GCF_001983975.1 - 50 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP019458.1 (Streptomyces autolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS,terpene-precursor	1	45,590
Region 1.2	betalactone	104,299	133,358
Region 1.3	T3PKS,T1PKS,nucleoside	139,618	343,202	High	bafilomycin B1	PKS:Type I
Region 1.4	NAPAA	564,134	598,270
Region 1.5	NRPS-like	885,535	928,273
Region 1.6	lanthipeptide-class-ii,NRPS,T1PKS,terpene	964,088	1,039,186
Region 1.7	terpene	1,147,219	1,171,008	Low	brasilicardin A	terpene+saccharide
Region 1.8	NRPS	1,193,609	1,272,361
Region 1.9	RiPP-like,T1PKS,hglE-KS	1,280,828	1,406,962	High	hexacosalactone A	other:other
Region 1.10	terpene-precursor	1,485,000	1,506,082
Region 1.11	T1PKS,NRPS-like	1,538,136	1,618,622	High	hygrocin A/hygrocin B	PKS
Region 1.12	T1PKS,NRPS	1,622,470	1,739,859	Medium	meridamycin	NRPS:Type I+PKS
Region 1.13	terpene	1,937,040	1,958,227	High	pristinol	terpene
Region 1.14	terpene	1,967,072	1,989,071	High	cyclooctatin	terpene:Diterpene
Region 1.15	betalactone,T1PKS,NRPS-like	2,054,119	2,151,091	Medium	geldanamycin	PKS
Region 1.16	terpene,PKS-like	2,469,283	2,513,419	Low	rustmicin	PKS:Iterative type I
Region 1.17	T1PKS,NRPS-like	2,589,070	2,663,773	Low	herbimycin A	PKS
Region 1.18	2dos,T1PKS,NRPS-like	2,710,365	2,793,501	Low	divergolide A/divergolide B/divergolide C/divergolide D	PKS:Type I
Region 1.19	terpene	2,967,470	2,996,523	Low	BE-43547A1/BE-43547A2/BE-43547B1/BE-43547B2/BE-43547B3/BE-43547C1/BE-43547C2	NRPS:Type I+PKS:Type I
Region 1.20	NI-siderophore	3,029,395	3,061,208	Low	peucechelin	NRPS:Type I
Region 1.21	ectoine	3,215,721	3,226,125	High	ectoine	other:other
Region 1.22	lassopeptide	3,789,685	3,812,219
Region 1.23	lanthipeptide-class-i	3,897,013	3,923,481
Region 1.24	T1PKS	4,257,465	4,440,274	Medium	desulfoclethramycin/clethramycin	other:other
Region 1.25	RiPP-like	4,575,326	4,587,722
Region 1.26	HR-T2PKS	4,594,676	4,644,913	Medium	(2E,4E,6E,8E)-N-(2-hydroxy-5-oxocyclopent-1-en-1-yl)-9-(o-tolyl)nona-2,4,6,8-tetraenamide/(E)-N-(2-hydroxy-5-oxocyclopent-1-en-1-yl)-5-(o-tolyl)pent-4-enamide	PKS+NRPS:Type I
Region 1.27	NRPS	4,694,799	4,738,809	Medium	ochronotic pigment	other:other
Region 1.28	indole	4,933,381	4,954,529	Medium	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	other:other
Region 1.29	terpene	5,531,569	5,553,965	High	geosmin	terpene:Sesquiterpene
Region 1.30	NI-siderophore	6,619,585	6,649,387	High	legonoxamine A/desferrioxamine B/legonoxamine B	other:other
Region 1.31	betalactone	6,966,296	6,995,679	Medium	belactosin A/belactosin C	other:other
Region 1.32	NRPS-like	7,242,290	7,285,136	High	echoside A/echoside B/echoside C/echoside D/echoside E	NRPS:Type I
Region 1.33	NI-siderophore	7,832,637	7,862,760
Region 1.34	terpene-precursor,arylpolyene,NRPS,aminocoumarin	7,931,320	8,012,417	High	cinnapeptin	NRPS:Type I
Region 1.35	RiPP-like	8,093,396	8,104,934
Region 1.36	T1PKS	8,159,262	8,221,851
Region 1.37	T2PKS	8,333,293	8,405,808	High	spore pigment	PKS
Region 1.38	triceptide	8,608,945	8,630,105
Region 1.39	terpene	8,656,490	8,682,943	High	hopene	terpene
Region 1.40	T1PKS	9,011,925	9,054,789
Region 1.41	butyrolactone	9,239,753	9,250,688
Region 1.42	hserlactone	9,261,859	9,282,617
Region 1.43	redox-cofactor	9,395,650	9,417,741
Region 1.44	T1PKS	9,445,023	9,524,731	High	efomycin K/efomycin L	PKS
Region 1.45	T1PKS	9,616,152	9,789,809	High	nigericin	PKS:Type I
Region 1.46	T1PKS	10,005,573	10,029,028	Low	azalomycin F3a	PKS

NZ_CP019459.1 (Streptomyces autolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	T1PKS	24,239	24,237	Low	fostriecin	PKS

NZ_CP019462.1 (Streptomyces autolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	T1PKS	1	15,584	Low	sceliphrolactam	PKS

NZ_CP019463.1 (Streptomyces autolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	T1PKS	1	15,586	Low	neomediomycin B	PKS+other:other

NZ_CP019464.1 (Streptomyces autolyticus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	T1PKS	1	15,601

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS,terpene-precursor	1	45,590
Region 1.2	betalactone	104,299	133,358
Region 1.3	T3PKS,T1PKS,nucleoside	139,618	343,202	High	bafilomycin B1	PKS:Type I
Region 1.4	NAPAA	564,134	598,270
Region 1.5	NRPS-like	885,535	928,273
Region 1.6	lanthipeptide-class-ii,NRPS,T1PKS,terpene	964,088	1,039,186
Region 1.7	terpene	1,147,219	1,171,008	Low	brasilicardin A	terpene+saccharide
Region 1.8	NRPS	1,193,609	1,272,361
Region 1.9	RiPP-like,T1PKS,hglE-KS	1,280,828	1,406,962	High	hexacosalactone A	other:other
Region 1.10	terpene-precursor	1,485,000	1,506,082
Region 1.11	T1PKS,NRPS-like	1,538,136	1,618,622	High	hygrocin A/hygrocin B	PKS
Region 1.12	T1PKS,NRPS	1,622,470	1,739,859	Medium	meridamycin	NRPS:Type I+PKS
Region 1.13	terpene	1,937,040	1,958,227	High	pristinol	terpene
Region 1.14	terpene	1,967,072	1,989,071	High	cyclooctatin	terpene:Diterpene
Region 1.15	betalactone,T1PKS,NRPS-like	2,054,119	2,151,091	Medium	geldanamycin	PKS
Region 1.16	terpene,PKS-like	2,469,283	2,513,419	Low	rustmicin	PKS:Iterative type I
Region 1.17	T1PKS,NRPS-like	2,589,070	2,663,773	Low	herbimycin A	PKS
Region 1.18	2dos,T1PKS,NRPS-like	2,710,365	2,793,501	Low	divergolide A/divergolide B/divergolide C/divergolide D	PKS:Type I
Region 1.19	terpene	2,967,470	2,996,523	Low	BE-43547A1/BE-43547A2/BE-43547B1/BE-43547B2/BE-43547B3/BE-43547C1/BE-43547C2	NRPS:Type I+PKS:Type I
Region 1.20	NI-siderophore	3,029,395	3,061,208	Low	peucechelin	NRPS:Type I
Region 1.21	ectoine	3,215,721	3,226,125	High	ectoine	other:other
Region 1.22	lassopeptide	3,789,685	3,812,219
Region 1.23	lanthipeptide-class-i	3,897,013	3,923,481
Region 1.24	T1PKS	4,257,465	4,440,274	Medium	desulfoclethramycin/clethramycin	other:other
Region 1.25	RiPP-like	4,575,326	4,587,722
Region 1.26	HR-T2PKS	4,594,676	4,644,913	Medium	(2E,4E,6E,8E)-N-(2-hydroxy-5-oxocyclopent-1-en-1-yl)-9-(o-tolyl)nona-2,4,6,8-tetraenamide/(E)-N-(2-hydroxy-5-oxocyclopent-1-en-1-yl)-5-(o-tolyl)pent-4-enamide	PKS+NRPS:Type I
Region 1.27	NRPS	4,694,799	4,738,809	Medium	ochronotic pigment	other:other
Region 1.28	indole	4,933,381	4,954,529	Medium	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	other:other
Region 1.29	terpene	5,531,569	5,553,965	High	geosmin	terpene:Sesquiterpene
Region 1.30	NI-siderophore	6,619,585	6,649,387	High	legonoxamine A/desferrioxamine B/legonoxamine B	other:other
Region 1.31	betalactone	6,966,296	6,995,679	Medium	belactosin A/belactosin C	other:other
Region 1.32	NRPS-like	7,242,290	7,285,136	High	echoside A/echoside B/echoside C/echoside D/echoside E	NRPS:Type I
Region 1.33	NI-siderophore	7,832,637	7,862,760
Region 1.34	terpene-precursor,arylpolyene,NRPS,aminocoumarin	7,931,320	8,012,417	High	cinnapeptin	NRPS:Type I
Region 1.35	RiPP-like	8,093,396	8,104,934
Region 1.36	T1PKS	8,159,262	8,221,851
Region 1.37	T2PKS	8,333,293	8,405,808	High	spore pigment	PKS
Region 1.38	triceptide	8,608,945	8,630,105
Region 1.39	terpene	8,656,490	8,682,943	High	hopene	terpene
Region 1.40	T1PKS	9,011,925	9,054,789
Region 1.41	butyrolactone	9,239,753	9,250,688
Region 1.42	hserlactone	9,261,859	9,282,617
Region 1.43	redox-cofactor	9,395,650	9,417,741
Region 1.44	T1PKS	9,445,023	9,524,731	High	efomycin K/efomycin L	PKS
Region 1.45	T1PKS	9,616,152	9,789,809	High	nigericin	PKS:Type I
Region 1.46	T1PKS	10,005,573	10,029,028	Low	azalomycin F3a	PKS
Region 2.1	T1PKS	24,239	24,237	Low	fostriecin	PKS
Region 5.1	T1PKS	1	15,584	Low	sceliphrolactam	PKS
Region 6.1	T1PKS	1	15,586	Low	neomediomycin B	PKS+other:other
Region 7.1	T1PKS	1	15,601

No secondary metabolite regions were found in these records:: NZ_CP019460.1 (Streptomyces autolyticus); NZ_CP019461.1 (Streptomyces autolyticus); NZ_CP019465.1 (Streptomyces autolyticus)

Compact view

NZ_CP019458.1 - Region 1 - NRPS,terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 45,590 nt. (total: 45,590 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthetase

BV401_RS00060: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS00150: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.29	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002286.3	0.27	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001250.4	0.27	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.27	NRPS	epichloenin A	Epichloe festucae
BGC0001128.4	0.27	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.26	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.26	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.26	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.26	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001261.3	0.26	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BV401_RS00150: PT_FPPS_like

Domain 1 (63 - 361): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.19 out of 26.85

Confidence: medium

Additional weak hits (11):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.05 out of 27.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.14 out of 39.62

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.30 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.81 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.38 out of 29.38

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.47 out of 29.51

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.68 out of 30.98

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.39 out of 25.88

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

BV401_RS00060: X

AMP-binding (465..867): X

nrpys: Val, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDAFNLEVWLWTGGEVNGYGPTETTVFATR
Nearest Stachelhaus code(s):: Val or aIle DALWWGGVFK (88% 8Å match); Ile DALWWGGVFK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

BV401_RS00065: mxmal

PKS_AT (168..348): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 61.2
Methylmalonyl-CoA: 59.2
Ethylmalonyl-CoA: 48.6
CHC-CoA: 37.2
2-Methylbutyryl-CoA: 36.9
Propionyl-CoA: 36.3
trans-1,2-CPDA: 27.6
Isobutyryl-CoA: 20.9
3-Methylbutyryl-CoA: 16.8
Benzoyl-CoA: 10.6
Acetyl-CoA: 7.5
Malonyl-CoA: 5.6
inactive: 0.0
fatty_acid: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP019458.1 - Region 2 - betalactone

Download region GenBank file

Download region SVG

Location: 104,299 - 133,358 nt. (total: 29,060 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BV401_RS00570: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS00630: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS00635: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BV401_RS00645: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS00705: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: sulfhydrylase

BV401_RS00675: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Ligases: ligase

BV401_RS00620: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.56	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.56	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.54	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000894.4	0.46	other (other)	citrinin	Monascus aurantiacus
BGC0001137.5	0.45	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000595.3	0.43	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002493.3	0.43	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000597.4	0.42	ribosomal	SWA-2138	Streptomyces sp. e14

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.56	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.56	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.54	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000894.4	0.46	other (other)	citrinin	Monascus aurantiacus
BGC0001137.5	0.45	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000595.3	0.43	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002493.3	0.43	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000597.4	0.42	ribosomal	SWA-2138	Streptomyces sp. e14

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.70 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

Additional weak hits (8):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.15 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.03 out of 30.22

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.13 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.43 out of 26.85

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.97 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_CP019458.1 - Region 3 - T1PKS,T3PKS,nucleoside

Download region GenBank file

Download region SVG

Location: 139,618 - 343,202 nt. (total: 203,585 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
nucleoside: (LipM or LipV or LipU or TunD or pur6 or pur10 or nikJ or nikO or truD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BV401_RS00785: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BV401_RS00895: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

BV401_RS00935: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BV401_RS00960: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS00995: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS01020: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS01130: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BV401_RS01140: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: acylase aminotransferase methyltransferase

BV401_RS01195: aminotransferase

smcogs: SMCOG1019: aminotransferase

BV401_RS01205: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

BV401_RS44095: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: deacetylase peptidase phosphatase

BV401_RS00915: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

BV401_RS01125: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

BV401_RS01220: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: decarboxylase

BV401_RS01115: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: ligase synthase

BV401_RS00870: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

BV401_RS00965: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS00970: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS01005: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS01025: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS01040: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS01050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS01055: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

BV401_RS42655: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS44090: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS44330: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS44335: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001454.5	0.63	other (other)	germicidin	Streptomyces argillaceus
BGC0001276.3	0.49	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.49	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.49	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.47	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.42	PKS	oronofacic acid	Pseudomonas syringae
BGC0000068.5	0.35	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0000159.5	0.35	PKS	tautomycin	Streptomyces spiroverticillatus
BGC0000847.4	0.34	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0001537.5	0.34	PKS	butyrolactol A	Streptomyces sp. NBRC 110030

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001454.5	0.86	other (other)	germicidin	Streptomyces argillaceus
BGC0001276.3	0.78	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.78	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.78	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.73	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001051.5	0.65	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.02 out of 29.65

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.03 out of 26.85

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.00 out of 23.79

Confidence: medium

Additional weak hits (35):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.92 out of 36.54

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.62 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.17 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.27 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.59 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.67 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.90 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.94 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.84 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.61 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.52 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.03 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.39 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.78 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.11 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.94 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.92 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.18 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.72 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.78 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.04 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.55 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.16 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 139617 - 343202:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (emal - Me-ohmal) + (ohmal) + (ohmal) + (Me-ccmal - Me-ccmal) + (Me-mal - ccmal - pk) + (Me-mal - Me-ohmal - ohmal - Me-mal) + (Me-ohmal - pk - ccmal) + (pk - Me-redmal - Me-ohmal - Me-ccmal) + (pk) + (Me-ccmal - ohmal) + (Me-redmal - ccmal) + (pk)
Non-colinear ordering:: BV401_RS44095 + BV401_RS44090 + BV401_RS00970 + BV401_RS00965 + BV401_RS44335 + BV401_RS01045 + BV401_RS01040 + BV401_RS01025 + BV401_RS01020 + BV401_RS01005 + BV401_RS42655 + BV401_RS44330 + BV401_RS00995

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 164204 - 335044:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (emal - Me-ohmal) + (ohmal) + (ohmal) + (Me-ccmal - Me-ccmal) + (Me-mal - ccmal - pk) + (Me-mal - Me-ohmal - ohmal - Me-mal) + (Me-ohmal - pk - ccmal) + (pk - Me-redmal - Me-ohmal - Me-ccmal) + (pk) + (Me-ccmal - ohmal) + (Me-redmal - ccmal) + (pk)
Non-colinear ordering:: BV401_RS44095 + BV401_RS44090 + BV401_RS00970 + BV401_RS00965 + BV401_RS44335 + BV401_RS01045 + BV401_RS01040 + BV401_RS01025 + BV401_RS01020 + BV401_RS01005 + BV401_RS42655 + BV401_RS44330 + BV401_RS00995

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS00965: mmal - mmal

PKS_AT (555..837): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.7
Ethylmalonyl-CoA: 202.8
Methoxymalonyl-CoA: 176.5
2-Methylbutyryl-CoA: 137.2
trans-1,2-CPDA: 123.2
Propionyl-CoA: 104.7
Malonyl-CoA: 98.0
CHC-CoA: 86.5
Isobutyryl-CoA: 68.2
Benzoyl-CoA: 52.7
3-Methylbutyryl-CoA: 36.0
inactive: 35.0
Acetyl-CoA: 34.9
fatty_acid: 16.2

PKS_AT (2241..2530): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 201.0
Ethylmalonyl-CoA: 186.7
Methoxymalonyl-CoA: 170.7
2-Methylbutyryl-CoA: 146.0
trans-1,2-CPDA: 121.4
Propionyl-CoA: 108.4
CHC-CoA: 99.4
Malonyl-CoA: 93.5
Isobutyryl-CoA: 66.4
Benzoyl-CoA: 59.9
3-Methylbutyryl-CoA: 40.2
Acetyl-CoA: 39.4
fatty_acid: 24.9
inactive: 21.4

