GCF_002147905.1 - 23 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_MOOL01000003.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS,NRPS-like	1	3,842

NZ_MOOL01000009.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	CDPS	1	13,320	Medium	pulcherriminic acid	other:other

NZ_MOOL01000015.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	NRPS-like	76,951	120,532

NZ_MOOL01000022.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	RiPP-like	30,301	40,567
Region 19.2	NRPS	59,465	106,475

NZ_MOOL01000024.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 21.1	RiPP-like	27,474	37,803
Region 21.2	betalactone	93,192	118,430	Low	fengycin	NRPS:Type I

NZ_MOOL01000027.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	terpene-precursor	370,541	391,431

NZ_MOOL01000032.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 29.1	azole-containing-RiPP	59,505	83,011

NZ_MOOL01000033.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 30.1	NRPS	48,483	79,669

NZ_MOOL01000039.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	NI-siderophore	349,239	380,946	High	petrobactin	other:other

NZ_MOOL01000040.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 37.1	NRP-metallophore,NRPS	174,694	226,442	High	bacillibactin	NRPS:Type I

NZ_MOOL01000048.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 44.1	terpene	59,464	81,317	Low	molybdenum cofactor	other:other

NZ_MOOL01000049.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 45.1	NRPS-like	1	12,210

NZ_MOOL01000050.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 46.1	NRPS	1	9,253

NZ_MOOL01000058.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 54.1	NRPS-like	1	19,486

NZ_MOOL01000063.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 59.1	NRPS,T1PKS	80,638	188,342	High	zwittermicin A	NRPS:Type I+PKS
Region 59.2	NRPS	193,539	226,796

NZ_MOOL01000065.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 61.1	NRPS	29,889	95,797

NZ_MOOL01000072.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 68.1	lanthipeptide-class-i	8,542	32,196	Low	paenicidin B	ribosomal:RiPP:Lanthipeptide

NZ_MOOL01000076.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 72.1	lanthipeptide-class-i	24,262	50,705

NZ_MOOL01000078.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 74.1	lanthipeptide-class-iv	37,622	60,234

NZ_MOOL01000084.1 (Bacillus thuringiensis serovar xiaguangiensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 80.1	RiPP-like	321	12,567

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS,NRPS-like	1	3,842
Region 6.1	CDPS	1	13,320	Medium	pulcherriminic acid	other:other
Region 12.1	NRPS-like	76,951	120,532
Region 19.1	RiPP-like	30,301	40,567
Region 19.2	NRPS	59,465	106,475
Region 21.1	RiPP-like	27,474	37,803
Region 21.2	betalactone	93,192	118,430	Low	fengycin	NRPS:Type I
Region 24.1	terpene-precursor	370,541	391,431
Region 29.1	azole-containing-RiPP	59,505	83,011
Region 30.1	NRPS	48,483	79,669
Region 36.1	NI-siderophore	349,239	380,946	High	petrobactin	other:other
Region 37.1	NRP-metallophore,NRPS	174,694	226,442	High	bacillibactin	NRPS:Type I
Region 44.1	terpene	59,464	81,317	Low	molybdenum cofactor	other:other
Region 45.1	NRPS-like	1	12,210
Region 46.1	NRPS	1	9,253
Region 54.1	NRPS-like	1	19,486
Region 59.1	NRPS,T1PKS	80,638	188,342	High	zwittermicin A	NRPS:Type I+PKS
Region 59.2	NRPS	193,539	226,796
Region 61.1	NRPS	29,889	95,797
Region 68.1	lanthipeptide-class-i	8,542	32,196	Low	paenicidin B	ribosomal:RiPP:Lanthipeptide
Region 72.1	lanthipeptide-class-i	24,262	50,705
Region 74.1	lanthipeptide-class-iv	37,622	60,234
Region 80.1	RiPP-like	321	12,567

No secondary metabolite regions were found in these records:: NZ_MOOL01000004.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000005.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000006.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000008.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000010.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000011.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000012.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000013.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000014.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000016.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000017.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000018.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000019.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000020.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000021.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000023.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000025.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000026.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000028.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000029.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000030.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000031.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000034.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000035.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000036.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000037.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000038.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000041.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000042.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000043.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000044.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000045.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000047.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000051.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000052.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000053.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000054.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000055.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000056.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000057.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000059.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000060.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000061.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000062.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000064.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000066.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000067.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000068.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000069.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000070.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000071.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000073.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000074.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000075.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000077.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000079.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000080.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000081.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000082.1 (Bacillus thuringiensis serovar xiaguangiensis); NZ_MOOL01000083.1 (Bacillus thuringiensis serovar xiaguangiensis)

Compact view

NZ_MOOL01000003.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 3,842 nt. (total: 3,842 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

BK733_RS00015: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS00020: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.71 out of 29.38

Confidence: medium

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BK733_RS00015: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (507..844): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWCSFDLTITGSKLVVGGEINEYGPTEAVVGCTN
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator

NZ_MOOL01000009.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 1 - 13,320 nt. (total: 13,320 nt) Show pHMM detection rules used

Region on contig edge.

