGASGGRHRPSLRDRANQTARRLFMCLCPHCRQRWRSCGWGRHASTL

Core with dehydrations:

ERGADhaGGRHRPDhaLRDRANQDhbARRLFMCysLCysPHCysRQRWRDhaCysGWGRHADhaDhbL

antiSMASH-DB 4.0 matches for allorf_6138327_6138542

100.0%

NZ_CP086102.1and 1 other:

NZ_KZ195572.1 Lanthipeptides: allorf_6138327_6138542_lanthipeptide

Lanthipeptides: allorf_6127439_6127654_lanthipeptide

1

ERGASGGRHRPSLRDRANQTARRLFMCLCPHCRQRWRSCGWGRHASTL

48

ERGASGGRHRPSLRDRANQTARRLFMCLCPHCRQRWRSCGWGRHASTL

1

ERGASGGRHRPSLRDRANQTARRLFMCLCPHCRQRWRSCGWGRHASTL

48

12.5%

NC_009621.1and 4 others:

NZ_CP088111.1 Lanthipeptides: allorf_0786726_0786959_lanthipeptideNZ_NBUK01000063.1 Lanthipeptides: allorf_6661_6894_lanthipeptideNZ_VISX01000063.1 Lanthipeptides: allorf_1862_2095_lanthipeptideNZ_VITA01000039.1 Lanthipeptides: allorf_06616_06849_lanthipeptide

Lanthipeptides: allorf_1020482_1020715_lanthipeptide

21

ARRLFMCLCPHCR

33

+RL M +CP R

27

IKRLMMLVCPPSR

39

12.2%

NZ_FMXV01000009.1:

Lanthipeptides: allorf_153763_153945_lanthipeptide

32

CRQRWRSCGWGRHA

45

C Q W C W H+

36

CSQCWHQCCWATHS

49

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.25 out of 27.04

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.15 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.20 out of 20.97

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.83 out of 27.04

Confidence: medium

Additional weak hits (15):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.25 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.53 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.98 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.05 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.81 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.15 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.81 out of 21.55

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.48 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.32 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

allorf_6125125_6125298 - Class II

Cleavage pHMM score: -6.70

RODEO score: 0

Monoisotopic mass: 1756.9 Da

Molecular weight: 1758.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1776.0 Da N = 1

allorf_6130884_6131057 - Class II

Cleavage pHMM score: -2.50

RODEO score: 0

Monoisotopic mass: 2352.3 Da

Molecular weight: 2353.8 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2371.8 Da N = 1; 2389.8 Da N = 2

allorf_6130947_6131129 - Class II

Cleavage pHMM score: -3.60

RODEO score: 0

Monoisotopic mass: 4591.5 Da

Molecular weight: 4594.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4612.1 Da N = 1; 4630.1 Da N = 2; 4648.2 Da N = 3; 4666.2 Da N = 4; 4684.2 Da N = 5; 4702.2 Da N = 6; 4720.2 Da N = 7; 4738.3 Da N = 8; 4756.3 Da N = 9; 4774.3 Da N = 10

allorf_6138327_6138542 - Class II

Cleavage pHMM score: -5.80

RODEO score: 0

Monoisotopic mass: 5480.8 Da

Molecular weight: 5484.2 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 5502.2 Da N = 1; 5520.3 Da N = 2

Predicted core structure(s)

For candidate cluster 54, location 6117990 - 6187252:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - X - X - Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 57, location 6134418 - 6187252:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - X - X - Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS26200: Thr - X - X - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (463..879): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1542..1939): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDGAFDAVNYEVHLLAGGDKDTYGPTETTSFATF
Nearest Stachelhaus code(s):: Val DAYWLGGTFK (68% 8Å match); Dhpg DAYHGGTLCK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2599..3004): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YCSSFDLTVTATKAMLGGEYNGYGPTETTVTCTQ
Nearest Stachelhaus code(s):: bMe-Asp or Asp DLTKMGGVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3664..4060): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FDMTFDIAGLDVQALVGGERNMYGPTETTIWSTT
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

RRE predictions

: RRE type: PqqD_RRE; Location: 15 - 91; Score: 32.4; RRE type: Stand_Alone_Lasso_RRE; Location: 41 - 91; Score: 26.8
: RRE type: PqqD_RRE; Location: 15 - 91; Score: 32.4; RRE type: Stand_Alone_Lasso_RRE; Location: 41 - 91; Score: 26.8