BV401_RS00970: mal

PKS_AT (911..1183): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 164.8
inactive: 81.7
Methoxymalonyl-CoA: 78.9
Methylmalonyl-CoA: 68.4
Propionyl-CoA: 38.3
Ethylmalonyl-CoA: 33.4
CHC-CoA: 30.9
fatty_acid: 28.8
Isobutyryl-CoA: 27.5
Acetyl-CoA: 21.3
2-Methylbutyryl-CoA: 21.3
trans-1,2-CPDA: 19.9
Benzoyl-CoA: 19.0
3-Methylbutyryl-CoA: 16.1

BV401_RS44090: mal

PKS_AT (942..1232): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.1
inactive: 92.7
Methoxymalonyl-CoA: 69.9
Methylmalonyl-CoA: 60.4
Isobutyryl-CoA: 35.7
Ethylmalonyl-CoA: 23.7
Propionyl-CoA: 22.2
Acetyl-CoA: 18.5
Benzoyl-CoA: 16.5
fatty_acid: 15.5
CHC-CoA: 14.2
2-Methylbutyryl-CoA: 9.5
trans-1,2-CPDA: 8.6
3-Methylbutyryl-CoA: 4.3

BV401_RS44095: emal - mmal

PKS_AT (97..394): emal

ATSignature: Isobutyryl-CoA

Top 3 matches:: Isobutyryl-CoA: 83.3%; 2-Methylbutyryl-CoA: 79.2%; Malonyl-CoA: 75.0%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 157.8
Methylmalonyl-CoA: 156.8
2-Methylbutyryl-CoA: 156.4
Methoxymalonyl-CoA: 124.7
Propionyl-CoA: 116.0
CHC-CoA: 96.6
trans-1,2-CPDA: 90.2
Malonyl-CoA: 70.5
Isobutyryl-CoA: 66.6
3-Methylbutyryl-CoA: 37.3
Benzoyl-CoA: 34.0
Acetyl-CoA: 27.7
inactive: 25.5
fatty_acid: 19.5

PKS_AT (1097..1395): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.0
Ethylmalonyl-CoA: 198.5
Methoxymalonyl-CoA: 166.3
2-Methylbutyryl-CoA: 144.4
trans-1,2-CPDA: 120.5
CHC-CoA: 110.4
Propionyl-CoA: 102.4
Malonyl-CoA: 96.1
Isobutyryl-CoA: 70.6
Benzoyl-CoA: 65.1
Acetyl-CoA: 45.2
3-Methylbutyryl-CoA: 37.8
inactive: 30.2
fatty_acid: 25.8

BV401_RS00995: pk

PKS_AT (143..438): pk

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 179.3
Methylmalonyl-CoA: 176.6
Methoxymalonyl-CoA: 152.0
2-Methylbutyryl-CoA: 107.6
trans-1,2-CPDA: 98.3
Propionyl-CoA: 87.6
CHC-CoA: 85.6
Malonyl-CoA: 71.6
Isobutyryl-CoA: 71.5
3-Methylbutyryl-CoA: 57.7
Acetyl-CoA: 49.1
Benzoyl-CoA: 41.8
inactive: 24.0
fatty_acid: 11.9

BV401_RS42655: mmal - mal

PKS_AT (581..867): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.0
Ethylmalonyl-CoA: 194.9
Methoxymalonyl-CoA: 172.6
2-Methylbutyryl-CoA: 141.8
trans-1,2-CPDA: 121.5
CHC-CoA: 116.6
Propionyl-CoA: 113.4
Malonyl-CoA: 86.0
Isobutyryl-CoA: 73.3
Benzoyl-CoA: 53.0
Acetyl-CoA: 30.2
inactive: 23.3
fatty_acid: 22.0
3-Methylbutyryl-CoA: 20.9

PKS_AT (2572..2837): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 175.9
inactive: 83.7
Methoxymalonyl-CoA: 78.5
Methylmalonyl-CoA: 59.9
CHC-CoA: 22.6
Ethylmalonyl-CoA: 22.2
Isobutyryl-CoA: 18.6
Benzoyl-CoA: 16.8
trans-1,2-CPDA: 16.4
fatty_acid: 16.2
Acetyl-CoA: 16.0
Propionyl-CoA: 15.8
2-Methylbutyryl-CoA: 10.4
3-Methylbutyryl-CoA: 0.0

BV401_RS01005: mmal - mal

PKS_AT (557..837): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.3
Ethylmalonyl-CoA: 204.7
Methoxymalonyl-CoA: 175.9
2-Methylbutyryl-CoA: 140.8
trans-1,2-CPDA: 133.2
Propionyl-CoA: 114.1
Malonyl-CoA: 102.1
CHC-CoA: 87.9
Isobutyryl-CoA: 63.5
Benzoyl-CoA: 54.6
3-Methylbutyryl-CoA: 45.6
Acetyl-CoA: 36.9
inactive: 33.6
fatty_acid: 15.6

PKS_AT (2238..2498): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 164.3
inactive: 76.2
Methoxymalonyl-CoA: 64.1
Methylmalonyl-CoA: 46.3
Isobutyryl-CoA: 24.1
Acetyl-CoA: 21.2
fatty_acid: 19.9
Propionyl-CoA: 19.6
CHC-CoA: 16.2
Benzoyl-CoA: 15.4
Ethylmalonyl-CoA: 14.7
2-Methylbutyryl-CoA: 7.6
trans-1,2-CPDA: 2.8
3-Methylbutyryl-CoA: 0.0

BV401_RS01015: pk

PKS_AT (26..249): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BV401_RS01020: pk

PKS_AT (565..845): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 225.1
Methylmalonyl-CoA: 218.9
Methoxymalonyl-CoA: 181.5
2-Methylbutyryl-CoA: 145.1
trans-1,2-CPDA: 139.9
Propionyl-CoA: 116.0
CHC-CoA: 111.3
Malonyl-CoA: 104.5
Isobutyryl-CoA: 80.1
Benzoyl-CoA: 62.2
Acetyl-CoA: 44.5
3-Methylbutyryl-CoA: 29.5
inactive: 27.6
fatty_acid: 25.0

BV401_RS01025: pk - mmal - mmal - mmal

PKS_AT (574..855): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 213.8
Methylmalonyl-CoA: 213.2
Methoxymalonyl-CoA: 179.0
2-Methylbutyryl-CoA: 140.9
trans-1,2-CPDA: 124.5
Propionyl-CoA: 102.7
CHC-CoA: 101.5
Malonyl-CoA: 101.4
Isobutyryl-CoA: 78.8
Benzoyl-CoA: 64.3
Acetyl-CoA: 36.6
fatty_acid: 26.3
3-Methylbutyryl-CoA: 23.8
inactive: 23.4

PKS_AT (2230..2513): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.5
Ethylmalonyl-CoA: 202.1
Methoxymalonyl-CoA: 166.5
2-Methylbutyryl-CoA: 140.1
trans-1,2-CPDA: 124.3
Propionyl-CoA: 107.3
Malonyl-CoA: 90.6
CHC-CoA: 90.4
Isobutyryl-CoA: 65.1
Benzoyl-CoA: 60.2
Acetyl-CoA: 37.0
3-Methylbutyryl-CoA: 31.6
fatty_acid: 27.6
inactive: 20.6

PKS_AT (4195..4483): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.8
Ethylmalonyl-CoA: 207.7
Methoxymalonyl-CoA: 164.0
trans-1,2-CPDA: 130.8
2-Methylbutyryl-CoA: 129.5
Propionyl-CoA: 99.5
CHC-CoA: 92.9
Malonyl-CoA: 83.8
Isobutyryl-CoA: 63.8
Benzoyl-CoA: 54.0
Acetyl-CoA: 33.5
3-Methylbutyryl-CoA: 28.7
inactive: 26.4
fatty_acid: 17.2

PKS_AT (5646..5928): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 218.8
Ethylmalonyl-CoA: 216.2
Methoxymalonyl-CoA: 176.0
trans-1,2-CPDA: 138.1
2-Methylbutyryl-CoA: 133.9
Propionyl-CoA: 106.0
CHC-CoA: 96.8
Malonyl-CoA: 95.4
Isobutyryl-CoA: 67.9
Benzoyl-CoA: 54.5
Acetyl-CoA: 34.0
inactive: 27.5
fatty_acid: 27.1
3-Methylbutyryl-CoA: 27.1

BV401_RS01040: mmal - pk - mal

PKS_AT (560..842): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 213.0
Ethylmalonyl-CoA: 210.1
Methoxymalonyl-CoA: 173.3
2-Methylbutyryl-CoA: 135.3
trans-1,2-CPDA: 133.4
Propionyl-CoA: 105.7
CHC-CoA: 91.1
Malonyl-CoA: 84.6
Isobutyryl-CoA: 60.1
Benzoyl-CoA: 52.5
Acetyl-CoA: 36.0
3-Methylbutyryl-CoA: 30.4
fatty_acid: 26.4
inactive: 24.8

PKS_AT (2066..2358): pk

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 79.2%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 180.8
Methylmalonyl-CoA: 180.5
Methoxymalonyl-CoA: 163.0
2-Methylbutyryl-CoA: 137.8
trans-1,2-CPDA: 108.9
Propionyl-CoA: 99.6
CHC-CoA: 87.5
Malonyl-CoA: 83.1
Isobutyryl-CoA: 48.6
Acetyl-CoA: 35.4
Benzoyl-CoA: 33.0
3-Methylbutyryl-CoA: 29.4
inactive: 18.7
fatty_acid: 13.1

PKS_AT (3523..3820): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.5
inactive: 106.6
Methoxymalonyl-CoA: 67.0
Methylmalonyl-CoA: 57.4
Propionyl-CoA: 33.0
Ethylmalonyl-CoA: 25.2
Isobutyryl-CoA: 23.4
Acetyl-CoA: 23.0
2-Methylbutyryl-CoA: 21.1
CHC-CoA: 12.7
Benzoyl-CoA: 11.7
fatty_acid: 9.4
trans-1,2-CPDA: 9.1
3-Methylbutyryl-CoA: 0.0

BV401_RS01045: mmal - mmal - mal - mmal

PKS_AT (538..816): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 198.4
Ethylmalonyl-CoA: 186.3
Methoxymalonyl-CoA: 167.6
2-Methylbutyryl-CoA: 140.4
Malonyl-CoA: 104.7
Propionyl-CoA: 97.7
trans-1,2-CPDA: 91.7
CHC-CoA: 82.4
Isobutyryl-CoA: 81.3
Benzoyl-CoA: 53.0
Acetyl-CoA: 45.6
inactive: 34.9
fatty_acid: 26.5
3-Methylbutyryl-CoA: 14.6

PKS_AT (1514..1811): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.6
Ethylmalonyl-CoA: 208.5
Methoxymalonyl-CoA: 173.6
2-Methylbutyryl-CoA: 147.8
Propionyl-CoA: 113.5
trans-1,2-CPDA: 111.0
CHC-CoA: 105.4
Malonyl-CoA: 100.1
Benzoyl-CoA: 83.3
Isobutyryl-CoA: 76.8
Acetyl-CoA: 64.3
3-Methylbutyryl-CoA: 33.8
fatty_acid: 33.4
inactive: 21.4

PKS_AT (3032..3324): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.8
inactive: 76.0
Methoxymalonyl-CoA: 69.8
Methylmalonyl-CoA: 60.5
Isobutyryl-CoA: 31.2
Propionyl-CoA: 28.4
Acetyl-CoA: 20.9
Benzoyl-CoA: 18.9
Ethylmalonyl-CoA: 17.9
2-Methylbutyryl-CoA: 16.6
CHC-CoA: 14.2
fatty_acid: 11.8
trans-1,2-CPDA: 8.5
3-Methylbutyryl-CoA: 6.1

PKS_AT (4496..4791): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.3
Ethylmalonyl-CoA: 188.1
Methoxymalonyl-CoA: 178.4
2-Methylbutyryl-CoA: 113.7
trans-1,2-CPDA: 112.7
Malonyl-CoA: 107.4
CHC-CoA: 105.7
Isobutyryl-CoA: 97.5
Propionyl-CoA: 94.4
Benzoyl-CoA: 87.1
Acetyl-CoA: 59.6
3-Methylbutyryl-CoA: 48.5
inactive: 40.3
fatty_acid: 36.1

BV401_RS01050: X

AMP-binding (13..422): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NVAS--SSGSAVTITYVGSLQLYGTTEISGISML
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BV401_RS44335: mmal - mal - pk

PKS_AT (554..852): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.3
Ethylmalonyl-CoA: 203.8
Methoxymalonyl-CoA: 176.5
2-Methylbutyryl-CoA: 134.8
trans-1,2-CPDA: 126.3
Propionyl-CoA: 112.5
CHC-CoA: 95.7
Isobutyryl-CoA: 85.6
Malonyl-CoA: 80.1
Benzoyl-CoA: 63.7
Acetyl-CoA: 40.8
3-Methylbutyryl-CoA: 37.9
fatty_acid: 28.2
inactive: 18.5

PKS_AT (1570..1865): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.9
inactive: 95.4
Methoxymalonyl-CoA: 70.6
Methylmalonyl-CoA: 66.0
Isobutyryl-CoA: 38.9
Ethylmalonyl-CoA: 37.4
Propionyl-CoA: 28.9
Benzoyl-CoA: 24.7
CHC-CoA: 22.1
Acetyl-CoA: 20.8
fatty_acid: 18.6
trans-1,2-CPDA: 14.1
2-Methylbutyryl-CoA: 12.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (3334..3634): pk

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 91.7%; Methylmalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 183.9
Ethylmalonyl-CoA: 181.3
Methoxymalonyl-CoA: 179.5
2-Methylbutyryl-CoA: 128.2
Malonyl-CoA: 96.6
trans-1,2-CPDA: 90.9
Propionyl-CoA: 90.1
Isobutyryl-CoA: 89.2
CHC-CoA: 75.8
Benzoyl-CoA: 49.6
Acetyl-CoA: 48.4
3-Methylbutyryl-CoA: 45.0
inactive: 34.0
fatty_acid: 28.4

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
MexT	Global virulence regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP019458.1 - Region 4 - NAPAA

Download region GenBank file

Download region SVG

Location: 564,134 - 598,270 nt. (total: 34,137 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BV401_RS02255: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase

BV401_RS02285: methyltransferase

smcogs: SMCOG1089: methyltransferase

BV401_RS02320: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: amidase hydrolase

BV401_RS02245: amidase

smcogs: SMCOG1105: amidase

BV401_RS02270: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: dehydratase

BV401_RS02350: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

BV401_RS02305: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.59	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.59	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

Additional weak hits (6):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.77 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.13 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.67 out of 30.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 564133 - 598270:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS02305: X

AMP-binding (43..438): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FVAMFDFSVEEVCCLVSGELNVYGPTEATVTATW
Nearest Stachelhaus code(s):: Ile or Val DFLCLGVVIK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 5 - NRPS-like

Download region GenBank file

Download region SVG

Location: 885,535 - 928,273 nt. (total: 42,739 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BV401_RS03695: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

BV401_RS03720: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

BV401_RS03825: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: acetyltransferase aminotransferase methyltransferase

BV401_RS03740: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

BV401_RS03755: aminotransferase

smcogs: SMCOG1019: aminotransferase

BV401_RS03795: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

BV401_RS03790: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: dehydratase

BV401_RS03760: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

BV401_RS03765: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0002274.2	0.64	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002193.2	0.64	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000340.5	0.53	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000820.5	0.49	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001206.5	0.47	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0001873.3	0.45	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0002274.2	0.64	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002193.2	0.64	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000340.5	0.53	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000820.5	0.49	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001206.5	0.47	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0001873.3	0.45	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (10):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.43 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.49 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.46 out of 20.97

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.61 out of 29.51

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.47 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 885534 - 928273:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS03765: X

AMP-binding (29..426): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AGKIHIAAIEALFTISGGEVPAFGMTETCAGSVF
Nearest Stachelhaus code(s):: Ppa VALFIGAAGK (71% 8Å match); 4-ohPpa IAAFLGAAGK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 6 - NRPS,T1PKS,lanthipeptide-class-ii,terpene

Download region GenBank file

Download region SVG

Location: 964,088 - 1,039,186 nt. (total: 75,099 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BV401_RS04040: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BV401_RS04065: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BV401_RS04160: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

BV401_RS04230: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

BV401_RS04245: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BV401_RS04265: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: carbamoyltransferase methyltransferase

BV401_RS04150: methyltransferase

smcogs: SMCOG1089: methyltransferase

BV401_RS42695: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: phosphatase

BV401_RS04120: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Lyases: cyclase

BV401_RS04080: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase synthase

BV401_RS04110: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

BV401_RS04125: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS04130: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS04135: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BV401_RS04140: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS04145: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BV401_RS04175: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.84	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.82	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.81	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.79	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.79	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BV401_RS04080

BV401_RS04085

Leader:

MNTTVTAWKNAMYREGLAVEPAHPAGA

Core:

VDLSADLPDETGTGAAETLSTQPFFDCCG

Core with dehydrations:

VDLDhaADLPDEDhbGDhbGAAEDhbLDhaDhbQPFFDCysCysG

antiSMASH-DB 4.0 matches for BV401_RS04085

100.0%

NZ_BDFA01000012.1and 6 others:

NZ_CP019458.1 Lanthipeptides: BV401_RS04085_lanthipeptideNZ_CP025018.1 Lanthipeptides: CFP59_RS43145_lanthipeptideNZ_CP029823.1 Lanthipeptides: DNK48_RS43375_lanthipeptideNZ_CP065050.1 Lanthipeptides: I1A49_RS03785_lanthipeptideNZ_JAALLH010000001.1 Lanthipeptides: SMALB_RS03525_lanthipeptideNZ_LJIW01000001.1 Lanthipeptides: SMF913_RS04065_lanthipeptide