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BK733_RS00560: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002103.2	0.71	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001286.3	0.47	other (other)	itaconic acid	Ustilago maydis
BGC0001336.5	0.36	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000470.6	0.34	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.32	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000607.5	0.31	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001529.5	0.30	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000306.5	0.29	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000444.5	0.28	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8
BGC0001334.5	0.27	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002103.2	0.71	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001286.3	0.47	other (other)	itaconic acid	Ustilago maydis
BGC0001336.5	0.36	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000470.6	0.34	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.32	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000607.5	0.31	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001529.5	0.30	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000306.5	0.29	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000444.5	0.28	NRPS	thaxtomin A	Streptomyces turgidiscabies Car8
BGC0001334.5	0.27	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.49 out of 25.88

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.80 out of 27.78

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.67 out of 25.31

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.94 out of 25.31

Confidence: medium

Additional weak hits (3):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.81 out of 27.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.81 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.54 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
PsrA	Oleic acid responsive regulator

NZ_MOOL01000015.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 76,951 - 120,532 nt. (total: 43,582 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

BK733_RS02105: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: phosphorylase phosphotransferase

BK733_RS02070: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

BK733_RS02095: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

Hydrolases: glucosidase

BK733_RS02100: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: ligase

BK733_RS02055: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.69 out of 27.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.91 out of 25.88

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.91 out of 25.88

Confidence: medium

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 25.04 out of 26.12

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.96 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.18 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.81 out of 20.97

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.69 out of 21.55

Confidence: strong

Additional weak hits (10):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.06 out of 29.72

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.13 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.13 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.70 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.89 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.17 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.95 out of 29.38

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.11 out of 20.47

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.78 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.98 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 76950 - 120532:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BK733_RS02055: X

AMP-binding (225..621): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWMPFDASVWEAALAIGGEHNVYGPTECTVVTTT
Nearest Stachelhaus code(s):: Leu DAWYLGNVVK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
LuxO	Repressor of luminescence
PsrA	Oleic acid responsive regulator

NZ_MOOL01000022.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 30,301 - 40,567 nt. (total: 10,267 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

BK733_RS05920: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

No matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.64 out of 32.74

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_MOOL01000022.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 59,465 - 106,475 nt. (total: 47,011 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BK733_RS06085: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

BK733_RS06240: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

BK733_RS06235: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase glucanase hydrolase

BK733_RS06170: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

BK733_RS06190: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

BK733_RS06200: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

smcogs: SMCOG1283: 2`,3`-cyclic-nucleotide 2`-phosphodiesterase

BK733_RS06245: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: decarboxylase

BK733_RS06175: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase

BK733_RS06180: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.71 out of 26.33

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.13 out of 29.25

Confidence: medium

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 28.23 out of 31.73

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.81 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 28.19

Confidence: medium

Additional weak hits (7):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.14 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.07 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.69 out of 31.73

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 20.28 out of 29.72

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.46 out of 31.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.36 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.63 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 59464 - 106475:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BK733_RS06180: X - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (266..656): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FVMAFDISLLELESLLAGELNIYGPTETTICATV
Nearest Stachelhaus code(s):: Ala DILICALICK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1303..1683): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLHSGDISLGGATEASIWSIY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CcpA	Catabolite control protein A
HexR	Glucose-responsive regulator
SypG	Regulator of biofilm formation and host colonization
ZuR variant 1	Zinc-responsive repressor

NZ_MOOL01000024.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 27,474 - 37,803 nt. (total: 10,330 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

BK733_RS06945: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000896.5	0.29	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000721.4	0.27	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000172.5	0.23	PKS	Basiliskamide A, Basiliskamide B	Brevibacillus laterosporus PE36
BGC0000381.5	0.23	NRPS	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000433.5	0.22	NRPS	surfactin	Bacillus velezensis FZB42
BGC0000455.6	0.22	NRPS, saccharide	vancomycin	Amycolatopsis orientalis HCCB10007 (ATCC43491)
BGC0002588.2	0.22	other (other)	enduracididine	uncultured bacterium
BGC0001233.5	0.22	NRPS	feglymycin	Streptomyces sp. DSM 11171
BGC0001461.5	0.22	NRPS	Actinoidin B	Amycolatopsis keratiniphila subsp. nogabecina
BGC0001459.5	0.21	NRPS	decaplanin	Amycolatopsis regifaucium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000896.5	0.29	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000721.4	0.27	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000172.5	0.23	PKS	Basiliskamide A, Basiliskamide B	Brevibacillus laterosporus PE36
BGC0000381.5	0.23	NRPS	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000433.5	0.22	NRPS	surfactin	Bacillus velezensis FZB42
BGC0000455.6	0.22	NRPS, saccharide	vancomycin	Amycolatopsis orientalis HCCB10007 (ATCC43491)
BGC0002588.2	0.22	other (other)	enduracididine	uncultured bacterium
BGC0001233.5	0.22	NRPS	feglymycin	Streptomyces sp. DSM 11171
BGC0001461.5	0.22	NRPS	Actinoidin B	Amycolatopsis keratiniphila subsp. nogabecina
BGC0001459.5	0.21	NRPS	decaplanin	Amycolatopsis regifaucium

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.30 out of 26.06

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.87 out of 32.93

Confidence: medium

Additional weak hits (2):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 17.35 out of 30.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes

NZ_MOOL01000024.1 - Region 2 - betalactone

Download region GenBank file

Download region SVG

Location: 93,192 - 118,430 nt. (total: 25,239 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BK733_RS07305: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase carboxylase transferase

BK733_RS07260: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

BK733_RS07280: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BK733_RS07300: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Lyases: hydratase