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195572.1 - Region 29 - ectoine

Download region SVG

Location: 6,825,313 - 6,835,711 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

B9W61_RS29105: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase

B9W61_RS29095: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

B9W61_RS29125: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B9W61_RS29135: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.95	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.95	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.28 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.51 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.85 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_KZ195572.1 - Region 30 - terpene

Download region SVG

Location: 7,270,706 - 7,291,782 nt. (total: 21,077 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W61_RS31235: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: formyltransferase

B9W61_RS31205: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Lyases: cyclase hydratase

B9W61_RS31225: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

B9W61_RS31245: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.37	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002034.3	0.36	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000879.5	0.35	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0002616.2	0.35	PKS	mycophenolic acid	Penicillium roqueforti
BGC0001677.3	0.35	PKS	mycophenolic acid	Penicillium roqueforti
BGC0001360.3	0.34	PKS	mycophenolic acid	Penicillium roqueforti FM164
BGC0002619.2	0.34	PKS	mycophenolic acid	Penicillium brevicompactum
BGC0000881.3	0.33	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.37	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002034.3	0.36	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000879.5	0.35	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0002616.2	0.35	PKS	mycophenolic acid	Penicillium roqueforti
BGC0001677.3	0.35	PKS	mycophenolic acid	Penicillium roqueforti
BGC0001360.3	0.34	PKS	mycophenolic acid	Penicillium roqueforti FM164
BGC0002619.2	0.34	PKS	mycophenolic acid	Penicillium brevicompactum
BGC0000881.3	0.33	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

B9W61_RS31225: T1TS

Domain 1 (4 - 315): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.50 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

Additional weak hits (15):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.00 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.66 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.43 out of 39.62

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.90 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.17 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.58 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.76 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.23 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.72 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.90 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.45 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_KZ195572.1 - Region 31 - NRPS

Download region SVG

Location: 7,597,550 - 7,641,803 nt. (total: 44,254 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

B9W61_RS32585: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B9W61_RS32590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001250.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001250.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.62	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.29 out of 23.79

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 27.95 out of 30.22

Confidence: strong

Additional weak hits (8):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.79 out of 20.01

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.72 out of 32.74

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.23 out of 29.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 60, location 7597549 - 7641803:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS32585: Hpr

Search NORINE for peptide: strict or relaxed

AMP-binding (457..852): Hpr

nrpys: Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQAFDVAFQESFLVTAGEENQYGPSETHVVTAE
Nearest Stachelhaus code(s):: Hpr DVQFVAQVVK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS32590: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (10..404): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGPAWDAFSLEGWLLTGGETNGYGPVESCVFATT
Nearest Stachelhaus code(s):: Val DALWLGGVFK (56% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_KZ195572.1 - Region 32 - azole-containing-RiPP

Download region SVG

Location: 7,669,884 - 7,700,056 nt. (total: 30,173 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

B9W61_RS32935: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.48	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000567.3	0.48	ribosomal	trifolitoxin	Rhizobium leguminosarum
BGC0002073.3	0.48	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002494.3	0.46	NRPS	vibriobactin	Vibrio cholerae
BGC0002495.2	0.45	NRPS	photobactin	Photorhabdus luminescens
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002476.2	0.43	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0000947.5	0.43	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002635.2	0.42	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000711.5	0.42	saccharide	neomycin	Streptomyces fradiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.48	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000567.3	0.48	ribosomal	trifolitoxin	Rhizobium leguminosarum
BGC0002073.3	0.48	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002494.3	0.46	NRPS	vibriobactin	Vibrio cholerae
BGC0002495.2	0.45	NRPS	photobactin	Photorhabdus luminescens
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002476.2	0.43	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0000947.5	0.43	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002635.2	0.42	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000711.5	0.42	saccharide	neomycin	Streptomyces fradiae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.90 out of 36.53

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.99 out of 26.85

Confidence: medium

Additional weak hits (7):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.05 out of 32.93

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.53 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.78 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.74 out of 20.01

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
RutR	Regulator of the pyrimidine and purine metabolism

Core peptide predictions

No core peptides found.