Lanthipeptides: BGB88_RS46105_lanthipeptide

1

VDLSADLPDETGTGAAETLSTQPFFDCCG

29

VDLSADLPDETGTGAAETLSTQPFFDCCG

1

VDLSADLPDETGTGAAETLSTQPFFDCCG

29

48.3%

NZ_CP058693.1:

Lanthipeptides: HYQ63_RS37670_lanthipeptide

16

AETLSTQPFFDCCG

29

AETLSTQPFFDCCG

1

AETLSTQPFFDCCG

14

37.9%

NC_016582.1:

Lanthipeptides: SBI_RS52400_lanthipeptide

18

TLSTQPFFDCCG

29

TLSTQPFF CCG

2

TLSTQPFFQCCG

13

with 5 more sequence matches

37.9%

NZ_CP097290.1and 1 other:

NZ_LIWB01000016.1 Lanthipeptides: AMK33_RS42540_lanthipeptide

Lanthipeptides: M4V62_RS43190_lanthipeptide

18

TLSTQPFFDCCG

29

TLSTQPFF+CCG

1

TLSTQPFFNCCG

12

37.9%

NZ_NNBP01000002.1:

Lanthipeptides: CG747_RS46875_lanthipeptide

17

ETLSTQPFFDCCG

29

+TLSTQPFF+CCG

1

KTLSTQPFFNCCG

13

31.0%

NZ_CP072827.1:

Lanthipeptides: J7W19_RS04815_lanthipeptide

11

TGTGAAETLSTQPFFDCC

28

+GT A +T+S PF+ CC

1

SGTIAIKTMS-APFWTCC

17

26.5%

NZ_JACSPO010000013.1and 1 other:

NZ_JACSPO010000013.1 Lanthipeptides: H9624_RS14885_lanthipeptide

Lanthipeptides: H9624_RS14885_lanthipeptide

1

VDLSADLPDETGTGAAET

18

+ +SA LPD TGA T

15

IAISAALPDFCPTGACTT

32

19.0%

NC_019757.1:

Lanthipeptides: allorf_3744133_3744366_lanthipeptide

10

ETGTGAAETLSTQ

22

ETGT + +TL+TQ

25

ETGTKSRQTLNTQ

37

MIBiG 4.0 matches for BV401_RS04085

13.7%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

9

DETGTGAAETLSTQPFFDCCG

29

DE+ AA T CC

30

DESSRPAAPACHTLSSLPCCA

50

allorf_00977752_00977883

Leader:

MHCGTTTASLSTGHLREVVSA

Core:

ESGGRDSVPVRVNVPMLCGDRP

Core with dehydrations:

EDhaGGRDDhaVPVRVNVPMLCysGDRP

antiSMASH-DB 4.0 matches for allorf_00977752_00977883

100.0%

NZ_BDFA01000012.1and 6 others:

NZ_CP019458.1 Lanthipeptides: allorf_00977752_00977883_lanthipeptideNZ_CP025018.1 Lanthipeptides: allorf_10559568_10559699_lanthipeptideNZ_CP029823.1 Lanthipeptides: allorf_10618447_10618578_lanthipeptideNZ_CP065050.1 Lanthipeptides: allorf_00914852_00914983_lanthipeptideNZ_JAALLH010000001.1 Lanthipeptides: allorf_0868461_0868592_lanthipeptideNZ_LJIW01000001.1 Lanthipeptides: allorf_0970795_0970926_lanthipeptide

Lanthipeptides: allorf_122437_122568_lanthipeptide

1

ESGGRDSVPVRVNVPMLCGDRP

22

ESGGRDSVPVRVNVPMLCGDRP

1

ESGGRDSVPVRVNVPMLCGDRP

22

MIBiG 4.0 matches for allorf_00977752_00977883

18.2%

BGC0000477.3 (ACA04491.1 (core 2)):

Cyanobactin: patellin 2 or patellin 3

13

NVPMLC

18

VP LC

1

TVPTLC

6

allorf_00977807_00978004

Leader:

MHSDLLGPDGRGRGGIGEWKTLCDIAGA

Core:

LIRECTLPVASMNALWNNYRLSIDWSPARSGERGERR

Core with dehydrations:

LIRECysDhbLPVADhaMNALWNNYRLDhaIDWDhaPARDhaGERGERR

antiSMASH-DB 4.0 matches for allorf_00977807_00978004

100.0%

NZ_BDFA01000012.1and 5 others:

NZ_CP019458.1 Lanthipeptides: allorf_00977807_00978004_lanthipeptideNZ_CP025018.1 Lanthipeptides: allorf_10559447_10559644_lanthipeptideNZ_CP029823.1 Lanthipeptides: allorf_10618326_10618523_lanthipeptideNZ_CP065050.1 Lanthipeptides: allorf_00914907_00915104_lanthipeptideNZ_LJIW01000001.1 Lanthipeptides: allorf_0970850_0971047_lanthipeptide

Lanthipeptides: allorf_122316_122513_lanthipeptide

1

LIRECTLPVASMNALWNNYRLSIDWSPARSGERGERR

37

LIRECTLPVASMNALWNNYRLSIDWSPARSGERGERR

1

LIRECTLPVASMNALWNNYRLSIDWSPARSGERGERR

37

97.3%

NZ_JAALLH010000001.1:

Lanthipeptides: allorf_0868516_0868713_lanthipeptide

1

LIRECTLPVASMNALWNNYRLSIDWSPARSGERGERR

37

LIRECTLPVASMNALWNNYRLS DWSPARSGERGERR

1

LIRECTLPVASMNALWNNYRLSTDWSPARSGERGERR

37

21.6%

NZ_JAENHX010000011.1:

Lanthipeptides: JIN86_RS20375_lanthipeptide

9

VASMNALWNNYRLSIDWSPARSG

31

+A+ L NNY ++ WS +G

11

IANAVGLGNNYGMACTWSAECNG

33

with 2 more sequence matches

18.4%

NC_017327.1and 1 other:

NZ_CP021217.1 Lanthipeptides: allorf_1158639_1158842_lanthipeptide

Lanthipeptides: allorf_0125265_0125468_lanthipeptide

20

RLSIDWSPARSGERGER

36

R ++ SP++ RGER

7

RPAVGLSPSKPQGRGER

23

16.2%

NZ_RBZW01000021.1:

Lassopeptides: D8Y22_RS07925_lassopeptide

23

IDWSPARSGERGERR

37

+D + +G RG RR

7

VDGNSGTTGNRGHRR

21

allorf_00977826_00977951

Leader:

MENVVRYRGSAHPGM

Core:

HATGRFHECTVEQLPPLYRLVTCEKW

Core with dehydrations:

HADhbGRFHECysDhbVEQLPPLYRLVDhbCysEKW

antiSMASH-DB 4.0 matches for allorf_00977826_00977951

100.0%

NZ_CP019458.1:

Lanthipeptides: allorf_00977826_00977951_lanthipeptide

1

HATGRFHECTVEQLPPLYRLVTCEKW

26

HATGRFHECTVEQLPPLYRLVTCEKW

1

HATGRFHECTVEQLPPLYRLVTCEKW

26

96.2%

NZ_BDFA01000012.1and 5 others:

NZ_CP025018.1 Lanthipeptides: allorf_10559500_10559625_lanthipeptideNZ_CP029823.1 Lanthipeptides: allorf_10618379_10618504_lanthipeptideNZ_CP065050.1 Lanthipeptides: allorf_00914926_00915051_lanthipeptideNZ_JAALLH010000001.1 Lanthipeptides: allorf_0868535_0868660_lanthipeptideNZ_LJIW01000001.1 Lanthipeptides: allorf_0970869_0970994_lanthipeptide

Lanthipeptides: allorf_122369_122494_lanthipeptide

1

HATGRFHECTVEQLPPLYRLVTCEKW

26

HATGRFHEC VEQLPPLYRLVTCEKW

1

HATGRFHECAVEQLPPLYRLVTCEKW

26

20.0%

NZ_CP058277.1:

Lanthipeptides: allorf_2528982_2529143_lanthipeptide

1

HATGRFHECTVEQLPP

16

HA RFH T L P

1

HARRRFHRPTAAALVP

16

with 3 more sequence matches

18.2%

NZ_KZ819178.1and 1 other:

NZ_KZ819178.1 Lanthipeptides: allorf_4075416_4075610_lanthipeptide

Lanthipeptides: allorf_4075416_4075610_lanthipeptide

3

TGRFHECTVEQLPPLYRLVTC

23

+GRFH V PL C

10

SGRFHRPAVRPPSPLLLRPRC

30

17.9%

NZ_CP039292.1and 1 other:

NZ_CP039292.1 Lanthipeptides: allorf_0076338_0076511_lanthipeptide

Lanthipeptides: allorf_0076338_0076511_lanthipeptide

1

HATGRFHECTVEQLPPLYR

19

+GR +C + P Y+

6

EGSGRVSDCLCKGCGPTYK

24

16.7%

NZ_KB217478.1:

Lanthipeptides: allorf_3684331_3684489_lanthipeptide

13

QLPPLYRLVTC

23

Q+P LY L+ C

16

QVPTLYTLINC

26

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

BV401_RS04255: PT_phytoene_like

Domain 1 (18 - 291): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 20.47

Confidence: medium

Additional weak hits (13):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.27 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.29 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.27 out of 25.88

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.76 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.60 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.20 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.04 out of 19.26

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.30 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.34 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.52 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Core peptide predictions

BV401_RS04085 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 2851.3 Da

Molecular weight: 2853.0 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2871.0 Da N = 1; 2889.1 Da N = 2; 2907.1 Da N = 3; 2925.1 Da N = 4

allorf_00977752_00977883 - Class II

Cleavage pHMM score: -5.90

RODEO score: 0

Monoisotopic mass: 2303.1 Da

Molecular weight: 2304.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2322.6 Da N = 1

allorf_00977807_00978004 - Class II

Cleavage pHMM score: -1.80

RODEO score: 0

Monoisotopic mass: 4226.2 Da

Molecular weight: 4228.8 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4246.8 Da N = 1; 4264.8 Da N = 2; 4282.8 Da N = 3; 4300.8 Da N = 4

allorf_00977826_00977951 - Class II

Cleavage pHMM score: -5.60

RODEO score: 0

Monoisotopic mass: 3058.5 Da

Molecular weight: 3060.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3078.5 Da N = 1

Predicted core structure(s)

For candidate cluster 11, location 964087 - 1039186:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe) + (ohmal) + (Pro) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 964411 - 1029322:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe) + (ohmal) + (Pro) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS04125: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (481..879): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVWEMTAVAAGEVNAYGPTETTVAATA
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

BV401_RS04130: mal

PKS_AT (574..865): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 58.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 99.0
inactive: 49.3
Methylmalonyl-CoA: 43.0
Methoxymalonyl-CoA: 40.5
Isobutyryl-CoA: 32.2
Ethylmalonyl-CoA: 20.3
Propionyl-CoA: 18.1
Benzoyl-CoA: 11.7
fatty_acid: 11.6
2-Methylbutyryl-CoA: 10.5
CHC-CoA: 5.6
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS04135: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (606..997): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VASVFDASVWEMYLITGGDFVAYGPTEGTIVQTW
Nearest Stachelhaus code(s):: Leu DAWIIGAIVK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

BV401_RS04140: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (477..878): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: MWEVFDVSAQETYMMTAGEENQYGSSECQVVSSL
Nearest Stachelhaus code(s):: Pro DVQFMAQVVK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

BV401_RS04175: X

AMP-binding (495..887): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VGLGFDVSLQQPDVISGGEFNCYGPTECTVNTTV
Nearest Stachelhaus code(s):: Cap DPQDIGIVNK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 7 - terpene

Download region GenBank file

Download region SVG

Location: 1,147,219 - 1,171,008 nt. (total: 23,790 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BV401_RS04840: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

BV401_RS04845: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase sulfotransferase

BV401_RS04865: aminotransferase

smcogs: SMCOG1019: aminotransferase

BV401_RS04875: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Ligases: synthetase

BV401_RS04860: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002007.2	0.55	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002584.2	0.54	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000632.5	0.54	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0002019.3	0.42	terpene	tiancilactone A, tiancilactone B, tiancilactone C, tiancilactone D, tiancilactone E, tiancilactone F, tiancilactone G, tiancilactone H	Streptomyces sp. CB03234
BGC0000665.5	0.42	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001529.5	0.41	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000640.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002007.2	0.55	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002584.2	0.54	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000632.5	0.54	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0002019.3	0.42	terpene	tiancilactone A, tiancilactone B, tiancilactone C, tiancilactone D, tiancilactone E, tiancilactone F, tiancilactone G, tiancilactone H	Streptomyces sp. CB03234
BGC0000665.5	0.42	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001529.5	0.41	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000640.3	0.41	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BV401_RS04850: T2TS

Domain 1 (271 - 551): Type 2 terpene synthase

Subtype: unknown

BV401_RS04860: PT_FPPS_like

Domain 1 (44 - 336): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.13 out of 29.72

Confidence: medium

Additional weak hits (5):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.77 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.56 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.69 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.19 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.58 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_CP019458.1 - Region 8 - NRPS

Download region GenBank file

Download region SVG

Location: 1,193,609 - 1,272,361 nt. (total: 78,753 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BV401_RS05010: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS05040: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

BV401_RS05060: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS05075: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS05130: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS05145: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: kinase

BV401_RS05025: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: hydrolase

BV401_RS05065: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

BV401_RS05095: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

BV401_RS05100: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BV401_RS05105: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.70	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.70	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.70	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.98 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (13):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.69 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.65 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.16 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.47 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.93 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.76 out of 20.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.66 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.48 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 1193608 - 1272361:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - D-Ala - D-Val - D-Ala - X) + (D-X - Thr - D-Orn - Val - D-Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS05100: Leu - Ala - Val - Ala - X

Search NORINE for peptide: strict or relaxed

AMP-binding (41..424): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAASFDASVLESLIIVGAEVNSYGPTEATVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (76% 8Å match); Leu DALLIGAVVK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1086..1486): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFECSAVLAGEANLYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVALVYK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2606..3003): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTYEVWLWTGGEVDGYGPTETTTFATR
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4124..4525): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFECSAVLAGEANIYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5643..6022): X

nrpys: Leu, 3OH-Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAESFDASVLEMLIIVGGDINAYGPTETTVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (85% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

BV401_RS05105: X - Thr - Orn - Val - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (523..910): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHAFDTSLEGLDLMLGGEYNFYGPTECTIDALA
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2029..2447): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LETHFDFSVWEGSQVFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3115..3507): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDTSWEGVDVMVGGEYNFYGPTECTVDAVY
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4634..5012): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDAATYEVWLWTGGDVDGYGPTETTTFATS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5671..6049): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAASFDASVLEVLIIVGGDVNSYGPTEATVVSTW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (79% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 9 - RiPP-like,T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 1,280,828 - 1,406,962 nt. (total: 126,135 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BV401_RS05250: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS05265: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS05325: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BV401_RS05400: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acetyltransferase acylase glycosyltransferase methyltransferase

BV401_RS05285: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BV401_RS05330: methyltransferase

smcogs: SMCOG1089: methyltransferase

BV401_RS42705: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

BV401_RS45415: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BV401_RS45690: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

BV401_RS05290: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

BV401_RS05300: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS05305: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS05335: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS05370: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

BV401_RS05375: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS05380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS42085: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS45405: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002497.3	1.08	other (other)	hexacosalactone A	Streptomyces sp.
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000107.3	0.54	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002192.3	0.54	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002497.3	0.90	other (other)	hexacosalactone A	Streptomyces sp.
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.74	PKS	oronofacic acid	Pseudomonas syringae
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000037.4	0.64	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (10):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.85 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.67 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.52 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.12 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.99 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.32 out of 25.88

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 17, location 1280827 - 1406962:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk - ohmal - pk - pk) + (Me-ohmal - ohmal) + (mal) + (Me-mal) + (ohmal) + (pk) + (ccmal) + (pk - ccmal - pk)
Non-colinear ordering:: BV401_RS42705 + BV401_RS45690 + BV401_RS05305 + BV401_RS05300 + BV401_RS05295 + BV401_RS42085 + BV401_RS45415 + BV401_RS45405 + BV401_RS05335

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 19, location 1282686 - 1406962:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk - ohmal - pk - pk) + (Me-ohmal - ohmal) + (mal) + (Me-mal) + (ohmal) + (pk) + (ccmal) + (pk - ccmal - pk)
Non-colinear ordering:: BV401_RS42705 + BV401_RS45690 + BV401_RS05305 + BV401_RS05300 + BV401_RS05295 + BV401_RS42085 + BV401_RS45415 + BV401_RS45405 + BV401_RS05335

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS05300: mmal

PKS_AT (631..843): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 8.5
Malonyl-CoA: 4.6
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BV401_RS05305: mal

PKS_AT (1274..1566): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 74.2
Methoxymalonyl-CoA: 35.0
Methylmalonyl-CoA: 33.2
inactive: 24.1
Propionyl-CoA: 19.2
CHC-CoA: 13.0
Isobutyryl-CoA: 7.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BV401_RS05335: pk - mal - pk

PKS_AT (570..868): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 229.8
Methylmalonyl-CoA: 226.2
Methoxymalonyl-CoA: 182.1
2-Methylbutyryl-CoA: 152.8
trans-1,2-CPDA: 135.2
Propionyl-CoA: 115.9
CHC-CoA: 108.2
Malonyl-CoA: 94.0
Isobutyryl-CoA: 79.3
Benzoyl-CoA: 70.6
Acetyl-CoA: 41.4
fatty_acid: 31.8
3-Methylbutyryl-CoA: 30.4
inactive: 24.1