BK733_RS07285: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

BK733_RS07275: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BK733_RS07290: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001095.5	0.41	NRPS	fengycin	Bacillus velezensis FZB42
BGC0000253.4	0.41	PKS	oviedomycin	Streptomyces antibioticus
BGC0000259.3	0.40	PKS	prodigiosin	Serratia marcescens
BGC0001464.3	0.40	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0001463.4	0.40	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.46	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001103.5	0.42	NRPS, PKS	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001095.5	0.41	NRPS	fengycin	Bacillus velezensis FZB42
BGC0000253.4	0.41	PKS	oviedomycin	Streptomyces antibioticus
BGC0000259.3	0.40	PKS	prodigiosin	Serratia marcescens
BGC0001464.3	0.40	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0001463.4	0.40	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.51 out of 27.55

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

Additional weak hits (1):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.65 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
GnfM	Regulator of nitrogen-fixation genes
ToxT	Regulator of MSHA biosynthesis

NZ_MOOL01000027.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 370,541 - 391,431 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

BK733_RS09645: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

BK733_RS09610: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

BK733_RS09615: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002284.3	0.38	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

BK733_RS09615: PT_FPPS_like

Domain 1 (32 - 295): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.49 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.66 out of 26.06

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.32 out of 25.88

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.28 out of 26.33

Confidence: medium

Additional weak hits (2):

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.73 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 25.40 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator

NZ_MOOL01000032.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 59,505 - 83,011 nt. (total: 23,507 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BK733_RS10520: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: methyltransferase

BK733_RS10535: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	0.46	ribosomal	curacozole	Streptomyces curacoi
BGC0001174.4	0.44	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001146.5	0.43	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001535.3	0.43	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001534.3	0.41	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0001145.5	0.40	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.39	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	0.46	ribosomal	curacozole	Streptomyces curacoi
BGC0001174.4	0.44	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0001146.5	0.43	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001535.3	0.43	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001534.3	0.41	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0001145.5	0.40	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.39	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000606.5	0.39	ribosomal	lactazole	Streptomyces lactacystinaeus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.11 out of 27.55

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.04 out of 23.79

Confidence: medium

Additional weak hits (3):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.62 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.69 out of 39.62

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Heterocycloanthracin_C_RRE; Location: 0 - 100; Score: 181.5; RRE type: Thiopeptide_F_RRE; Location: 10 - 89; Score: 41.0

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism

Core peptide predictions

No core peptides found.

NZ_MOOL01000033.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 48,483 - 79,669 nt. (total: 31,187 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BK733_RS34175: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Ligases: ligase

BK733_RS12465: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS12470: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.71	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.68	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.71	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.68	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.33 out of 18.16

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.10 out of 27.55

Confidence: medium

Additional weak hits (2):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 20.52 out of 29.51

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.88 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 48482 - 79669:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - Thr - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BK733_RS12465: NH2 - Thr - X

Search NORINE for peptide: strict or relaxed

CAL_domain (168..484): NH2

minowa: NH2

Prediction, score:

NH2: 129.0
Acetyl-CoA: 45.2
AHBA: 12.8
fatty_acid: 1.5
shikimic_acid: 0.0

AMP-binding (1174..1580): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2243..2651): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDVSVWQSETVLNGEINACGATESSDDVNH
Nearest Stachelhaus code(s):: Dpr DVWEMNADDK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

BK733_RS12470: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (504..841): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWCSFDLTITGSKLVVGGEINEYGPTEAVVGCTN
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
GnfM	Regulator of nitrogen-fixation genes

NZ_MOOL01000039.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 349,239 - 380,946 nt. (total: 31,708 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

BK733_RS18370: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: deacetylase

BK733_RS18305: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase synthase

BK733_RS18265: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

BK733_RS18335: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.89	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.51	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002620.2	0.50	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001713.5	0.48	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002464.3	0.48	other (other)	alcaligin	Bordetella pertussis Tohama I

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.89	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.51	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002620.2	0.50	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.50	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002305.2	0.50	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001713.5	0.48	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002464.3	0.48	other (other)	alcaligin	Bordetella pertussis Tohama I

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.14 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.03 out of 20.97

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.38 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.93 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 15.13 out of 18.16

Confidence: strong

Additional weak hits (4):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.58 out of 19.52

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.50 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.66 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.60 out of 36.54

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
ZuR variant 1	Zinc-responsive repressor

NZ_MOOL01000040.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 174,694 - 226,442 nt. (total: 51,749 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BK733_RS19595: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BK733_RS19600: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

BK733_RS19605: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BK733_RS19670: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BK733_RS19750: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: PPTase

BK733_RS19705: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase protease

BK733_RS19685: isochorismatase

smcogs: SMCOG1027: isochorismatase

BK733_RS19730: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: hydratase

BK733_RS19615: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: isomerase

BK733_RS19675: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

BK733_RS19680: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BK733_RS19690: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS19755: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	1.05	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.88	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	0.86	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	0.86	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.86	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.5	0.80	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0000309.5	0.75	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0000401.5	0.74	NRPS	paenibactin	Paenibacillus elgii B69
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000343.5	0.74	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.13 out of 27.78

Confidence: strong

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.21 out of 30.25

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.83 out of 27.78

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.53 out of 26.06

Confidence: strong

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.20 out of 32.93

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.53 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.40 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.41 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.90 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.62 out of 27.78