NZ_KZ195572.1 - Region 33 - T3PKS

Download region SVG

Location: 7,936,677 - 7,977,807 nt. (total: 41,131 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B9W61_RS34015: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B9W61_RS34045: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: kinase

B9W61_RS34085: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: back translocase glucanase protease

B9W61_RS33955: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

B9W61_RS33960: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

B9W61_RS34025: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: synthase

B9W61_RS34090: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B9W61_RS34095: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B9W61_RS37250: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.61	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000280.5	0.53	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.52	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002285.2	0.52	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002711.2	0.51	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002476.2	0.48	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.61	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000280.5	0.53	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000281.3	0.52	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002285.2	0.52	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002711.2	0.51	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002476.2	0.48	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.62 out of 25.88

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.21 out of 27.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (24):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.05 out of 25.88

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.55 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.18 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.18 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.12 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.31 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.72 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.24 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.64 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.71 out of 36.53

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.76 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.65 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.09 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.38 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.71 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.22 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.92 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.50 out of 26.06

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.57 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.59 out of 23.43

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
PsrA	Oleic acid responsive regulator

NZ_KZ195572.1 - Region 34 - NRP-metallophore,NRPS

Download region SVG

Location: 8,054,337 - 8,154,323 nt. (total: 99,987 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B9W61_RS34575: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

B9W61_RS34720: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: formyltransferase

B9W61_RS34570: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: esterase hydrolase

B9W61_RS34615: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

B9W61_RS34705: isochorismatase

smcogs: SMCOG1027: isochorismatase

B9W61_RS34730: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

B9W61_RS34750: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: dehydratase

B9W61_RS34535: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: isomerase

B9W61_RS34715: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

B9W61_RS34520: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

B9W61_RS34605: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS34710: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B9W61_RS34745: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000368.5	1.22	NRPS	griseobactin	Streptomyces sp. ATCC 700974
BGC0000325.5	1.01	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0001833.4	0.98	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.98	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.97	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.97	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.95	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.93	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.91	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.91	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000368.5	0.82	NRPS	griseobactin	Streptomyces sp. ATCC 700974
BGC0000325.5	0.76	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.69	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000401.5	0.68	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.94 out of 36.53

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.58 out of 30.11

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.45 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.21 out of 23.79

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.00 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.63 out of 27.04

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.57 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.74 out of 36.53

Confidence: medium

Additional weak hits (29):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.50 out of 20.97

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.17 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.78 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.89 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.32 out of 39.62

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.68 out of 32.74

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.93 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.30 out of 36.53

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.69 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.99 out of 26.85

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.45 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.37 out of 36.53

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.87 out of 20.01

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.60 out of 39.62

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.40 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.56 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.71 out of 36.53

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 63, location 8054336 - 8154323:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn) + (Arg - Thr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

B9W61_RS37355: X

AMP-binding (3..150): X

No predictions made

B9W61_RS34605: Fo-OH-Orn - Thr - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (14..234): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: ---AFDISVNELYLWCGGEYHGYGPAETTIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1317..1756): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTHFDFAVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2773..3171): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS34710: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (32..439): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SGSLFPLSSPGGGLLVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

B9W61_RS34745: Arg - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (585..953): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHAFDASWDPWDVVVGGEVNLYGPTETTVDAYY
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1656..2064): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KZ195572.1 - Region 35 - terpene

Download region SVG

Location: 8,218,234 - 8,240,447 nt. (total: 22,214 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase hydratase

B9W61_RS35120: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

B9W61_RS35155: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

B9W61_RS35115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000658.3	0.56	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000658.3	0.56	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

B9W61_RS35155: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (336 - 697): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (12):

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.75 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.71 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.75 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.98 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.95 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.70 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.65 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.28 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.29 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description

NZ_KZ195572.1 - Region 36 - butyrolactone

Download region SVG

Location: 8,271,854 - 8,282,798 nt. (total: 10,945 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B9W61_RS35420: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: methyltransferase

B9W61_RS35385: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

B9W61_RS35410: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.87	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.62	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.52	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001364.3	0.43	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000817.4	0.42	other (other)	methylarcyriarubin	uncultured bacterium
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001077.4	0.40	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002578.2	0.40	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002701.2	0.39	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0002111.3	0.39	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.87	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.62	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.52	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001364.3	0.43	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000817.4	0.42	other (other)	methylarcyriarubin	uncultured bacterium
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001077.4	0.40	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002578.2	0.40	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002701.2	0.39	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0002111.3	0.39	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.40 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.73 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.01 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.17 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.23 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KZ195572.1 - Region 37 - terpene-precursor