PKS_AT (2351..2638): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 230.9
inactive: 118.2
Methoxymalonyl-CoA: 59.7
Methylmalonyl-CoA: 48.5
Propionyl-CoA: 35.7
2-Methylbutyryl-CoA: 16.9
Isobutyryl-CoA: 13.7
Acetyl-CoA: 11.8
Benzoyl-CoA: 9.3
Ethylmalonyl-CoA: 5.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4181..4479): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 235.4
Methylmalonyl-CoA: 229.8
Methoxymalonyl-CoA: 186.4
2-Methylbutyryl-CoA: 166.8
trans-1,2-CPDA: 137.8
Propionyl-CoA: 123.7
CHC-CoA: 117.5
Malonyl-CoA: 106.4
Isobutyryl-CoA: 79.3
Benzoyl-CoA: 70.6
Acetyl-CoA: 46.3
fatty_acid: 33.7
3-Methylbutyryl-CoA: 31.5
inactive: 28.0

BV401_RS45405: mal

PKS_AT (874..1163): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.2
inactive: 116.7
Methoxymalonyl-CoA: 51.8
Methylmalonyl-CoA: 43.9
Propionyl-CoA: 32.4
Isobutyryl-CoA: 17.8
Acetyl-CoA: 15.4
Benzoyl-CoA: 11.3
2-Methylbutyryl-CoA: 6.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS45415: pk

PKS_AT (555..849): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 231.6
Methylmalonyl-CoA: 228.0
Methoxymalonyl-CoA: 183.3
2-Methylbutyryl-CoA: 167.7
trans-1,2-CPDA: 134.7
Propionyl-CoA: 119.3
CHC-CoA: 114.0
Malonyl-CoA: 101.4
Isobutyryl-CoA: 89.9
Benzoyl-CoA: 76.5
Acetyl-CoA: 42.7
3-Methylbutyryl-CoA: 42.1
fatty_acid: 38.7
inactive: 30.6

BV401_RS42085: mal

PKS_AT (1600..1890): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.2
inactive: 118.1
Methoxymalonyl-CoA: 58.2
Methylmalonyl-CoA: 45.6
Propionyl-CoA: 35.4
2-Methylbutyryl-CoA: 19.5
Isobutyryl-CoA: 13.6
Acetyl-CoA: 12.7
Benzoyl-CoA: 9.3
Ethylmalonyl-CoA: 7.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS45420: emal

PKS_AT (10..146): emal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 66.7%; Methylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 66.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 116.2
Methylmalonyl-CoA: 112.6
2-Methylbutyryl-CoA: 97.5
Methoxymalonyl-CoA: 91.5
trans-1,2-CPDA: 84.4
CHC-CoA: 83.1
Propionyl-CoA: 67.5
Malonyl-CoA: 58.5
Benzoyl-CoA: 40.9
Isobutyryl-CoA: 36.3
Acetyl-CoA: 23.8
fatty_acid: 16.6
inactive: 14.4
3-Methylbutyryl-CoA: 13.8

BV401_RS45690: mmal - mal

PKS_AT (629..927): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 229.2
Ethylmalonyl-CoA: 228.4
Methoxymalonyl-CoA: 184.7
2-Methylbutyryl-CoA: 180.5
trans-1,2-CPDA: 134.9
Propionyl-CoA: 132.2
CHC-CoA: 114.2
Malonyl-CoA: 109.8
Isobutyryl-CoA: 87.9
Benzoyl-CoA: 69.7
fatty_acid: 39.3
Acetyl-CoA: 37.6
3-Methylbutyryl-CoA: 36.0
inactive: 28.3

PKS_AT (2203..2494): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.7
inactive: 108.9
Methoxymalonyl-CoA: 51.7
Methylmalonyl-CoA: 38.8
Propionyl-CoA: 29.0
Isobutyryl-CoA: 20.1
2-Methylbutyryl-CoA: 11.9
Acetyl-CoA: 7.9
Ethylmalonyl-CoA: 5.8
Benzoyl-CoA: 5.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS42705: pk - mal - pk - pk

PKS_AT (558..856): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 79.2%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 211.1
Methylmalonyl-CoA: 208.2
2-Methylbutyryl-CoA: 181.1
Methoxymalonyl-CoA: 169.9
trans-1,2-CPDA: 135.1
Propionyl-CoA: 128.8
CHC-CoA: 111.7
Malonyl-CoA: 94.8
Isobutyryl-CoA: 91.0
Benzoyl-CoA: 66.7
Acetyl-CoA: 54.3
3-Methylbutyryl-CoA: 37.4
fatty_acid: 34.2
inactive: 23.6

PKS_AT (1585..1870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.1
inactive: 121.2
Methoxymalonyl-CoA: 56.4
Methylmalonyl-CoA: 46.5
Propionyl-CoA: 34.7
2-Methylbutyryl-CoA: 16.3
Isobutyryl-CoA: 15.7
Acetyl-CoA: 11.1
Benzoyl-CoA: 9.3
Ethylmalonyl-CoA: 7.4
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3070..3368): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 231.0
Methylmalonyl-CoA: 227.3
Methoxymalonyl-CoA: 184.7
2-Methylbutyryl-CoA: 176.0
trans-1,2-CPDA: 138.8
Propionyl-CoA: 134.7
CHC-CoA: 114.0
Malonyl-CoA: 109.2
Isobutyryl-CoA: 77.3
Benzoyl-CoA: 68.1
Acetyl-CoA: 41.7
fatty_acid: 38.1
inactive: 23.7
3-Methylbutyryl-CoA: 22.6

PKS_AT (4404..4698): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 224.4
Methylmalonyl-CoA: 220.3
Methoxymalonyl-CoA: 175.8
2-Methylbutyryl-CoA: 159.5
trans-1,2-CPDA: 126.1
Propionyl-CoA: 119.0
CHC-CoA: 114.3
Malonyl-CoA: 98.3
Isobutyryl-CoA: 76.4
Benzoyl-CoA: 63.9
Acetyl-CoA: 38.7
fatty_acid: 38.4
3-Methylbutyryl-CoA: 33.1
inactive: 25.7

BV401_RS05375: X

AMP-binding (15..416): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TLRLHSGSGADLTLSYGGCLQFYGTTETSGISVL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BV401_RS05380: X

AMP-binding (9..412): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NTTLHTFGQTGTMGFSGGSYEGYGLTEASPVVAY
Nearest Stachelhaus code(s):: Leu DFLYFGGVVK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_CP019458.1 - Region 10 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1,485,000 - 1,506,082 nt. (total: 21,083 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase methyltransferase

BV401_RS05845: methyltransferase

smcogs: SMCOG1248: methyltransferase

BV401_RS05880: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Ligases: synthetase

BV401_RS05830: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0000676.5	0.37	terpene	aphidicolin, aphidicolan-16β-ol, 3-deoxyaphidicolin, 17-deoxyaphidicolin	Phoma betae
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000688.4	0.36	terpene	copalyl diphosphate	Diaporthe amygdali

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0000676.5	0.37	terpene	aphidicolin, aphidicolan-16β-ol, 3-deoxyaphidicolin, 17-deoxyaphidicolin	Phoma betae
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000688.4	0.36	terpene	copalyl diphosphate	Diaporthe amygdali

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BV401_RS05830: PT_FPPS_like

Domain 1 (64 - 359): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.26 out of 27.04

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.61 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.97 out of 24.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.67 out of 25.75

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.16 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.32 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_CP019458.1 - Region 11 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1,538,136 - 1,618,622 nt. (total: 80,487 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

BV401_RS06020: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

BV401_RS06045: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

BV401_RS06080: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS06110: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS06120: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BV401_RS06135: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

BV401_RS06140: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BV401_RS44470: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase methyltransferase

BV401_RS06195: methyltransferase

smcogs: SMCOG1248: methyltransferase

BV401_RS45765: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

BV401_RS06025: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthase

BV401_RS06100: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS06105: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS44475: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000075.5	0.90	PKS	hygrocin A, hygrocin B	Streptomyces sp. LZ35
BGC0001273.3	0.87	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.86	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.85	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.81	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.62	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001051.5	0.57	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000075.5	0.84	PKS	hygrocin A, hygrocin B	Streptomyces sp. LZ35
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.72	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000113.5	0.64	PKS	niddamycin	Streptomyces caelestis
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001051.5	0.62	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (12):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.15 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.06 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.93 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.62 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.03 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.83 out of 36.54

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.43 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.56 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.10 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 21, location 1538135 - 1618622:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-ccmal - mal - ohmal) + (redemal) + (ccmal) + (Me-redmal) + (Me-mal - ccmal)
Non-colinear ordering:: BV401_RS45485 + BV401_RS45765 + BV401_RS06110 + BV401_RS06105 + BV401_RS06100 + BV401_RS44475 + BV401_RS44470

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS44470: mal

PKS_AT (1..237): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.5
inactive: 88.6
Methoxymalonyl-CoA: 61.4
Methylmalonyl-CoA: 51.6
Propionyl-CoA: 32.9
Acetyl-CoA: 19.9
Isobutyryl-CoA: 16.7
Ethylmalonyl-CoA: 15.4
fatty_acid: 11.4
trans-1,2-CPDA: 10.1
2-Methylbutyryl-CoA: 3.3
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS44475: mmal

PKS_AT (564..863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 195.8
Ethylmalonyl-CoA: 175.7
Methoxymalonyl-CoA: 143.2
2-Methylbutyryl-CoA: 116.2
Propionyl-CoA: 95.6
trans-1,2-CPDA: 92.6
Malonyl-CoA: 79.4
CHC-CoA: 78.6
Benzoyl-CoA: 62.0
Isobutyryl-CoA: 58.0
Acetyl-CoA: 39.8
fatty_acid: 35.0
inactive: 28.0
3-Methylbutyryl-CoA: 20.3

BV401_RS06100: mmal

PKS_AT (571..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 199.7
Ethylmalonyl-CoA: 182.2
Methoxymalonyl-CoA: 146.7
2-Methylbutyryl-CoA: 124.3
Propionyl-CoA: 99.1
trans-1,2-CPDA: 95.6
Malonyl-CoA: 83.5
CHC-CoA: 82.4
Isobutyryl-CoA: 64.2
Benzoyl-CoA: 58.1
Acetyl-CoA: 42.1
fatty_acid: 40.2
inactive: 28.4
3-Methylbutyryl-CoA: 25.0

BV401_RS06105: mal

PKS_AT (570..865): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.1
inactive: 115.6
Methoxymalonyl-CoA: 59.9
Methylmalonyl-CoA: 46.4
Propionyl-CoA: 34.9
Acetyl-CoA: 21.8
Isobutyryl-CoA: 21.4
Ethylmalonyl-CoA: 14.7
trans-1,2-CPDA: 8.3
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BV401_RS06110: emal

PKS_AT (618..915): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 83.3%; Methylmalonyl-CoA: 79.2%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 184.0
Methylmalonyl-CoA: 179.4
Methoxymalonyl-CoA: 141.5
2-Methylbutyryl-CoA: 113.2
Propionyl-CoA: 104.8
trans-1,2-CPDA: 93.4
CHC-CoA: 87.0
Malonyl-CoA: 77.2
Isobutyryl-CoA: 76.4
Benzoyl-CoA: 52.2
Acetyl-CoA: 38.6
fatty_acid: 33.3
3-Methylbutyryl-CoA: 32.8
inactive: 26.5

BV401_RS45765: mal

PKS_AT (1..237): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 173.3
inactive: 91.8
Methoxymalonyl-CoA: 61.3
Methylmalonyl-CoA: 48.4
Propionyl-CoA: 36.3
Acetyl-CoA: 18.7
Isobutyryl-CoA: 16.9
Ethylmalonyl-CoA: 15.7
trans-1,2-CPDA: 9.6
2-Methylbutyryl-CoA: 5.2
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS45485: AHBA - mmal - mal

CAL_domain (34..442): AHBA

minowa: AHBA

Prediction, score:

AHBA: 406.4
shikimic_acid: 243.3
fatty_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0

PKS_AT (1637..1936): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.2
Ethylmalonyl-CoA: 192.8
Methoxymalonyl-CoA: 158.4
2-Methylbutyryl-CoA: 125.2
trans-1,2-CPDA: 114.1
Propionyl-CoA: 105.7
Malonyl-CoA: 91.0
CHC-CoA: 82.7
Isobutyryl-CoA: 72.2
Benzoyl-CoA: 62.0
Acetyl-CoA: 48.8
fatty_acid: 33.4
inactive: 32.7
3-Methylbutyryl-CoA: 20.3

PKS_AT (3358..3661): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.7
inactive: 134.2
Methoxymalonyl-CoA: 73.4
Methylmalonyl-CoA: 49.1
Propionyl-CoA: 34.9
Benzoyl-CoA: 24.4
Isobutyryl-CoA: 21.0
Acetyl-CoA: 20.0
Ethylmalonyl-CoA: 18.9
2-Methylbutyryl-CoA: 13.7
CHC-CoA: 3.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_CP019458.1 - Region 12 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1,622,470 - 1,739,859 nt. (total: 117,390 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BV401_RS06295: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS06390: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS06410: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS06470: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acylase

BV401_RS06405: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: glucosidase

BV401_RS06445: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: dehydratase

BV401_RS06230: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: racemase

BV401_RS06465: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

BV401_RS06395: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS06415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS06455: argininosuccinate synthase

smcogs: SMCOG1291: argininosuccinate synthase

BV401_RS44500: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS44505: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

BV401_RS06430: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001012.3	0.84	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001244.3	0.72	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.71	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002285.2	0.69	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001012.3	0.79	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002285.2	0.68	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001011.5	0.68	NRPS, PKS	meridamycin	Streptomyces sp. NRRL 30748
BGC0000067.5	0.67	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.27 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.46 out of 20.01

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (11):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.64 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.70 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.48 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.54 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.89 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 22, location 1622469 - 1739859:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr) + (mal - pk) + (ohmal) + (pk - pk - Me-redmal) + (Me-ccmal) + (ohmal - ohmal - pk - ohmal - ohmal - pk - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 23, location 1622469 - 1735033:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr) + (mal - pk) + (ohmal) + (pk - pk - Me-redmal) + (Me-ccmal) + (ohmal - ohmal - pk - ohmal - ohmal - pk - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 24, location 1695086 - 1739859:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr) + (mal - pk) + (ohmal) + (pk - pk - Me-redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS44500: mal - mal - pk - mal - mal - pk - mal

PKS_AT (571..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.1
inactive: 108.2
Methoxymalonyl-CoA: 54.6
Methylmalonyl-CoA: 47.5
Propionyl-CoA: 40.1
Isobutyryl-CoA: 40.1
Benzoyl-CoA: 23.5
Acetyl-CoA: 23.0
Ethylmalonyl-CoA: 22.2
fatty_acid: 20.1
CHC-CoA: 13.9
2-Methylbutyryl-CoA: 13.5
trans-1,2-CPDA: 12.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2024..2297): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.1
inactive: 122.7
Methoxymalonyl-CoA: 54.1
Methylmalonyl-CoA: 47.1
Propionyl-CoA: 33.0
Isobutyryl-CoA: 31.6
Ethylmalonyl-CoA: 29.0
Acetyl-CoA: 23.3
Benzoyl-CoA: 19.3
2-Methylbutyryl-CoA: 14.3
fatty_acid: 13.2
CHC-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3475..3763): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 215.1
Methylmalonyl-CoA: 212.7
Methoxymalonyl-CoA: 169.7
trans-1,2-CPDA: 148.2
2-Methylbutyryl-CoA: 148.2
CHC-CoA: 126.6
Propionyl-CoA: 119.5
Malonyl-CoA: 95.6
Isobutyryl-CoA: 82.6
Benzoyl-CoA: 67.6
Acetyl-CoA: 54.8
fatty_acid: 39.1
inactive: 22.5
3-Methylbutyryl-CoA: 10.7

PKS_AT (5015..5288): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.3
inactive: 127.7
Methoxymalonyl-CoA: 55.4
Methylmalonyl-CoA: 49.7
Isobutyryl-CoA: 40.2
Propionyl-CoA: 32.2
Ethylmalonyl-CoA: 25.5
Benzoyl-CoA: 18.8
Acetyl-CoA: 16.0
fatty_acid: 11.5
CHC-CoA: 10.2
2-Methylbutyryl-CoA: 9.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (6474..6747): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 207.2
inactive: 117.0
Methoxymalonyl-CoA: 61.9
Methylmalonyl-CoA: 50.0
Propionyl-CoA: 33.9
Isobutyryl-CoA: 28.9
Ethylmalonyl-CoA: 25.9
Benzoyl-CoA: 24.2
Acetyl-CoA: 20.8
2-Methylbutyryl-CoA: 15.2
fatty_acid: 11.4
CHC-CoA: 11.0
trans-1,2-CPDA: 9.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (8020..8301): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 217.0
Methylmalonyl-CoA: 209.6
Methoxymalonyl-CoA: 166.1
2-Methylbutyryl-CoA: 152.5
trans-1,2-CPDA: 131.5
CHC-CoA: 119.7
Propionyl-CoA: 110.0
Malonyl-CoA: 84.7
Isobutyryl-CoA: 69.8
Benzoyl-CoA: 60.9
Acetyl-CoA: 49.2
fatty_acid: 38.4
inactive: 19.4
3-Methylbutyryl-CoA: 18.7

PKS_AT (10115..10416): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.3
inactive: 97.5
Methoxymalonyl-CoA: 64.3
Methylmalonyl-CoA: 58.7
Propionyl-CoA: 36.5
Isobutyryl-CoA: 31.2
Ethylmalonyl-CoA: 26.9
Acetyl-CoA: 22.1
fatty_acid: 15.7
Benzoyl-CoA: 14.9
2-Methylbutyryl-CoA: 14.5
CHC-CoA: 11.6
trans-1,2-CPDA: 10.0
3-Methylbutyryl-CoA: 0.0