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.56 out of 29.38

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.57 out of 32.74

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 25.99 out of 30.25

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.21 out of 30.25

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

Additional weak hits (6):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.83 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.49 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.05 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.54 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.85 out of 36.53

Confidence: weak

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 15.72 out of 18.46

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 174693 - 226442:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BK733_RS19680: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SVSLYPMSSPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PMPAQGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BK733_RS19690: Gly - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (464..864): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDISALELQALVGGETNLYGPTETTIWSTF
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1524..1937): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEINMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_MOOL01000048.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 59,464 - 81,317 nt. (total: 21,854 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BK733_RS22310: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BK733_RS22315: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: lyase

BK733_RS22285: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000917.3	0.52	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000916.5	0.46	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000812.3	0.45	other (other)	huperzine A	Shiraia sp. slf14
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002138.2	0.40	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000917.3	0.52	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000916.5	0.46	other (other)	molybdenum cofactor	Staphylococcus carnosus
BGC0000812.3	0.45	other (other)	huperzine A	Shiraia sp. slf14
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002138.2	0.40	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

BK733_RS22325: T2TS

Domain 1 (4 - 614): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.42 out of 30.22

Confidence: medium

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator

NZ_MOOL01000049.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 12,210 nt. (total: 12,210 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase

BK733_RS22505: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase

BK733_RS22500: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

BK733_RS22485: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

Additional weak hits (2):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.92 out of 31.73

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.64 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 12210:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BK733_RS22485: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (179..581): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGLTFDVSVAEGNFFVAGEYNLYGPTEASIYTTG
Nearest Stachelhaus code(s):: Ala DVANIALIYK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_MOOL01000050.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 9,253 nt. (total: 9,253 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

BK733_RS22530: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS22535: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 9253:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - Tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BK733_RS22530: Tyr - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (268..662): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: NWRFFDGFVTSTISTLAGEANEYGPTENSVVTTV
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1306..1708): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGLTFDVSVAEGNFFVAGEYNLYGPTEASIYTTG
Nearest Stachelhaus code(s):: Ala DVANIALIYK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

BK733_RS22535: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (177..579): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGLTFDVSVAEGNFFVAGEYNLYGPTEASIYTTG
Nearest Stachelhaus code(s):: Ala DVANIALIYK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

NZ_MOOL01000058.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 19,486 nt. (total: 19,486 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

BK733_RS24045: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: deaminase esterase hydrolase

BK733_RS24055: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

BK733_RS24095: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

BK733_RS24115: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

BK733_RS24100: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

BK733_RS24120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002277.2	0.63	NRPS	atromentin	Suillus grevillei
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002277.2	0.63	NRPS	atromentin	Suillus grevillei
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.27 out of 26.06

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.24 out of 18.16

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.70 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.28 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

Additional weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.05 out of 30.11

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 20.83 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.21 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.12 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MogR	Repressor of flagellar motility genes

NZ_MOOL01000063.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 80,638 - 188,342 nt. (total: 107,705 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BK733_RS25135: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BK733_RS25220: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BK733_RS25235: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

BK733_RS25245: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BK733_RS25260: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BK733_RS25310: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: PPTase acetyltransferase acylase aminotransferase carbamoyltransferase

BK733_RS25055: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

BK733_RS25230: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BK733_RS25290: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

BK733_RS25300: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

BK733_RS25320: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: deaminase esterase hydrolase phosphatase

BK733_RS25265: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

BK733_RS25270: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

BK733_RS25280: thioesterase

smcogs: SMCOG1004: thioesterase

BK733_RS25305: hydrolase

smcogs: SMCOG1179: hydrolase

BK733_RS25330: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: cyclase decarboxylase

BK733_RS25130: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

BK733_RS25375: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

BK733_RS25140: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS25200: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BK733_RS25205: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS25210: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS25250: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BK733_RS25255: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS25275: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BK733_RS25285: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS25325: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001059.5	1.45	NRPS, PKS	zwittermicin A	Bacillus cereus
BGC0001833.4	0.94	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.90	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.89	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.89	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.89	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.89	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.86	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002075.3	0.86	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.84	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001059.5	0.95	NRPS, PKS	zwittermicin A	Bacillus cereus
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 25.18 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 25.18 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 25.47 out of 26.06

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.88 out of 23.79

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.62 out of 27.78

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 25.61 out of 27.78

Confidence: strong

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 21.55

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.52 out of 27.55

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.91 out of 32.93

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 24.74 out of 28.14

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.01 out of 32.93

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.67 out of 25.31

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 25.31 out of 28.14

Confidence: medium

Additional weak hits (5):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.17 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.92 out of 20.01

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.97 out of 25.88

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.27 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 80637 - 188342:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Tyr) + (ohmal - bOH-Tyr) + (Pro) + (X - ohmal) + (D-Asn) + (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BK733_RS25140: X - Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (477..877): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSVAFDASIMEPVLFVGGELNAYGPTETTVCATM
Nearest Stachelhaus code(s):: Leu DAMLVGAVCK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1539..1944): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LWRYFDSSVSESDLIMGGEVNEYGPTEATVSAMY
Nearest Stachelhaus code(s):: Lys DAEDIGTVSK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

BK733_RS25200: mal

PKS_AT (1897..2192): mal

ATSignature: 2-Rhyd-Malonyl-CoA

Top 3 matches:: 2-Rhyd-Malonyl-CoA: 100.0%; Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 107.0
inactive: 74.6
Methoxymalonyl-CoA: 50.9
Methylmalonyl-CoA: 41.7
Propionyl-CoA: 29.7
Ethylmalonyl-CoA: 14.1
2-Methylbutyryl-CoA: 13.3
CHC-CoA: 12.9
3-Methylbutyryl-CoA: 10.8
Isobutyryl-CoA: 9.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0

BK733_RS25205: bOH-Tyr - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (274..685): bOH-Tyr

nrpys: bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGLSFDASVQNGDGIIAGETNAYGPTETTVDSTC
Nearest Stachelhaus code(s):: bOH-Tyr DASTIAAVDK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1329..1728): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDVSVLEGNFLLAGEENMYGPTEATVIAST
Nearest Stachelhaus code(s):: Ala DVHNLAIVYK (76% 8Å match); Ser DVWNVAMVHK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

BK733_RS25230: mal

PKS_AT (5..291): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 51.2
inactive: 31.2
Methoxymalonyl-CoA: 30.8
Methylmalonyl-CoA: 13.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BK733_RS25250: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (8..410): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFVSGETNLYGPTEATIDVTA
Nearest Stachelhaus code(s):: Ser DVWHFSLIDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

BK733_RS25255: X - mal

AMP-binding (448..845): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHQHFDMSVWEGNQTFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Ser DMWNTGLVHK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

PKS_AT (1551..1847): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 133.7
inactive: 95.1
Methoxymalonyl-CoA: 44.7
Methylmalonyl-CoA: 25.8
Propionyl-CoA: 15.1
Isobutyryl-CoA: 9.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BK733_RS25275: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (461..856): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKVIVGGEINEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BK733_RS25285: X - X

AMP-binding (280..682): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAMSFDVTIFEVYIFVGVELNLYGPTEATVCCTS
Nearest Stachelhaus code(s):: Met DVFYLGGVFK (59% 8Å match); Ala DVFFVGLVAK (50% 8Å match); Pro DLFYLALVCK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1323..1725): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAMSFDVTIFEVYILVGVELNGYGPTEATVCCTT
Nearest Stachelhaus code(s):: Met DVFYLGGVFK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
PerR	Peroxide regulator
ToxT	Regulator of MSHA biosynthesis

NZ_MOOL01000063.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 193,539 - 226,796 nt. (total: 33,258 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Isomerases: mutase

BK733_RS25485: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase

BK733_RS25555: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BK733_RS25560: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.18 out of 26.85

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.79 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.52 out of 27.55

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 24.43 out of 24.78

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.66 out of 24.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 16.33 out of 18.16

Confidence: strong

Additional weak hits (7):

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.73 out of 30.98

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.77 out of 27.04

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.99 out of 20.01

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.42 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.68 out of 20.01

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.21 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 26.22 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 193538 - 226796:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Ser - Lys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BK733_RS25555: Gly - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (464..855): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGFTFDPFVVELQLLVGGEYNIYGPTETTVWLTV
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (71% 8Å match); D-Ala DMPQLGMVWK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1498..1900): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFTSGETNLYGPTEATIDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLIDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

BK733_RS25560: Lys - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (272..663): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: lys (Lys)

Stachelhaus prediction details:

Stachelhaus sequence:: YHFSFDASVEQPSCISGGDYNTYGPTEATVCATF
Nearest Stachelhaus code(s):: Lys DAESIGSVCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1307..1709): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGLTFDVSVAEGNFFVAGEYNLYGPTEASIYTTG
Nearest Stachelhaus code(s):: Ala DVANIALIYK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
LexA variant 2	Repressor of DNA damage response
RutR	Regulator of the pyrimidine and purine metabolism
ZuR variant 1	Zinc-responsive repressor

NZ_MOOL01000065.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 29,889 - 95,797 nt. (total: 65,909 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase acetyltransferase acyltransferase

BK733_RS25820: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

BK733_RS25850: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

BK733_RS25860: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: deacetylase esterase

BK733_RS25815: thioesterase

smcogs: SMCOG1004: thioesterase

BK733_RS25910: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Ligases: ligase

BK733_RS25825: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS25830: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BK733_RS25835: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

BK733_RS25760: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

BK733_RS25775: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.70	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.70	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.21 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.03 out of 26.06

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.01 out of 30.25

Confidence: medium

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 30.96 out of 36.54

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.34 out of 20.97

Confidence: medium

Additional weak hits (6):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 25.08 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.64 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.09 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.74 out of 31.73

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 17.58 out of 30.12

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 29888 - 95797:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Thr) + (X - Ala) + (Ser - Leu - D-X - Glu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BK733_RS25825: Ser - Leu - X - Glu

Search NORINE for peptide: strict or relaxed

AMP-binding (496..901): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFTSGEINLYGPTEATVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1558..1945): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: MWHAFDSAVQEPFAITGGDINQYGPSENTVVTTD
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2600..3000): X

nrpys: Gln, Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDASIQQMDILVGGEYNVYGPTECTVDATC
Nearest Stachelhaus code(s):: Gln or Glu DAQDLGVVDK (88% 8Å match); Ile DAQDLGVVDK (85% 8Å match); Gln DAQDLGVVDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4115..4515): Glu

nrpys: Glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLAFDVSIQQMDMLVGGEYNVYGPTECTVDATC
Nearest Stachelhaus code(s):: Gln or Glu DAQDLGVVDK (85% 8Å match); Ile DAQDLGVVDK (82% 8Å match); Gln DAQDLGVVDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