BV401_RS44505: mmal - mmal

PKS_AT (1..234): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Methoxymalonyl-CoA: 70.8%; Malonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 174.3
Ethylmalonyl-CoA: 174.2
Methoxymalonyl-CoA: 139.8
trans-1,2-CPDA: 110.4
2-Methylbutyryl-CoA: 106.2
CHC-CoA: 96.3
Propionyl-CoA: 93.7
Malonyl-CoA: 76.0
Benzoyl-CoA: 58.6
Isobutyryl-CoA: 56.5
Acetyl-CoA: 50.5
fatty_acid: 38.3
3-Methylbutyryl-CoA: 28.3
inactive: 20.4

PKS_AT (2003..2290): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.0
Ethylmalonyl-CoA: 208.5
Methoxymalonyl-CoA: 169.7
trans-1,2-CPDA: 140.1
2-Methylbutyryl-CoA: 138.1
CHC-CoA: 123.3
Propionyl-CoA: 117.8
Malonyl-CoA: 94.0
Isobutyryl-CoA: 73.2
Benzoyl-CoA: 68.3
Acetyl-CoA: 53.7
fatty_acid: 44.9
inactive: 24.4
3-Methylbutyryl-CoA: 11.2

BV401_RS06390: pk - pk

PKS_AT (558..856): pk

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%; Methylmalonyl-CoA: 79.2%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 182.1
Methylmalonyl-CoA: 177.1
Methoxymalonyl-CoA: 150.2
trans-1,2-CPDA: 112.0
2-Methylbutyryl-CoA: 111.9
Propionyl-CoA: 95.0
CHC-CoA: 87.4
Malonyl-CoA: 76.4
Isobutyryl-CoA: 56.7
fatty_acid: 37.0
Benzoyl-CoA: 33.5
Acetyl-CoA: 25.9
inactive: 20.7
3-Methylbutyryl-CoA: 10.5

PKS_AT (2294..2580): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 215.6
Methylmalonyl-CoA: 208.4
Methoxymalonyl-CoA: 169.9
2-Methylbutyryl-CoA: 149.4
trans-1,2-CPDA: 142.3
Propionyl-CoA: 114.6
CHC-CoA: 112.5
Malonyl-CoA: 86.0
Isobutyryl-CoA: 59.2
Benzoyl-CoA: 55.9
Acetyl-CoA: 41.4
fatty_acid: 39.5
3-Methylbutyryl-CoA: 28.7
inactive: 19.3

BV401_RS06395: mal

PKS_AT (912..1185): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.6
inactive: 112.5
Methoxymalonyl-CoA: 60.2
Methylmalonyl-CoA: 48.0
Propionyl-CoA: 30.6
Ethylmalonyl-CoA: 27.3
Isobutyryl-CoA: 25.6
Benzoyl-CoA: 24.2
Acetyl-CoA: 19.6
2-Methylbutyryl-CoA: 16.7
fatty_acid: 15.1
CHC-CoA: 11.9
trans-1,2-CPDA: 9.4
3-Methylbutyryl-CoA: 0.0

BV401_RS06405: mmal

PKS_AT (22..256): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 186.7
Ethylmalonyl-CoA: 186.0
Methoxymalonyl-CoA: 150.6
2-Methylbutyryl-CoA: 123.3
trans-1,2-CPDA: 121.0
CHC-CoA: 105.6
Propionyl-CoA: 99.7
Malonyl-CoA: 71.7
Isobutyryl-CoA: 61.7
Benzoyl-CoA: 56.6
Acetyl-CoA: 49.1
fatty_acid: 40.2
3-Methylbutyryl-CoA: 31.2
inactive: 15.8

BV401_RS06410: mal - pk

PKS_AT (570..868): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.1
inactive: 92.3
Methoxymalonyl-CoA: 66.7
Methylmalonyl-CoA: 50.5
Acetyl-CoA: 27.5
Propionyl-CoA: 22.9
Isobutyryl-CoA: 22.9
Ethylmalonyl-CoA: 19.3
fatty_acid: 15.7
Benzoyl-CoA: 12.6
2-Methylbutyryl-CoA: 9.5
CHC-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1589..1876): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 210.2
Methylmalonyl-CoA: 206.5
Methoxymalonyl-CoA: 168.5
trans-1,2-CPDA: 141.7
2-Methylbutyryl-CoA: 137.1
CHC-CoA: 118.2
Propionyl-CoA: 106.9
Malonyl-CoA: 90.8
Isobutyryl-CoA: 73.3
Benzoyl-CoA: 65.9
fatty_acid: 52.0
Acetyl-CoA: 44.4
inactive: 24.1
3-Methylbutyryl-CoA: 11.8

BV401_RS06415: Hpr

Search NORINE for peptide: strict or relaxed

AMP-binding (487..928): Hpr

nrpys: Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQAFDISLQESFVSQAGEHNHYGPSEAHVVTSY
Nearest Stachelhaus code(s):: Hpr DIQFSAHVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
ArgR	Regulator of arginine biosynthesis genes
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_CP019458.1 - Region 13 - terpene

Download region GenBank file

Download region SVG

Location: 1,937,040 - 1,958,227 nt. (total: 21,188 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

BV401_RS07485: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: cyclase hydratase

BV401_RS07445: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

BV401_RS07475: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

BV401_RS07450: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS07480: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.79	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000683.3	0.76	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002274.2	0.55	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001746.3	0.79	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000683.3	0.76	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002274.2	0.55	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene			C15	C1-C11	none

Genes with terpene domains:

BV401_RS07445: T1TS

Domain 1 (1 - 341): Type 1 terpene synthase

Subtype: Isoafricanol synthase type

Reactions:: FPP → sesquiterpene_C1-C11

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (4):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.00 out of 27.04

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.39 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 14 - terpene

Download region GenBank file

Download region SVG

Location: 1,967,072 - 1,989,071 nt. (total: 22,000 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BV401_RS07545: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BV401_RS07580: Hydroxylation

MITE: MITE0000061Hydroxylation (identity: 95.10%)
smcogs: SMCOG1034: cytochrome P450

BV401_RS07585: Hydroxylation

MITE: MITE0000062Hydroxylation (identity: 94.30%)
smcogs: SMCOG1034: cytochrome P450

BV401_RS07590: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS07610: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthetase

BV401_RS07570: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.91	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000660.5	0.59	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002391.2	0.57	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002736.2	0.57	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000675.5	0.55	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001911.3	0.52	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.52	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001475.4	0.52	terpene	aspterric acid	Aspergillus terreus NIH2624

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.91	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000660.5	0.59	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002391.2	0.57	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002736.2	0.57	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000675.5	0.55	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001911.3	0.52	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.52	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001475.4	0.52	terpene	aspterric acid	Aspergillus terreus NIH2624

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BV401_RS07570: PT_FPPS_like

Domain 1 (52 - 358): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BV401_RS07575: T1TS

Domain 1 (94 - 295): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (7):

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.75 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.07 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.07 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.48 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.56 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.24 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 15 - NRPS-like,T1PKS,betalactone

Download region GenBank file

Download region SVG

Location: 2,054,119 - 2,151,091 nt. (total: 96,973 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BV401_RS08130: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BV401_RS08150: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BV401_RS08160: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

BV401_RS08185: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase acylase methyltransferase

BV401_RS07935: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

BV401_RS08075: methyltransferase

smcogs: SMCOG1248: methyltransferase

BV401_RS08115: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase phosphatase

BV401_RS08145: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

BV401_RS08195: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: dehydratase hydratase lyase

BV401_RS07995: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BV401_RS08000: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

BV401_RS08005: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BV401_RS08100: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Isomerases: racemase

BV401_RS08085: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

BV401_RS07990: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

BV401_RS08010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS08090: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

BV401_RS08110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS08120: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS08175: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000068.5	1.12	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0000067.5	0.94	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001275.3	0.83	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.60	PKS	oronofacic acid	Pseudomonas syringae
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000068.5	0.97	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0000067.5	0.86	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000066.5	0.71	PKS	geldanamycin	Streptomyces hygroscopicus
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0000074.5	0.64	PKS	herbimycin A	Streptomyces hygroscopicus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.48 out of 23.79

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.33 out of 29.51

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.29 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.52 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.63 out of 28.19

Confidence: medium

Additional weak hits (19):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.62 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.01 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.24 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.96 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.11 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.36 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.01 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.10 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.12 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.15 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.03 out of 30.11

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.94 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.96 out of 32.93

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.32 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 27, location 2054118 - 2151091:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-redmal) + (redmal - Me-ccmal) + (Me-ccmal - ohmxmal)
Non-colinear ordering:: BV401_RS08110 + BV401_RS08120 + BV401_RS08115

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 29, location 2068610 - 2151091:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-redmal) + (redmal - Me-ccmal) + (Me-ccmal - ohmxmal)
Non-colinear ordering:: BV401_RS08110 + BV401_RS08120 + BV401_RS08115

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS08010: X

AMP-binding (15..430): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DFSRHAGSTLSASGWV---VAGYGLSEASPNVAQ
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BV401_RS08110: AHBA - mmal

CAL_domain (34..442): AHBA

minowa: AHBA

Prediction, score:

AHBA: 530.0
shikimic_acid: 272.5
Acetyl-CoA: 13.2
fatty_acid: 0.0
NH2: 0.0

PKS_AT (1660..1957): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 205.3
Ethylmalonyl-CoA: 181.6
Methoxymalonyl-CoA: 167.9
2-Methylbutyryl-CoA: 124.4
Propionyl-CoA: 110.2
Malonyl-CoA: 101.0
trans-1,2-CPDA: 96.0
CHC-CoA: 76.5
Isobutyryl-CoA: 69.6
Benzoyl-CoA: 56.5
Acetyl-CoA: 37.7
3-Methylbutyryl-CoA: 36.8
inactive: 24.2
fatty_acid: 23.4

BV401_RS08115: mmal - mxmal

PKS_AT (573..872): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.0
Ethylmalonyl-CoA: 193.7
Methoxymalonyl-CoA: 177.2
2-Methylbutyryl-CoA: 131.2
Propionyl-CoA: 115.2
Malonyl-CoA: 103.6
trans-1,2-CPDA: 99.8
CHC-CoA: 80.6
Isobutyryl-CoA: 75.0
Benzoyl-CoA: 56.5
3-Methylbutyryl-CoA: 41.6
Acetyl-CoA: 40.3
inactive: 28.2
fatty_acid: 24.3

PKS_AT (2335..2635): mxmal

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 100.0%; Ethylmalonyl-CoA: 91.7%; Methylmalonyl-CoA: 91.7%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 192.7
Methylmalonyl-CoA: 185.0
Ethylmalonyl-CoA: 180.4
2-Methylbutyryl-CoA: 128.2
Malonyl-CoA: 96.1
trans-1,2-CPDA: 94.1
Propionyl-CoA: 90.6
CHC-CoA: 74.8
Isobutyryl-CoA: 66.7
Benzoyl-CoA: 56.6
Acetyl-CoA: 35.3
3-Methylbutyryl-CoA: 32.2
inactive: 28.5
fatty_acid: 11.9

BV401_RS08120: mal - mmal

PKS_AT (583..891): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 230.9
inactive: 124.4
Methoxymalonyl-CoA: 67.1
Methylmalonyl-CoA: 60.3
Propionyl-CoA: 34.0
Isobutyryl-CoA: 31.7
Benzoyl-CoA: 28.8
Acetyl-CoA: 19.9
2-Methylbutyryl-CoA: 14.4
Ethylmalonyl-CoA: 14.3
CHC-CoA: 12.5
trans-1,2-CPDA: 11.6
fatty_acid: 10.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (2655..2952): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.0
Ethylmalonyl-CoA: 187.7
Methoxymalonyl-CoA: 171.6
2-Methylbutyryl-CoA: 124.1
Propionyl-CoA: 112.7
Malonyl-CoA: 102.1
trans-1,2-CPDA: 97.9
CHC-CoA: 82.8
Isobutyryl-CoA: 72.4
Benzoyl-CoA: 56.8
Acetyl-CoA: 41.6
3-Methylbutyryl-CoA: 41.2
inactive: 26.8
fatty_acid: 26.2

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
ZuR variant 1	Zinc-responsive repressor

NZ_CP019458.1 - Region 16 - PKS-like,terpene

Download region GenBank file

Download region SVG

Location: 2,469,283 - 2,513,419 nt. (total: 44,137 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BV401_RS09615: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS09675: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acylase methyltransferase

BV401_RS09645: methyltransferase

smcogs: SMCOG1089: methyltransferase

BV401_RS09660: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

BV401_RS09720: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase dehydratase

BV401_RS09630: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

BV401_RS09640: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

BV401_RS09665: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS09670: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	1.23	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	1.03	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000065.5	0.39	PKS	rustmicin	Streptomyces galbus
BGC0000275.4	0.25	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0002045.3	0.23	PKS	persiamycin A	Streptomonospora sp. PA3
BGC0001580.3	0.23	PKS	ebelactone	Kitasatospora aburaviensis
BGC0001782.3	0.23	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0002504.2	0.23	PKS	nocardiopsistin A, nocardiopsistin B, nocardiopsistin C	Nocardiopsis sp.
BGC0002443.3	0.23	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.85	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000065.5	0.58	PKS	rustmicin	Streptomyces galbus
BGC0000657.5	0.55	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001475.4	0.49	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000798.3	0.46	saccharide	dhurrin	Sorghum bicolor
BGC0000886.4	0.46	other (other)	allylmalonyl-CoA	Streptomyces tsukubensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

BV401_RS09640: T1TS

Domain 1 (9 - 425): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.11 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (17):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.26 out of 20.01

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.55 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.52 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.93 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.00 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.95 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.14 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.80 out of 36.54

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.45 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.44 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.65 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.90 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 30, location 2469282 - 2513419:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mxmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 32, location 2472390 - 2513419:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mxmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS09660: mxmal

PKS_AT (20..290): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 20.9
Malonyl-CoA: 19.3
Methylmalonyl-CoA: 18.2
2-Methylbutyryl-CoA: 10.0
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production

NZ_CP019458.1 - Region 17 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 2,589,070 - 2,663,773 nt. (total: 74,704 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BV401_RS10110: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS10155: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BV401_RS10165: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

BV401_RS10290: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BV401_RS10325: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BV401_RS43905: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

BV401_RS10260: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BV401_RS44595: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: phosphatase

BV401_RS10150: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: synthase

BV401_RS10255: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS10265: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS45635: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.86	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.85	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.79	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.65	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.64	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (13):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.38 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.73 out of 18.57

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.27 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.52 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.23 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 33, location 2589069 - 2663773:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (AHBA - pk - redmal) + (pk) + (Me-ccmal) + (ccmal)
Non-colinear ordering:: BV401_RS45635 + BV401_RS10255 + BV401_RS10260 + BV401_RS10265 + BV401_RS10270

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS45635: AHBA - pk - mal

CAL_domain (34..440): AHBA

minowa: AHBA

Prediction, score:

AHBA: 382.6
shikimic_acid: 254.0
NH2: 10.6
fatty_acid: 0.0
Acetyl-CoA: -4.1

PKS_AT (1508..1802): pk

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%; Methylmalonyl-CoA: 87.5%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 180.0
Methylmalonyl-CoA: 169.5
Methoxymalonyl-CoA: 156.0
trans-1,2-CPDA: 113.0
2-Methylbutyryl-CoA: 105.7
Propionyl-CoA: 90.2
CHC-CoA: 88.7
Malonyl-CoA: 81.9
Benzoyl-CoA: 49.3
Isobutyryl-CoA: 33.9
Acetyl-CoA: 29.0
inactive: 13.8
3-Methylbutyryl-CoA: 13.1
fatty_acid: 9.5

PKS_AT (3178..3461): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.2
inactive: 81.5
Methoxymalonyl-CoA: 64.6
Methylmalonyl-CoA: 53.9
Ethylmalonyl-CoA: 29.6
Propionyl-CoA: 27.3
Isobutyryl-CoA: 14.3
2-Methylbutyryl-CoA: 14.0
CHC-CoA: 12.4
Benzoyl-CoA: 12.1
trans-1,2-CPDA: 8.5
fatty_acid: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS10255: pk

PKS_AT (569..863): pk

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%; Methylmalonyl-CoA: 87.5%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 180.0
Methylmalonyl-CoA: 169.5
Methoxymalonyl-CoA: 156.0
trans-1,2-CPDA: 113.0
2-Methylbutyryl-CoA: 105.7
Propionyl-CoA: 90.2
CHC-CoA: 88.7
Malonyl-CoA: 81.9
Benzoyl-CoA: 49.3
Isobutyryl-CoA: 33.9
Acetyl-CoA: 29.0
inactive: 13.8
3-Methylbutyryl-CoA: 13.1
fatty_acid: 9.5

BV401_RS10260: mmal

PKS_AT (550..839): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 196.7
Ethylmalonyl-CoA: 187.9
Methoxymalonyl-CoA: 156.6
2-Methylbutyryl-CoA: 129.3
trans-1,2-CPDA: 101.6
Propionyl-CoA: 93.8
CHC-CoA: 90.2
Malonyl-CoA: 84.7
Isobutyryl-CoA: 71.6
Benzoyl-CoA: 62.2
Acetyl-CoA: 53.5
fatty_acid: 37.0
3-Methylbutyryl-CoA: 31.5
inactive: 22.2

BV401_RS44595: pk

PKS_AT (0..211): pk

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 66.7%; Methylmalonyl-CoA: 66.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 110.4
Methylmalonyl-CoA: 104.1
Methoxymalonyl-CoA: 104.1
trans-1,2-CPDA: 68.5
CHC-CoA: 55.8
2-Methylbutyryl-CoA: 54.6
Propionyl-CoA: 45.1
Malonyl-CoA: 42.7
Benzoyl-CoA: 26.1
inactive: 14.9
fatty_acid: 12.0
Acetyl-CoA: 11.4
Isobutyryl-CoA: 8.2
3-Methylbutyryl-CoA: 0.0