BK733_RS25830: X - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (466..870): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWMTFDVSVWEWQFFSGGETNFYGPTEATIYVNA
Nearest Stachelhaus code(s):: Glu DVWHFGRINK (71% 8Å match); Gln DAWQFGLIDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1527..1919): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: MWATFDLSVFEVNTNLAGEYNLYGPSEDTTYSTY
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

BK733_RS25835: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (457..866): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQIFGGEINMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ColR	Phenol-responsive regulator
HgtR	Hydrogen-dependent regulator
MogR	Repressor of flagellar motility genes

NZ_MOOL01000072.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 8,542 - 32,196 nt. (total: 23,655 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

BK733_RS26595: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

BK733_RS26630: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase dehydratase

BK733_RS26600: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

BK733_RS26610: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0000538.3	0.57	ribosomal	nisin Z	Lactococcus lactis
BGC0000542.3	0.57	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.57	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000560.5	0.56	ribosomal	subtilomycin	Bacillus subtilis
BGC0000556.5	0.54	ribosomal	streptin	Streptococcus pyogenes
BGC0000536.3	0.54	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.54	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000549.3	0.54	ribosomal	salivaricin D	Streptococcus salivarius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0000538.3	0.57	ribosomal	nisin Z	Lactococcus lactis
BGC0000542.3	0.57	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.57	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000560.5	0.56	ribosomal	subtilomycin	Bacillus subtilis
BGC0000556.5	0.54	ribosomal	streptin	Streptococcus pyogenes
BGC0000536.3	0.54	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.54	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000549.3	0.54	ribosomal	salivaricin D	Streptococcus salivarius

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.97 out of 26.06

Confidence: medium

Additional weak hits (1):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.92 out of 31.73

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 152 - 246; Score: 41.5

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes

NZ_MOOL01000076.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 24,262 - 50,705 nt. (total: 26,444 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

BK733_RS27340: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase dehydratase

BK733_RS27285: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

BK733_RS27295: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000541.5	0.61	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001618.3	0.56	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0000560.5	0.55	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.55	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0002668.2	0.55	ribosomal	cesin A	Clostridium estertheticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000541.5	0.61	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.61	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001289.5	0.60	ribosomal	penisin	Paenibacillus ehimensis
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001618.3	0.56	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0000560.5	0.55	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.55	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0002668.2	0.55	ribosomal	cesin A	Clostridium estertheticum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BK733_RS27285

BK733_RS27270

Leader:

MINEKNLFDLDVQVTTATGDVDPQ

BK733_RS27275

Leader:

MINEKNLFDLDVQVTTATGDVDPQ

BK733_RS27280

Leader:

MINEKNLFDLDVQVTTATGDVDPQ

Shared core:

ITSISACTPGCGNTGSFNSFCC

Core with dehydrations:

IDhbDhaIDhaACysDhbPGCysGNDhbGDhaFNDhaFCysCys

antiSMASH-DB 4.0 matches for BK733_RS27270

100.0%

NC_022873.1and 92 others:

NZ_CM000742.1 Lanthipeptides: BMYCO0001_RS26515_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18180_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18175_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18170_lanthipeptideNZ_CP011151.1 Lanthipeptides: WR47_RS18165_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19775_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19770_lanthipeptideNZ_CP015350.1 Lanthipeptides: BT246_RS19765_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18710_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18705_lanthipeptideNZ_CP017060.1 Lanthipeptides: FORC47_RS18700_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21370_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21365_lanthipeptideNZ_CP026678.1 Lanthipeptides: C2I25_RS21360_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16385_lanthipeptideNZ_CP035965.1 Lanthipeptides: EXW35_RS16380_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16155_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16150_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16145_lanthipeptideNZ_CP035994.1 Lanthipeptides: EXW32_RS16140_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26195_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26190_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26185_lanthipeptideNZ_CP035999.1 Lanthipeptides: EXW27_RS26180_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16265_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16260_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16255_lanthipeptideNZ_CP036099.1 Lanthipeptides: EXW47_RS16250_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16620_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16615_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16610_lanthipeptideNZ_CP036117.1 Lanthipeptides: EXW43_RS16605_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16110_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16105_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16100_lanthipeptideNZ_CP036145.1 Lanthipeptides: EXW57_RS16095_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14125_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14120_lanthipeptideNZ_CP040334.1 Lanthipeptides: EUC39_RS14115_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18355_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18350_lanthipeptideNZ_CP045606.2 Lanthipeptides: GE376_RS18345_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15835_lanthipeptideNZ_CP047366.1 Lanthipeptides: GSN03_RS15830_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16415_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16410_lanthipeptideNZ_CP071811.1 Lanthipeptides: EXW36_RS16405_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15130_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15125_lanthipeptideNZ_CP072061.1 Lanthipeptides: J5V93_RS15120_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15990_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15985_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15980_lanthipeptideNZ_CP084035.1 Lanthipeptides: LCF45_RS15975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25975_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25970_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25965_lanthipeptideNZ_CP093291.1 Lanthipeptides: MN093_RS25960_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15810_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15805_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15800_lanthipeptideNZ_CP093835.1 Lanthipeptides: MN034_RS15795_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24265_lanthipeptideNZ_JAIPUK010000008.1 Lanthipeptides: K9P71_RS24260_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06155_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06150_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06145_lanthipeptideNZ_JANCTB010000001.1 Lanthipeptides: NMG90_RS06140_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21535_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21530_lanthipeptideNZ_JH792114.1 Lanthipeptides: II3_RS21525_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11095_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11090_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11085_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11080_lanthipeptideNZ_JH792251.1 Lanthipeptides: III_RS11075_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18900_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18895_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18890_lanthipeptideNZ_LDGT01000041.1 Lanthipeptides: ABE17_RS18885_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26430_lanthipeptideNZ_LDHL01000037.1 Lanthipeptides: ABD98_RS26425_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27280_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27275_lanthipeptideNZ_MOOL01000076.1 Lanthipeptides: BK733_RS27270_lanthipeptideNZ_MSTN01000016.1 Lanthipeptides: BVF97_RS28620_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08145_lanthipeptideNZ_NIUP01000011.1 Lanthipeptides: CEU84_RS08140_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26165_lanthipeptideNZ_NKAX01000026.1 Lanthipeptides: CE086_RS26160_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14760_lanthipeptideNZ_NVGU01000011.1 Lanthipeptides: COL71_RS14755_lanthipeptide

Lanthipeptides: YBT1518_RS19670_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITSISACTPGCGNTGSFNSFCC

1

ITSISACTPGCGNTGSFNSFCC

22

95.5%

NC_022873.1:

Lanthipeptides: YBT1518_RS19675_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

IT ISACTPGCGNTGSFNSFCC

1

ITRISACTPGCGNTGSFNSFCC

22

82.6%

NZ_CP047792.1and 1 other:

NZ_JAGSAY010000004.1 Lanthipeptides: KC186_RS06745_lanthipeptide

Lanthipeptides: E3S88_RS07345_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC NTGSFNSFCC

2

ITSHSLCTPGCANTGSFNSFCC

23

with 111 more sequence matches

Only the first 10 are displayed here.

81.8%

NC_006582.1and 6 others:

NZ_BOQQ01000001.1 Lanthipeptides: KI354_RS00530_lanthipeptideNZ_BOQS01000001.1 Lanthipeptides: KI364_RS00675_lanthipeptideNZ_CP019985.1 Lanthipeptides: BC8716_RS09795_lanthipeptideNZ_CP104963.1 Lanthipeptides: N7M99_RS07725_lanthipeptideNZ_FRBS01000002.1 Lanthipeptides: BUC05_RS08990_lanthipeptideNZ_JAODPB010000001.1 Lanthipeptides: N6H06_RS03040_lanthipeptide

Lanthipeptides: ABC_RS22115_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

TS+S CTPGCG TGSFNSFCC

1

FTSVSFCTPGCGETGSFNSFCC

22

81.8%

NC_014023.1and 36 others:

NC_014023.1 Lanthipeptides: BMQ_RS27575_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26425_lanthipeptideNZ_CP018875.1 Lanthipeptides: BUW91_RS26420_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28075_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28070_lanthipeptideNZ_CP028091.1 Lanthipeptides: C1N54_RS28065_lanthipeptideNZ_CP031776.1 Lanthipeptides: D0441_RS30140_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01185_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01180_lanthipeptideNZ_CP041065.1 Lanthipeptides: FJM50_RS01175_lanthipeptideNZ_CP048884.1 Lanthipeptides: BMG_RS27510_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26980_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26975_lanthipeptideNZ_CP058263.1 Lanthipeptides: HW576_RS26970_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26985_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26980_lanthipeptideNZ_CP085427.1 Lanthipeptides: LIT30_RS26975_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27820_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27815_lanthipeptideNZ_CP085432.1 Lanthipeptides: LIT34_RS27810_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25635_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25630_lanthipeptideNZ_JACJHT010000009.1 Lanthipeptides: HNP21_RS25625_lanthipeptideNZ_JAHHYI010000015.1 Lanthipeptides: KM925_RS26245_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28075_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28070_lanthipeptideNZ_JANIOE010000010.1 Lanthipeptides: NQ109_RS28065_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19640_lanthipeptideNZ_NKAQ01000005.1 Lanthipeptides: CE057_RS19635_lanthipeptideNZ_NTZG01000054.1 Lanthipeptides: CN510_RS18265_lanthipeptideNZ_NUIN01000020.1 Lanthipeptides: CN973_RS26930_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30285_lanthipeptideNZ_NUOI01000090.1 Lanthipeptides: COE08_RS30280_lanthipeptideNZ_NUOQ01000009.1 Lanthipeptides: COE31_RS05925_lanthipeptideNZ_NUXL01000007.1 Lanthipeptides: COJ36_RS20885_lanthipeptideNZ_NUZS01000089.1 Lanthipeptides: COJ90_RS28785_lanthipeptide

Lanthipeptides: BMQ_RS27580_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+S CTPGCG+TGS+NSFCC

1

ITSVSLCTPGCGDTGSWNSFCC

22

81.8%

NZ_FNNQ01000006.1and 2 others:

NZ_FNNQ01000006.1 Lanthipeptides: BLV90_RS07685_lanthipeptideNZ_FNNQ01000006.1 Lanthipeptides: BLV90_RS07680_lanthipeptide

Lanthipeptides: BLV90_RS07690_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+S CTPGCG TGSFNS+CC