BV401_RS10265: mal

PKS_AT (552..835): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.2
inactive: 81.5
Methoxymalonyl-CoA: 64.6
Methylmalonyl-CoA: 53.9
Ethylmalonyl-CoA: 29.6
Propionyl-CoA: 27.3
Isobutyryl-CoA: 14.3
2-Methylbutyryl-CoA: 14.0
CHC-CoA: 12.4
Benzoyl-CoA: 12.1
trans-1,2-CPDA: 8.5
fatty_acid: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_CP019458.1 - Region 18 - 2dos,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 2,710,365 - 2,793,501 nt. (total: 83,137 nt) Show pHMM detection rules used

2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

BV401_RS10635: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BV401_RS10650: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BV401_RS10670: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

BV401_RS10725: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BV401_RS10750: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

BV401_RS10765: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BV401_RS44175: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

BV401_RS10675: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: hydrolase

BV401_RS10665: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: dehydratase

BV401_RS10605: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

BV401_RS10625: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

BV401_RS10630: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS10655: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS10680: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

BV401_RS10690: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS10695: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS10705: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS10710: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS44180: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

BV401_RS10740: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	1.34	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	1.28	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	1.28	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	1.26	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	1.02	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	1.01	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.95	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.93	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.89	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.87	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.70	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.70	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001163.3	0.64	PKS	1-heptadecene	Moorea producens 3L
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (16):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.50 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.71 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.86 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.27 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.22 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.46 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.57 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.73 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.90 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.30 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.69 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.00 out of 29.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.09 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 34, location 2710364 - 2793501:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (AHBA - Me-ccmal - mal - pk) + (Me-redmal) + (Me-redmal) + (Me-ccmal) + (pk)
Non-colinear ordering:: BV401_RS10710 + BV401_RS10705 + BV401_RS44180 + BV401_RS44175 + BV401_RS10695 + BV401_RS10690

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS10630: Acetyl-CoA

CAL_domain (45..497): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 49.0
fatty_acid: 15.3
AHBA: 2.7
NH2: 2.1
shikimic_acid: -4.8

BV401_RS10655: X

AMP-binding (47..462): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAIL---ITVSSTAFSEGARATYGMTELSIGTWT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BV401_RS10690: pk

PKS_AT (572..871): pk

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 83.3%; Methylmalonyl-CoA: 79.2%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 182.1
Ethylmalonyl-CoA: 176.8
Methoxymalonyl-CoA: 154.7
trans-1,2-CPDA: 127.4
2-Methylbutyryl-CoA: 117.6
CHC-CoA: 99.7
Malonyl-CoA: 98.0
Propionyl-CoA: 94.9
Isobutyryl-CoA: 87.7
Benzoyl-CoA: 60.9
fatty_acid: 50.9
3-Methylbutyryl-CoA: 41.5
Acetyl-CoA: 40.5
inactive: 28.8

BV401_RS10695: mmal

PKS_AT (570..868): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 205.8
Ethylmalonyl-CoA: 198.4
Methoxymalonyl-CoA: 167.4
2-Methylbutyryl-CoA: 124.9
trans-1,2-CPDA: 121.7
Propionyl-CoA: 107.7
CHC-CoA: 87.9
Malonyl-CoA: 83.1
Isobutyryl-CoA: 77.4
Benzoyl-CoA: 66.0
fatty_acid: 34.7
Acetyl-CoA: 29.6
3-Methylbutyryl-CoA: 25.6
inactive: 21.9

BV401_RS44175: mmal

PKS_AT (2..262): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Methoxymalonyl-CoA: 75.0%; Malonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 144.6
Ethylmalonyl-CoA: 135.6
Methoxymalonyl-CoA: 126.4
trans-1,2-CPDA: 76.8
Isobutyryl-CoA: 75.7
2-Methylbutyryl-CoA: 67.1
Propionyl-CoA: 64.9
CHC-CoA: 64.5
Malonyl-CoA: 63.8
fatty_acid: 45.3
Benzoyl-CoA: 41.0
3-Methylbutyryl-CoA: 23.2
Acetyl-CoA: 20.1
inactive: 13.8

BV401_RS10705: mmal

PKS_AT (570..869): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 183.3
Ethylmalonyl-CoA: 174.7
Methoxymalonyl-CoA: 148.8
trans-1,2-CPDA: 110.6
2-Methylbutyryl-CoA: 93.2
Propionyl-CoA: 91.5
Isobutyryl-CoA: 87.7
CHC-CoA: 81.6
Malonyl-CoA: 78.3
Benzoyl-CoA: 56.1
Acetyl-CoA: 32.6
fatty_acid: 30.9
3-Methylbutyryl-CoA: 21.4
inactive: 17.4

BV401_RS10710: AHBA - mmal - mal - pk

CAL_domain (29..444): AHBA

minowa: AHBA

Prediction, score:

AHBA: 420.6
shikimic_acid: 243.0
Acetyl-CoA: 10.5
fatty_acid: 0.0
NH2: 0.0

PKS_AT (1564..1863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 192.7
Ethylmalonyl-CoA: 185.5
Methoxymalonyl-CoA: 154.6
trans-1,2-CPDA: 111.9
2-Methylbutyryl-CoA: 109.6
Propionyl-CoA: 100.9
Isobutyryl-CoA: 98.3
CHC-CoA: 91.4
Malonyl-CoA: 82.3
Benzoyl-CoA: 60.9
fatty_acid: 48.9
Acetyl-CoA: 37.1
3-Methylbutyryl-CoA: 34.5
inactive: 17.7

PKS_AT (3260..3554): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.8
inactive: 82.0
Methoxymalonyl-CoA: 68.6
Methylmalonyl-CoA: 54.3
Isobutyryl-CoA: 37.8
Propionyl-CoA: 33.0
Ethylmalonyl-CoA: 29.4
trans-1,2-CPDA: 18.0
Acetyl-CoA: 15.9
Benzoyl-CoA: 12.9
2-Methylbutyryl-CoA: 12.0
CHC-CoA: 11.6
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4570..4871): pk

ATSignature: Ethylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%; Methylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 191.1
Ethylmalonyl-CoA: 186.2
Methoxymalonyl-CoA: 150.5
2-Methylbutyryl-CoA: 131.4
CHC-CoA: 108.9
trans-1,2-CPDA: 103.0
Malonyl-CoA: 100.2
Isobutyryl-CoA: 99.2
Propionyl-CoA: 99.1
Benzoyl-CoA: 51.0
Acetyl-CoA: 50.5
fatty_acid: 47.1
3-Methylbutyryl-CoA: 25.2
inactive: 23.7

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CelR	Cellobiose uptake repressor

NZ_CP019458.1 - Region 19 - terpene

Download region GenBank file

Download region SVG

Location: 2,967,470 - 2,996,523 nt. (total: 29,054 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BV401_RS11615: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Lyases: lyase

BV401_RS11640: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Isomerases: isomerase

BV401_RS11585: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase synthetase

BV401_RS11600: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BV401_RS11605: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

BV401_RS11625: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

BV401_RS11645: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002458.3	0.65	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0000665.5	0.52	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002591.2	0.50	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000668.5	0.49	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0000666.5	0.49	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0000663.5	0.48	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001594.3	0.48	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000937.5	0.47	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002458.3	0.65	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0000665.5	0.52	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002591.2	0.50	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000668.5	0.49	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0000666.5	0.49	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0000663.5	0.48	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001594.3	0.48	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000937.5	0.47	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BV401_RS11600: PT_FPPS_like

Domain 1 (61 - 349): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BV401_RS11630: TS_Pyr4

Domain 1 (18 - 228): Pyr4 type terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

Additional weak hits (6):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.68 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.54 out of 23.43

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.44 out of 32.74

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.30 out of 32.38

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_CP019458.1 - Region 20 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 3,029,395 - 3,061,208 nt. (total: 31,814 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BV401_RS11800: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase transferase

BV401_RS11795: methyltransferase

smcogs: SMCOG1089: methyltransferase

BV401_RS11880: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: decarboxylase

BV401_RS11860: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

BV401_RS11830: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001408.5	0.63	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0000947.5	0.50	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002031.3	0.47	other (other)	kitasetaline	Kitasatospora setae KM-6054

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001408.5	0.63	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0000947.5	0.50	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002031.3	0.47	other (other)	kitasetaline	Kitasatospora setae KM-6054

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.62 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.90 out of 36.53

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 26.17 out of 29.65

Confidence: medium

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.66 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.84 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.34 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.26 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.73 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
DmdR1	Iron(II)-dependent repressor
LexA variant 1	Repressor of DNA damage response

NZ_CP019458.1 - Region 21 - ectoine

Download region GenBank file

Download region SVG

Location: 3,215,721 - 3,226,125 nt. (total: 10,405 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BV401_RS12655: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase

BV401_RS12635: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BV401_RS12650: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.86	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.86	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.61 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.40 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_CP019458.1 - Region 22 - lassopeptide

Download region GenBank file

Download region SVG

Location: 3,789,685 - 3,812,219 nt. (total: 22,535 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BV401_RS15150: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS15185: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: hydrolase

BV401_RS15160: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001539.4	0.50	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001634.3	0.48	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002318.2	0.46	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000927.3	0.44	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0001364.3	0.44	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002496.3	0.44	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000041.3	0.42	PKS	oronofacic acid	Pseudomonas syringae
BGC0002706.2	0.41	NRPS	saframycin Mx1	Myxococcus xanthus
BGC0002015.4	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001539.4	0.50	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001634.3	0.48	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002318.2	0.46	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000927.3	0.44	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0001364.3	0.44	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002496.3	0.44	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000041.3	0.42	PKS	oronofacic acid	Pseudomonas syringae
BGC0002706.2	0.41	NRPS	saframycin Mx1	Myxococcus xanthus
BGC0002015.4	0.40	ribosomal	aborycin	Streptomyces sp. ZS0098

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.30 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.53 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.22 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 39.62

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 83; Score: 41.4

TFBS definitions

Regulator	Description

NZ_CP019458.1 - Region 23 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 3,897,013 - 3,923,481 nt. (total: 26,469 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase

BV401_RS15635: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase dehydratase

BV401_RS15665: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

BV401_RS15670: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.52	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000434.5	0.26	NRPS	SW-163C, UK-63598, SW-163E, SW-163F, SW-163G	Streptomyces sp. SNA15896
BGC0000429.4	0.22	NRPS, PKS	skyllamycin A, skyllamycin B	Streptomyces sp. Acta 2897

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.52	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000434.5	0.26	NRPS	SW-163C, UK-63598, SW-163E, SW-163F, SW-163G	Streptomyces sp. SNA15896
BGC0000429.4	0.22	NRPS, PKS	skyllamycin A, skyllamycin B	Streptomyces sp. Acta 2897

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.00 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.73 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.24 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.09 out of 32.93

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 158 - 250; Score: 60.1

TFBS definitions

Regulator	Description

NZ_CP019458.1 - Region 24 - T1PKS

Download region GenBank file

Download region SVG

Location: 4,257,465 - 4,440,274 nt. (total: 182,810 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

BV401_RS17155: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS17225: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS17325: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BV401_RS17330: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: acetyltransferase acylase kinase

BV401_RS17135: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BV401_RS17235: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BV401_RS17270: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

BV401_RS17345: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: dehalogenase esterase hydrolase

BV401_RS17120: thioesterase

smcogs: SMCOG1004: thioesterase

BV401_RS17145: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BV401_RS17195: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BV401_RS17310: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

BV401_RS17230: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS17250: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS17260: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS17265: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS17275: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS44725: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002498.3	0.77	other (other)	desulfoclethramycin, clethramycin	Streptomyces sp.
BGC0002355.2	0.74	PKS, other (other)	tetrafibricin	Streptomyces neyagawaensis
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002357.3	0.72	PKS, other (other)	neomediomycin B	Streptomyces sp. RK95-74
BGC0002356.3	0.68	PKS, other (other)	mediomycin A	Streptomyces blastmyceticus
BGC0001662.4	0.68	PKS	mediomycin A	Kitasatospora mediocidica
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002498.3	0.77	other (other)	desulfoclethramycin, clethramycin	Streptomyces sp.
BGC0002355.2	0.74	PKS, other (other)	tetrafibricin	Streptomyces neyagawaensis
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002357.3	0.72	PKS, other (other)	neomediomycin B	Streptomyces sp. RK95-74
BGC0002356.3	0.68	PKS, other (other)	mediomycin A	Streptomyces blastmyceticus
BGC0001662.4	0.68	PKS	mediomycin A	Kitasatospora mediocidica
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 23.52 out of 26.33

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.47 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.52 out of 23.79

Confidence: medium

Additional weak hits (24):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.20 out of 20.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.69 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.69 out of 26.85

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.39 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.72 out of 31.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.37 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.88 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.02 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.78 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.38 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.64 out of 21.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.81 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.80 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.21 out of 23.43

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.87 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.31 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 40, location 4257464 - 4440274:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (ccmal - ohmal - ccmal - ohmal - ccmal) + (Me-ohmal) + (ohmal - ccmal - ccmal) + (ccmal - ohmal) + (ohmal - ohmal - ccmal - ohmal - ohmal) + (pk - Me-ohmal) + (ccmal - redmal - ccmal) + (ccmal - Me-ccmal)
Non-colinear ordering:: BV401_RS44725 + BV401_RS17265 + BV401_RS17260 + BV401_RS17250 + BV401_RS17270 + BV401_RS17275 + BV401_RS17235 + BV401_RS17230 + BV401_RS17225

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS17135: pk

PKS_AT (11..274): pk

ATSignature: (unknown)

No matches above 50%

minowa: CHC-CoA

Prediction, score:

CHC-CoA: 12.8
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BV401_RS17225: mal - mmal

PKS_AT (591..884): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 230.6
inactive: 117.9
Methoxymalonyl-CoA: 69.2
Methylmalonyl-CoA: 64.0
Propionyl-CoA: 39.9
Ethylmalonyl-CoA: 27.5
Isobutyryl-CoA: 26.8
Acetyl-CoA: 25.4
trans-1,2-CPDA: 22.5
Benzoyl-CoA: 21.8
2-Methylbutyryl-CoA: 19.3
CHC-CoA: 16.8
fatty_acid: 11.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (2374..2673): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 221.7
Ethylmalonyl-CoA: 214.7
Methoxymalonyl-CoA: 173.9
2-Methylbutyryl-CoA: 138.6
trans-1,2-CPDA: 133.7
Propionyl-CoA: 101.8
CHC-CoA: 101.5
Malonyl-CoA: 96.3
Isobutyryl-CoA: 89.3
Benzoyl-CoA: 72.6
3-Methylbutyryl-CoA: 61.7
Acetyl-CoA: 45.9
fatty_acid: 38.4
inactive: 31.1

BV401_RS17230: mal - mal - mal

PKS_AT (580..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 235.8
inactive: 125.5
Methoxymalonyl-CoA: 77.2
Methylmalonyl-CoA: 67.0
Isobutyryl-CoA: 43.6
Propionyl-CoA: 39.0
Ethylmalonyl-CoA: 33.9
Benzoyl-CoA: 29.7
2-Methylbutyryl-CoA: 24.8
Acetyl-CoA: 22.8
CHC-CoA: 18.6
trans-1,2-CPDA: 15.2
fatty_acid: 13.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (2340..2633): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 241.8
inactive: 135.9
Methoxymalonyl-CoA: 68.1
Methylmalonyl-CoA: 68.0
Propionyl-CoA: 43.8
Isobutyryl-CoA: 39.0
Acetyl-CoA: 26.2
2-Methylbutyryl-CoA: 26.0
Benzoyl-CoA: 25.3
trans-1,2-CPDA: 14.2
CHC-CoA: 14.1
fatty_acid: 11.6
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -2.7

PKS_AT (4420..4708): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 235.3
inactive: 125.4
Methoxymalonyl-CoA: 73.6
Methylmalonyl-CoA: 70.6
Propionyl-CoA: 42.7
Ethylmalonyl-CoA: 34.9
Benzoyl-CoA: 27.9
Acetyl-CoA: 27.5
Isobutyryl-CoA: 25.6
2-Methylbutyryl-CoA: 24.6
CHC-CoA: 18.8
trans-1,2-CPDA: 16.7
fatty_acid: 13.1
3-Methylbutyryl-CoA: 0.0

BV401_RS17235: pk - mmal

PKS_AT (570..869): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 224.8
Methylmalonyl-CoA: 224.4
Methoxymalonyl-CoA: 178.2
2-Methylbutyryl-CoA: 144.5
trans-1,2-CPDA: 129.3
CHC-CoA: 107.1
Propionyl-CoA: 103.4
Malonyl-CoA: 99.2
Isobutyryl-CoA: 83.4
Benzoyl-CoA: 64.3
3-Methylbutyryl-CoA: 56.1
fatty_acid: 45.7
Acetyl-CoA: 45.2
inactive: 28.3

PKS_AT (2117..2416): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 223.2
Ethylmalonyl-CoA: 213.2
Methoxymalonyl-CoA: 176.4
2-Methylbutyryl-CoA: 147.1
trans-1,2-CPDA: 126.9
Propionyl-CoA: 101.3
Malonyl-CoA: 99.0
CHC-CoA: 96.2
Isobutyryl-CoA: 90.8
Benzoyl-CoA: 70.9
3-Methylbutyryl-CoA: 63.2
Acetyl-CoA: 49.3
fatty_acid: 39.7
inactive: 33.6

BV401_RS44725: mal - mal

PKS_AT (539..830): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 242.0
inactive: 127.2
Methoxymalonyl-CoA: 74.7
Methylmalonyl-CoA: 70.5
Propionyl-CoA: 45.0
Isobutyryl-CoA: 43.9
Benzoyl-CoA: 33.5
Ethylmalonyl-CoA: 31.5
Acetyl-CoA: 25.2
2-Methylbutyryl-CoA: 24.9
trans-1,2-CPDA: 20.9
CHC-CoA: 19.6
fatty_acid: 14.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (2341..2630): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 236.5
inactive: 118.2
Methoxymalonyl-CoA: 66.4
Methylmalonyl-CoA: 64.4
Propionyl-CoA: 43.1
Isobutyryl-CoA: 33.6
Ethylmalonyl-CoA: 26.4
Benzoyl-CoA: 25.6
2-Methylbutyryl-CoA: 22.7
Acetyl-CoA: 20.1
CHC-CoA: 15.5
trans-1,2-CPDA: 14.5
fatty_acid: 9.3
3-Methylbutyryl-CoA: 0.0

BV401_RS17250: mal - mal - mal

PKS_AT (572..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 244.6
inactive: 118.3
Methoxymalonyl-CoA: 70.4
Methylmalonyl-CoA: 61.1
Propionyl-CoA: 36.2
Isobutyryl-CoA: 29.2
Benzoyl-CoA: 21.1
2-Methylbutyryl-CoA: 20.6
Ethylmalonyl-CoA: 20.3
Acetyl-CoA: 17.5
CHC-CoA: 10.4
trans-1,2-CPDA: 7.1
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2134..2426): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 239.7
inactive: 114.6
Methoxymalonyl-CoA: 67.7
Methylmalonyl-CoA: 61.4
Propionyl-CoA: 37.5
Isobutyryl-CoA: 29.4
Benzoyl-CoA: 23.4
Ethylmalonyl-CoA: 20.9
Acetyl-CoA: 20.2
CHC-CoA: 14.4
2-Methylbutyryl-CoA: 11.1
trans-1,2-CPDA: 9.4
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3890..4190): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.0
inactive: 109.0
Methoxymalonyl-CoA: 65.5
Methylmalonyl-CoA: 62.3
Propionyl-CoA: 40.5
Isobutyryl-CoA: 29.5
Ethylmalonyl-CoA: 23.7
2-Methylbutyryl-CoA: 23.7
Acetyl-CoA: 21.0
Benzoyl-CoA: 18.8
trans-1,2-CPDA: 16.0
CHC-CoA: 12.9
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS17260: mmal

PKS_AT (567..866): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 224.7
Ethylmalonyl-CoA: 220.8
Methoxymalonyl-CoA: 176.8
2-Methylbutyryl-CoA: 139.7
trans-1,2-CPDA: 126.6
CHC-CoA: 101.4
Propionyl-CoA: 99.7
Malonyl-CoA: 96.5
Isobutyryl-CoA: 82.9
Benzoyl-CoA: 67.9
3-Methylbutyryl-CoA: 59.2
Acetyl-CoA: 40.2
fatty_acid: 36.2
inactive: 30.3

BV401_RS17265: mal - mal - mal - mal - mal

PKS_AT (567..858): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 236.8
inactive: 127.3
Methoxymalonyl-CoA: 71.0
Methylmalonyl-CoA: 70.4
Propionyl-CoA: 47.4
Ethylmalonyl-CoA: 31.6
Isobutyryl-CoA: 30.1
Acetyl-CoA: 24.7
Benzoyl-CoA: 23.8
2-Methylbutyryl-CoA: 23.2
trans-1,2-CPDA: 19.5
CHC-CoA: 17.3
fatty_acid: 10.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2397..2688): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 232.8
inactive: 122.6
Methoxymalonyl-CoA: 71.0
Methylmalonyl-CoA: 69.1
Propionyl-CoA: 47.7
2-Methylbutyryl-CoA: 31.2
Isobutyryl-CoA: 30.9
Acetyl-CoA: 29.2
Ethylmalonyl-CoA: 26.2
Benzoyl-CoA: 21.4
CHC-CoA: 15.4
trans-1,2-CPDA: 13.9
fatty_acid: 11.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (3875..4168): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 235.5
inactive: 114.5
Methoxymalonyl-CoA: 72.0
Methylmalonyl-CoA: 67.9
Propionyl-CoA: 43.2
Isobutyryl-CoA: 38.2
Ethylmalonyl-CoA: 31.4
Benzoyl-CoA: 27.4
Acetyl-CoA: 25.3
2-Methylbutyryl-CoA: 23.3
trans-1,2-CPDA: 20.2
CHC-CoA: 15.3
fatty_acid: 13.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (5731..6022): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 237.7
inactive: 116.9
Methoxymalonyl-CoA: 70.1
Methylmalonyl-CoA: 68.3
Propionyl-CoA: 47.4
Isobutyryl-CoA: 30.3
Acetyl-CoA: 29.1
2-Methylbutyryl-CoA: 24.9
Ethylmalonyl-CoA: 24.6
Benzoyl-CoA: 24.0
trans-1,2-CPDA: 18.5
CHC-CoA: 14.8
fatty_acid: 10.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (7279..7571): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 237.2
inactive: 121.2
Methoxymalonyl-CoA: 70.0
Methylmalonyl-CoA: 68.6
Propionyl-CoA: 43.7
Ethylmalonyl-CoA: 25.8
Benzoyl-CoA: 25.2
Acetyl-CoA: 24.8
Isobutyryl-CoA: 24.2
trans-1,2-CPDA: 20.8
CHC-CoA: 19.6
2-Methylbutyryl-CoA: 18.8
fatty_acid: 12.6
3-Methylbutyryl-CoA: 0.0

BV401_RS17270: mal - mal

PKS_AT (576..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 239.6
inactive: 120.8
Methoxymalonyl-CoA: 71.3
Methylmalonyl-CoA: 69.4
Propionyl-CoA: 45.3
Isobutyryl-CoA: 35.5
Ethylmalonyl-CoA: 35.2
Acetyl-CoA: 26.5
2-Methylbutyryl-CoA: 23.8
Benzoyl-CoA: 23.0
CHC-CoA: 16.7
trans-1,2-CPDA: 14.0
fatty_acid: 9.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (2366..2658): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 243.6
inactive: 117.5
Methoxymalonyl-CoA: 72.4
Methylmalonyl-CoA: 67.4
Propionyl-CoA: 40.4
Isobutyryl-CoA: 32.0
Ethylmalonyl-CoA: 24.4
Benzoyl-CoA: 20.7
Acetyl-CoA: 20.4
2-Methylbutyryl-CoA: 19.4
CHC-CoA: 13.3
trans-1,2-CPDA: 8.9
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS17275: mal - mal - mal - mal - mal

PKS_AT (684..982): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 229.9
inactive: 123.4
Methoxymalonyl-CoA: 77.5
Methylmalonyl-CoA: 75.1
Isobutyryl-CoA: 48.9
Propionyl-CoA: 39.2
Acetyl-CoA: 35.2
Ethylmalonyl-CoA: 27.1
2-Methylbutyryl-CoA: 23.2
Benzoyl-CoA: 20.1
CHC-CoA: 14.7
trans-1,2-CPDA: 10.2
fatty_acid: 8.3
3-Methylbutyryl-CoA: 5.9

PKS_AT (2231..2522): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 240.5
inactive: 125.5
Methoxymalonyl-CoA: 67.0
Methylmalonyl-CoA: 66.0
Propionyl-CoA: 39.1
Isobutyryl-CoA: 34.2
Benzoyl-CoA: 24.4
Acetyl-CoA: 23.0
trans-1,2-CPDA: 21.9
2-Methylbutyryl-CoA: 19.7
Ethylmalonyl-CoA: 18.8
fatty_acid: 12.5
CHC-CoA: 12.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3758..4049): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 236.4
inactive: 121.5
Methoxymalonyl-CoA: 67.6
Methylmalonyl-CoA: 66.3
Propionyl-CoA: 42.9
Benzoyl-CoA: 25.7
Acetyl-CoA: 24.2
Isobutyryl-CoA: 24.1
Ethylmalonyl-CoA: 23.3
2-Methylbutyryl-CoA: 18.7
CHC-CoA: 17.8
trans-1,2-CPDA: 16.5
fatty_acid: 9.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (5579..5870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 245.5
inactive: 120.7
Methoxymalonyl-CoA: 75.9
Methylmalonyl-CoA: 73.6
Propionyl-CoA: 43.3
Isobutyryl-CoA: 41.8
Ethylmalonyl-CoA: 41.0
2-Methylbutyryl-CoA: 28.4
Benzoyl-CoA: 28.3
Acetyl-CoA: 23.6
CHC-CoA: 20.5
trans-1,2-CPDA: 16.9
fatty_acid: 13.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (7121..7416): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 228.1
inactive: 120.0
Methoxymalonyl-CoA: 76.7
Methylmalonyl-CoA: 75.1
Isobutyryl-CoA: 51.4
Propionyl-CoA: 43.2
Ethylmalonyl-CoA: 35.6
Benzoyl-CoA: 23.0
Acetyl-CoA: 21.3
2-Methylbutyryl-CoA: 20.6
CHC-CoA: 14.9
trans-1,2-CPDA: 14.1
3-Methylbutyryl-CoA: 14.1
fatty_acid: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 25 - RiPP-like

Download region GenBank file

Download region SVG

Location: 4,575,326 - 4,587,722 nt. (total: 12,397 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BV401_RS17960: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS17970: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002584.2	0.43	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002115.3	0.41	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000477.3	0.40	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0000565.5	0.40	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.38	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000583.5	0.38	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000193.3	0.38	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000471.4	0.37	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002584.2	0.43	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0002115.3	0.41	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000483.5	0.41	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000477.3	0.40	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0000565.5	0.40	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.38	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000583.5	0.38	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000193.3	0.38	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000471.4	0.37	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.62 out of 23.79

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.07 out of 23.43

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.87 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.56 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.49 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.88 out of 27.18

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.81 out of 23.43

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 3 - 106; Score: 62.9; RRE type: NHLP_CD_RRE; Location: 3 - 103; Score: 53.5; RRE type: Cyanobactin_D_RRE; Location: 3 - 88; Score: 44.2

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 26 - HR-T2PKS

Download region GenBank file

Download region SVG

Location: 4,594,676 - 4,644,913 nt. (total: 50,238 nt) Show pHMM detection rules used

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BV401_RS18040: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

BV401_RS18120: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS18165: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS18215: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BV401_RS18220: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: PPTase acylase carboxylase

BV401_RS18095: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

BV401_RS18105: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

BV401_RS18140: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: amidase dehalogenase hydrolase

BV401_RS18045: amidase

smcogs: SMCOG1105: amidase

BV401_RS18090: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BV401_RS18100: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

BV401_RS18110: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

BV401_RS18145: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS18175: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS18190: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS18195: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000234.5	0.54	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001987.2	0.52	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000867.3	0.51	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002510.2	0.50	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000218.5	0.49	PKS	doxorubicin	Streptomyces peucetius
BGC0002477.3	0.49	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0001177.4	0.49	PKS	mensacaricin	Streptomyces bottropensis
BGC0000225.5	0.48	PKS	frenolicin B	Streptomyces roseofulvus
BGC0002369.2	0.48	PKS	maduralactomycin A, maduralactomycin B, actinospirol A, actinospirol B	Actinomadura rubteroloni

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000234.5	0.54	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001987.2	0.52	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000867.3	0.51	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002510.2	0.50	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000218.5	0.49	PKS	doxorubicin	Streptomyces peucetius
BGC0002477.3	0.49	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0001177.4	0.49	PKS	mensacaricin	Streptomyces bottropensis
BGC0000225.5	0.48	PKS	frenolicin B	Streptomyces roseofulvus
BGC0002369.2	0.48	PKS	maduralactomycin A, maduralactomycin B, actinospirol A, actinospirol B	Actinomadura rubteroloni

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.68 out of 27.04

Confidence: medium

Additional weak hits (12):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.05 out of 30.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.77 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.68 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.07 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.20 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.81 out of 27.04

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.79 out of 25.88

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BV401_RS18140: mal

PKS_AT (20..306): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 107.0
Methylmalonyl-CoA: 45.6
Methoxymalonyl-CoA: 42.7
Propionyl-CoA: 39.0
inactive: 35.5
Ethylmalonyl-CoA: 18.2
CHC-CoA: 17.6
trans-1,2-CPDA: 10.7
2-Methylbutyryl-CoA: 10.3
Acetyl-CoA: 9.3
fatty_acid: 6.0
Isobutyryl-CoA: 2.9
Benzoyl-CoA: 0.7
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 27 - NRPS

Download region GenBank file

Download region SVG

Location: 4,694,799 - 4,738,809 nt. (total: 44,011 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BV401_RS18575: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BV401_RS18685: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Hydrolases: deacetylase hydrolase

BV401_RS18660: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

BV401_RS18680: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase

BV401_RS18670: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

BV401_RS18715: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.73 out of 23.79

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.29 out of 30.11

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.44 out of 27.04

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (18):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.31 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.82 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.82 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.18 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.38 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.23 out of 20.01

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.05 out of 25.88

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.53 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.16 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.75 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 43, location 4694798 - 4738809:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS18670: X

AMP-binding (471..874): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CWMTFDASVCEWQFSSGGENNLYGPTETTIQIAH
Nearest Stachelhaus code(s):: Gln DAWQFGLIQK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 28 - indole

Download region GenBank file

Download region SVG

Location: 4,933,381 - 4,954,529 nt. (total: 21,149 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BV401_RS19510: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS19535: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Isomerases: racemase

BV401_RS19495: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001483.4	0.57	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0001294.5	0.56	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002643.2	0.46	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0000844.5	0.46	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0002128.3	0.45	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001910.4	0.44	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001483.4	0.57	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0001294.5	0.56	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002643.2	0.46	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0000844.5	0.46	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0002128.3	0.45	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001910.4	0.44	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

Additional weak hits (3):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.04 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.60 out of 29.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor

NZ_CP019458.1 - Region 29 - terpene

Download region GenBank file

Download region SVG

Location: 5,531,569 - 5,553,965 nt. (total: 22,397 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

BV401_RS22085: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

BV401_RS22120: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: amidase

BV401_RS22090: amidase

smcogs: SMCOG1105: amidase

Lyases: cyclase

BV401_RS22095: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0001336.5	0.45	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000851.5	0.44	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001223.5	0.41	other (other)	hydroxysporine	uncultured bacterium
BGC0002669.2	0.39	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0001336.5	0.45	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000851.5	0.44	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001223.5	0.41	other (other)	hydroxysporine	uncultured bacterium
BGC0002669.2	0.39	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

BV401_RS22095: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (376 - 739): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.15 out of 23.79

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.14 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.98 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.93 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.47 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.24 out of 27.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 30 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 6,619,585 - 6,649,387 nt. (total: 29,803 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BV401_RS27010: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BV401_RS27015: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS27070: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BV401_RS27090: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Lyases: decarboxylase hydratase

BV401_RS27025: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

BV401_RS27045: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BV401_RS27095: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.83	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.74	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.74	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.60	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.53	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.83	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.74	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.74	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.60	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.53	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 25.23 out of 29.51

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 36.53

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.89 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.80 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.79 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.55 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.41 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.04 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
DosR	Hypoxia stress response regulator

NZ_CP019458.1 - Region 31 - betalactone

Download region GenBank file

Download region SVG

Location: 6,966,296 - 6,995,679 nt. (total: 29,384 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

BV401_RS28615: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: methyltransferase

BV401_RS28640: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

BV401_RS28700: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

BV401_RS28635: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

BV401_RS28645: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001441.5	0.64	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001948.3	0.43	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001440.5	0.41	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0001806.4	0.41	NRPS	tolaasin A	Pseudomonas tolaasii
BGC0001895.4	0.40	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000908.3	0.39	other (other)	melanin	Streptomyces avermitilis
BGC0001869.4	0.39	NRPS, other (phenazine)	griseoluteic acid, demethoxygriseoluteic acid, phenaszentine A, phenaszentine C, phenaszenketide C, phenaszenketide D	Xenorhabdus szentirmaii DSM 16338
BGC0001562.5	0.39	NRPS	curacomycin	Streptomyces curacoi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001441.5	0.64	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001948.3	0.43	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001440.5	0.41	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0001806.4	0.41	NRPS	tolaasin A	Pseudomonas tolaasii
BGC0001895.4	0.40	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000908.3	0.39	other (other)	melanin	Streptomyces avermitilis
BGC0001869.4	0.39	NRPS, other (phenazine)	griseoluteic acid, demethoxygriseoluteic acid, phenaszentine A, phenaszentine C, phenaszenketide C, phenaszenketide D	Xenorhabdus szentirmaii DSM 16338
BGC0001562.5	0.39	NRPS	curacomycin	Streptomyces curacoi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.13 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.16 out of 26.85

Confidence: medium

Additional weak hits (17):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.08 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.98 out of 21.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.39 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.95 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.33 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.44 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.70 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.01 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 32.93

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.51 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.03 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.43 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.08 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis

NZ_CP019458.1 - Region 32 - NRPS-like

Download region GenBank file

Download region SVG

Location: 7,242,290 - 7,285,136 nt. (total: 42,847 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BV401_RS29950: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BV401_RS29985: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

BV401_RS30005: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

BV401_RS29925: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

BV401_RS29975: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

BV401_RS29970: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000340.5	0.95	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0002274.2	0.65	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002193.2	0.64	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001295.5	0.47	other (other)	cremeomycin	Streptomyces cremeus
BGC0001844.4	0.46	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0001873.3	0.46	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0000197.5	0.45	PKS, saccharide	aranciamycin	Streptomyces echinatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000340.5	0.95	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0002274.2	0.65	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002193.2	0.64	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001295.5	0.47	other (other)	cremeomycin	Streptomyces cremeus
BGC0001844.4	0.46	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0001873.3	0.46	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0000197.5	0.45	PKS, saccharide	aranciamycin	Streptomyces echinatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.50 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.35 out of 29.51

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (11):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.58 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.78 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.89 out of 33.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.97 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.12 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.81 out of 35.63

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.17 out of 25.88

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.80 out of 23.43

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.70 out of 30.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 48, location 7242289 - 7285136:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS29970: X