1

ITSVSLCTPGCGETGSFNSYCC

22

81.8%

NZ_FPAA01000016.1and 3 others:

NZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15995_lanthipeptideNZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15990_lanthipeptideNZ_FPAA01000016.1 Lanthipeptides: CHX35_RS15985_lanthipeptide

Lanthipeptides: CHX35_RS16000_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+S CTPGCG+TGSFNS+CC

1

ITSVSLCTPGCGDTGSFNSYCC

22

81.8%

NZ_LELK01000004.1:

Lanthipeptides: AB986_RS12540_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGCG TGSFNS+CC

1

ITSYSFCTPGCGETGSFNSYCC

22

78.3%

NC_003923.1and 9 others:

NC_009641.1 Lanthipeptides: NWMN_RS09635_lanthipeptideNZ_CP023076.1 Lanthipeptides: CJ017_RS08945_lanthipeptideNZ_CP054876.1 Lanthipeptides: HUW54_RS09150_lanthipeptideNZ_CP077098.1 Lanthipeptides: KSF82_RS09475_lanthipeptideNZ_CP092781.1 Lanthipeptides: ML436_RS08940_lanthipeptideNZ_CP102959.1 Lanthipeptides: NW979_RS08780_lanthipeptideNZ_CP102962.1 Lanthipeptides: NW971_RS09555_lanthipeptideNZ_LR133917.1 Lanthipeptides: ELZ45_RS09155_lanthipeptideNZ_LS483317.1 Lanthipeptides: DQL75_RS09700_lanthipeptide

Lanthipeptides: MW_RS09420_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC TGSFNSFCC

2

ITSHSLCTPGCAKTGSFNSFCC

23

78.3%

NZ_LR134304.1:

Lanthipeptides: EL116_RS09245_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS+ CTPGCG TGSFNSFCC

2

ITSVIGCTPGCGKTGSFNSFCC

23

77.3%

NZ_AP019791.1:

Lanthipeptides: RxyAA322_RS06460_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC TGSFNS+CC

1

ITSYSLCTPGCAKTGSFNSYCC

22

72.7%

NZ_QGTF01000010.1:

Lanthipeptides: BDW27_RS18560_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

+TS+S CTPGC N G+FNSFCC

1

VTSVSVCTPGCEN-GTFNSFCC

21

70.8%

NZ_VKCY01000012.1:

Lanthipeptides: FNK43_RS09020_lanthipeptide

1

ITSISACTPGCGNTGSFNSFCC

22

ITS S CTPGC TGSFNS+CC

3

ITSFSLCTPGCAKTGSFNSYCC

24

MIBiG 4.0 matches for BK733_RS27270

35.3%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

1

ITSISACTPGCGNTGSF

17

ITSIS CTPGC TG+

1

ITSISLCTPGC-KTGAL

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.12 out of 20.97

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.05 out of 20.97

Confidence: strong

Additional weak hits (2):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.40 out of 30.98

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

BK733_RS27270 - Class I

Cleavage pHMM score: 11.60

RODEO score: 33

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.3 Da N = 1; 2034.3 Da N = 2; 2052.3 Da N = 3

BK733_RS27275 - Class I

Cleavage pHMM score: 11.60

RODEO score: 33

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.3 Da N = 1; 2034.3 Da N = 2; 2052.3 Da N = 3

BK733_RS27280 - Class I

Cleavage pHMM score: 11.60

RODEO score: 33

Monoisotopic mass: 1996.9 Da

Molecular weight: 1998.3 Da

Number of bridges: 3

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2016.3 Da N = 1; 2034.3 Da N = 2; 2052.3 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 162 - 259; Score: 83.1

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_MOOL01000078.1 - Region 1 - lanthipeptide-class-iv

Download region GenBank file

Download region SVG

Location: 37,622 - 60,234 nt. (total: 22,613 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

BK733_RS28300: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: protease

BK733_RS28325: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000558.5	0.45	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002701.2	0.40	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0001796.5	0.31	NRPS	tauramamide	Brevibacillus laterosporus DSM 25
BGC0000367.5	0.28	NRPS	gramicidin	Brevibacillus brevis NBRC 100599

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000558.5	0.45	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002701.2	0.40	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0001796.5	0.31	NRPS	tauramamide	Brevibacillus laterosporus DSM 25
BGC0000367.5	0.28	NRPS	gramicidin	Brevibacillus brevis NBRC 100599

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.77 out of 20.97

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.16 out of 28.19

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.66 out of 24.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.19 out of 24.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 14.45 out of 18.16

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.21 out of 25.88

Confidence: medium

Additional weak hits (3):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.99 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.79 out of 30.25

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
PsrA	Oleic acid responsive regulator
ZuR variant 1	Zinc-responsive repressor

NZ_MOOL01000084.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 321 - 12,567 nt. (total: 12,247 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.48	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000617.5	0.43	ribosomal	coagulin	Bacillus coagulans
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002579.2	0.42	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000624.3	0.39	ribosomal	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.48	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000617.5	0.43	ribosomal	coagulin	Bacillus coagulans
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002579.2	0.42	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000624.3	0.39	ribosomal	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.06 out of 18.46

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

Additional weak hits (4):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 30.11

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.07 out of 32.93

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 26.05 out of 36.54

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
RpoN	Regulator of nitrogen assimilation and virulence