AMP-binding (44..450): X

nrpys: Ppa

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SGKIHVAALLELFTVSGGEWPAFGMTETCAGSIY
Nearest Stachelhaus code(s):: Ppa VALFVGAAGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 33 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 7,832,637 - 7,862,760 nt. (total: 30,124 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BV401_RS32440: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

BV401_RS32405: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

BV401_RS32455: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002633.2	0.50	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii
BGC0002683.2	0.49	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000858.3	0.48	other (other)	ectoine	Methylobacter marinus
BGC0002470.2	0.48	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000859.3	0.48	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.48	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.48	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.47	other (other)	ectoine	Methylophaga alcalica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002633.2	0.50	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii
BGC0002683.2	0.49	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000858.3	0.48	other (other)	ectoine	Methylobacter marinus
BGC0002470.2	0.48	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000859.3	0.48	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.48	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.48	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.47	other (other)	ectoine	Methylophaga alcalica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.07 out of 26.85

Confidence: medium

Additional weak hits (10):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.22 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.84 out of 26.85

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.32 out of 27.18

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.51 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.19 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
LexA variant 2	Repressor of DNA damage response
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP019458.1 - Region 34 - NRPS,aminocoumarin,arylpolyene,terpene-precursor

Download region GenBank file

Download region SVG

Location: 7,931,320 - 8,012,417 nt. (total: 81,098 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
arylpolyene: (APE_KS1 or APE_KS2)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
aminocoumarin: (novK or novJ or novI or novH or SpcDK_cou)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BV401_RS32795: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS32805: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS32915: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS32955: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS32985: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acyltransferase glycosyltransferase methyltransferase transferase

BV401_RS32780: methyltransferase

smcogs: SMCOG1089: methyltransferase

BV401_RS32790: methyltransferase

smcogs: SMCOG1089: methyltransferase

BV401_RS32940: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

BV401_RS32960: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BV401_RS33020: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BV401_RS33025: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: esterase

BV401_RS32860: thioesterase

smcogs: SMCOG1004: thioesterase

Isomerases: isomerase

BV401_RS32820: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase synthetase

BV401_RS32770: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

BV401_RS32800: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BV401_RS32870: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS32875: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS32880: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS32895: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS32925: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS32935: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS32950: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BV401_RS32980: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS33005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BV401_RS33010: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	1.13	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	1.12	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.11	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	1.11	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	1.10	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.08	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.07	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.07	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	1.06	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000342.4	1.05	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001529.5	0.80	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002075.3	0.76	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.76	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BV401_RS32800: PT_FPPS_like

Domain 1 (58 - 344): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 30.12 out of 30.12

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

Additional weak hits (15):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.66 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.65 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.78 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.53 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.40 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.46 out of 26.06

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.53 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.56 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.07 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.62 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.92 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 51, location 7938467 - 8012417:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Leu) + (Ser - D-Asp) + (Ala - Ser) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 52, location 7938467 - 7979601:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Leu) + (Ser - D-Asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 53, location 7953005 - 8012417:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Leu) + (Ser - D-Asp) + (Ala - Ser) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS32925: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (13..422): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

BV401_RS45110: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (600..998): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FTEAFDAAVLEMLIIVGGEVNAYGPTESTVAATT
Nearest Stachelhaus code(s):: Leu DALLIGAVAK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

BV401_RS32935: Ser - Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (463..869): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFLCSGEHNLYGPTEASVDVTY
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1529..1932): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWTSFDLSVTATKALLGGELNVYGPTEGTVNVAE
Nearest Stachelhaus code(s):: Asp DLTKLGVVNK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

BV401_RS32940: Ala - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (464..864): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEGSALLCGEANVYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSLAVVYK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1521..1932): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFLCSGEHNLYGPTEASVDVTS
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BV401_RS32950: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (464..873): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

BV401_RS33005: NH2

CAL_domain (44..486): NH2

minowa: NH2

Prediction, score:

NH2: 111.0
Acetyl-CoA: 38.1
fatty_acid: 10.9
shikimic_acid: 0.0
AHBA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_CP019458.1 - Region 35 - RiPP-like

Download region GenBank file

Download region SVG

Location: 8,093,396 - 8,104,934 nt. (total: 11,539 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002387.2	0.28	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001377.5	0.25	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.25	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002788.2	0.24	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000495.5	0.24	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002713.2	0.24	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0001060.5	0.22	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.21	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0001514.5	0.20	other (other)	aristeromycin	Streptomyces citricolor
BGC0000241.5	0.19	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002387.2	0.28	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001377.5	0.25	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.25	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002788.2	0.24	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000495.5	0.24	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002713.2	0.24	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0001060.5	0.22	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.21	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0001514.5	0.20	other (other)	aristeromycin	Streptomyces citricolor
BGC0000241.5	0.19	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.93 out of 26.85

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.04 out of 23.43

Confidence: medium

Additional weak hits (6):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.81 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.60 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.70 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.05 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.16 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.73 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP019458.1 - Region 36 - T1PKS

Download region GenBank file

Download region SVG

Location: 8,159,262 - 8,221,851 nt. (total: 62,590 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

BV401_RS33720: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS33755: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

BV401_RS33765: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

BV401_RS45145: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Hydrolases: back translocase

BV401_RS33670: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Ligases: synthase

BV401_RS45150: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000024.5	0.55	PKS	aureothin	Streptomyces thioluteus
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000041.3	0.54	PKS	oronofacic acid	Pseudomonas syringae
BGC0002228.3	0.51	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum
BGC0000844.5	0.51	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001665.3	0.50	PKS	methylated alkyl-resorcinol, methylated acyl-phloroglucinol	Mycobacterium marinum M

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000024.5	0.55	PKS	aureothin	Streptomyces thioluteus
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000041.3	0.54	PKS	oronofacic acid	Pseudomonas syringae
BGC0002228.3	0.51	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum
BGC0000844.5	0.51	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001665.3	0.50	PKS	methylated alkyl-resorcinol, methylated acyl-phloroglucinol	Mycobacterium marinum M

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

Additional weak hits (10):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.09 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.14 out of 36.54

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.87 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.54 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.22 out of 29.51

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.29 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.56 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 55, location 8159261 - 8221851:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-mal - Me-ccmal) + (Me-redmal - Me-mal)
Non-colinear ordering:: BV401_RS45150 + BV401_RS45145

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS45145: mmal - mmal

PKS_AT (566..850): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 202.6
Ethylmalonyl-CoA: 184.9
Methoxymalonyl-CoA: 167.4
2-Methylbutyryl-CoA: 126.5
Malonyl-CoA: 108.9
trans-1,2-CPDA: 106.2
CHC-CoA: 104.3
Propionyl-CoA: 100.1
Isobutyryl-CoA: 79.5
Benzoyl-CoA: 60.1
Acetyl-CoA: 59.4
inactive: 40.2
3-Methylbutyryl-CoA: 29.1
fatty_acid: 19.2

PKS_AT (2648..2952): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 218.8
Ethylmalonyl-CoA: 210.2
Methoxymalonyl-CoA: 183.1
2-Methylbutyryl-CoA: 125.9
trans-1,2-CPDA: 124.9
Malonyl-CoA: 122.6
Propionyl-CoA: 101.7
Isobutyryl-CoA: 95.7
CHC-CoA: 94.0
Benzoyl-CoA: 75.5
Acetyl-CoA: 69.4
3-Methylbutyryl-CoA: 59.3
inactive: 50.9
fatty_acid: 30.0

BV401_RS45150: mmal - mmal - mmal

PKS_AT (573..854): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 188.2
Ethylmalonyl-CoA: 177.3
Methoxymalonyl-CoA: 157.7
2-Methylbutyryl-CoA: 121.8
trans-1,2-CPDA: 113.2
Malonyl-CoA: 107.4
Propionyl-CoA: 100.2
CHC-CoA: 95.7
Isobutyryl-CoA: 69.2
Acetyl-CoA: 52.3
Benzoyl-CoA: 43.9
inactive: 33.7
3-Methylbutyryl-CoA: 30.3
fatty_acid: 21.4

PKS_AT (1574..1871): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.3
Ethylmalonyl-CoA: 185.9
Methoxymalonyl-CoA: 165.3
2-Methylbutyryl-CoA: 123.0
trans-1,2-CPDA: 114.9
CHC-CoA: 101.6
Propionyl-CoA: 97.9
Malonyl-CoA: 95.6
Isobutyryl-CoA: 81.3
Benzoyl-CoA: 59.9
Acetyl-CoA: 50.4
3-Methylbutyryl-CoA: 43.8
fatty_acid: 32.2
inactive: 29.9

PKS_AT (2592..2877): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 215.2
Ethylmalonyl-CoA: 200.2
Methoxymalonyl-CoA: 177.5
2-Methylbutyryl-CoA: 145.1
Malonyl-CoA: 124.1
trans-1,2-CPDA: 119.2
CHC-CoA: 113.6
Propionyl-CoA: 110.3
Isobutyryl-CoA: 95.1
Benzoyl-CoA: 62.3
Acetyl-CoA: 54.8
inactive: 53.2
3-Methylbutyryl-CoA: 47.7
fatty_acid: 35.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_CP019458.1 - Region 37 - T2PKS

Download region GenBank file

Download region SVG

Location: 8,333,293 - 8,405,808 nt. (total: 72,516 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase oxygenase

BV401_RS34365: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

BV401_RS34370: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BV401_RS34455: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BV401_RS34580: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: PPTase acetyltransferase aminotransferase methyltransferase

BV401_RS34305: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

BV401_RS34310: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

BV401_RS34330: methyltransferase

smcogs: SMCOG1089: methyltransferase

BV401_RS34390: aminotransferase

smcogs: SMCOG1019: aminotransferase

BV401_RS34405: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: deacetylase hydrolase

BV401_RS34295: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

BV401_RS34480: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

BV401_RS34420: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

BV401_RS34425: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

BV401_RS34435: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS34440: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.76	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.73	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.72	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000275.4	0.57	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002000.4	0.55	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001895.4	0.55	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.76	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.73	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.72	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000275.4	0.57	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002000.4	0.55	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001895.4	0.55	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.87 out of 27.04

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.10 out of 23.43

Confidence: medium

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.70 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.48 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.41 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.43 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.63 out of 21.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.12 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.67 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 8333292 to 8405808
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

BV401_RS34330: MET (Score: 29.5; E-value: 9.3e-10)
BV401_RS34405: MET C6|C8 (Score: 497.4; E-value: 3.7e-152)
BV401_RS34420: CYC C4-C21/C2-C23|C2-C19 (Score: 148.6; E-value: 1.2e-46)
BV401_RS34425: CYC C9-C14 (Score: 246.6; E-value: 1.7e-76)
BV401_RS34430: ACP (Score: 63.0; E-value: 4.6e-20)
BV401_RS34435: CLF (Score: 542.9; E-value: 9.9e-166)
BV401_RS34440: KS (Score: 707.0; E-value: 1.6e-215)
BV401_RS34445: CYC C5-C18 (Score: 214.7; E-value: 8e-67)
BV401_RS34455: OXY (Score: 263.3; E-value: 1.1e-80)
BV401_RS34485: OXY (Score: 33.7; E-value: 4.8e-11)

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
DasR	N-acetylglucosamine dependent repressor

NZ_CP019458.1 - Region 38 - triceptide

Download region GenBank file

Download region SVG

Location: 8,608,945 - 8,630,105 nt. (total: 21,161 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

BV401_RS35470: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: dehydratase

BV401_RS35465: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.42	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.40	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001122.4	0.33	NRPS, PKS	dihydroisoflavipucine, isoflavipucine	Aspergillus terreus NIH2624
BGC0001387.5	0.32	other (other)	nucleocidin	Streptomyces calvus
BGC0000453.5	0.29	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0002467.2	0.27	NRPS	thermochelin	Thermocrispum agreste DSM 44070
BGC0000466.5	0.26	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0001945.3	0.26	NRPS	chloromyxamide	Myxococcus sp.
BGC0001941.3	0.26	PKS	Fulvuthiacene A, Fulvuthiacene B	Myxococcus fulvus
BGC0000197.5	0.26	PKS, saccharide	aranciamycin	Streptomyces echinatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.42	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.40	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001122.4	0.33	NRPS, PKS	dihydroisoflavipucine, isoflavipucine	Aspergillus terreus NIH2624
BGC0001387.5	0.32	other (other)	nucleocidin	Streptomyces calvus
BGC0000453.5	0.29	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0002467.2	0.27	NRPS	thermochelin	Thermocrispum agreste DSM 44070
BGC0000466.5	0.26	NRPS	yatakemycin	Streptomyces sp. TP-A2060
BGC0001945.3	0.26	NRPS	chloromyxamide	Myxococcus sp.
BGC0001941.3	0.26	PKS	Fulvuthiacene A, Fulvuthiacene B	Myxococcus fulvus
BGC0000197.5	0.26	PKS, saccharide	aranciamycin	Streptomyces echinatus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.25 out of 20.01

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.32 out of 26.85

Confidence: medium

Additional weak hits (9):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.16 out of 30.22

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.95 out of 20.01

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.09 out of 29.25

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.17 out of 20.01

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.99 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 39 - terpene

Download region GenBank file

Download region SVG

Location: 8,656,490 - 8,682,943 nt. (total: 26,454 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BV401_RS35580: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

BV401_RS35605: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase transferase

BV401_RS35575: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

BV401_RS35660: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: synthase synthetase

BV401_RS35630: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BV401_RS35655: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.74	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000651.5	0.48	terpene	KS-505a	Streptomyces argenteolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.74	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0001361.3	0.48	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.48	terpene	sodorifen	Serratia plymuthica
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000651.5	0.48	terpene	KS-505a	Streptomyces argenteolus

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

BV401_RS35615: PT_phytoene_like

Domain 1 (6 - 266): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

BV401_RS35620: PT_phytoene_like

Domain 1 (13 - 308): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

BV401_RS35630: PT_FPPS_like

Domain 1 (69 - 355): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BV401_RS35635: T2TS

Domain 1 (12 - 639): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

Additional weak hits (5):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.82 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.78 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.89 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.74 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 40 - T1PKS

Download region GenBank file

Download region SVG

Location: 9,011,925 - 9,054,789 nt. (total: 42,865 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BV401_RS37210: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BV401_RS45660: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Lyases: dehydratase

BV401_RS37250: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

BV401_RS43215: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

BV401_RS37235: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.67	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.62	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.67	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.62	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.07 out of 29.51

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.61 out of 20.97

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 25.31

Confidence: medium

Additional weak hits (11):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.82 out of 25.88

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.25 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.44 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.98 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.08 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.60 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.46 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 59, location 9011924 - >9054789:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)
Non-colinear ordering:: BV401_RS43215 + BV401_RS45660

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS43215: pk

PKS_AT (661..946): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; CE-Malonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 118.4
Methoxymalonyl-CoA: 108.9
Malonyl-CoA: 91.6
Ethylmalonyl-CoA: 82.7
Propionyl-CoA: 74.9
2-Methylbutyryl-CoA: 72.2
Isobutyryl-CoA: 68.1
fatty_acid: 47.4
trans-1,2-CPDA: 43.9
Benzoyl-CoA: 40.7
CHC-CoA: 39.9
Acetyl-CoA: 23.0
3-Methylbutyryl-CoA: 19.9
inactive: 19.3

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
DosR	Hypoxia stress response regulator

NZ_CP019458.1 - Region 41 - butyrolactone

Download region GenBank file

Download region SVG

Location: 9,239,753 - 9,250,688 nt. (total: 10,936 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BV401_RS38180: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BV401_RS38195: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

BV401_RS38210: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.57	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001659.3	0.37	terpene	mangicol A	Fusarium equiseti
BGC0000914.5	0.35	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001909.3	0.34	PKS	strobilurin A	Strobilurus tenacellus
BGC0000723.5	0.33	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0002571.2	0.33	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000843.5	0.32	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.57	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001659.3	0.37	terpene	mangicol A	Fusarium equiseti
BGC0000914.5	0.35	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001909.3	0.34	PKS	strobilurin A	Strobilurus tenacellus
BGC0000723.5	0.33	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0002571.2	0.33	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0000843.5	0.32	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.82 out of 39.62

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 30.98

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.63 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.73 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.90 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.60 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.49 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CP019458.1 - Region 42 - hserlactone

Download region GenBank file

Download region SVG

Location: 9,261,859 - 9,282,617 nt. (total: 20,759 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BV401_RS38285: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: acyltransferase methyltransferase

BV401_RS38310: acyltransferase

smcogs: SMCOG1141: acyltransferase

BV401_RS38335: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deformylase

BV401_RS38320: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: ligase

BV401_RS38305: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.47	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001682.3	0.45	other (other)	N-acyl lysine, N-acyl ornithine	Pseudomonas aeruginosa LESB58
BGC0002545.3	0.36	PKS	sungeidine C, sungeidine B, sungeidine D, sungeidine H, sungeidine A, sungeidine E, sungeidine F, sungeidine G	Micromonospora sp.
BGC0001765.3	0.36	saccharide	salecan	Agrobacterium tumefaciens
BGC0002362.3	0.35	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001380.3	0.35	saccharide	salecan	Agrobacterium sp. ZX09
BGC0000896.5	0.34	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0001377.5	0.33	PKS	uncialamycin	Streptomyces uncialis
BGC0000692.5	0.32	saccharide	apramycin	Streptoalloteichus hindustanus
BGC0001292.5	0.32	other (other)	A33853	Streptomyces sp. NRRL 12068

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.47	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0001682.3	0.45	other (other)	N-acyl lysine, N-acyl ornithine	Pseudomonas aeruginosa LESB58
BGC0002545.3	0.36	PKS	sungeidine C, sungeidine B, sungeidine D, sungeidine H, sungeidine A, sungeidine E, sungeidine F, sungeidine G	Micromonospora sp.
BGC0001765.3	0.36	saccharide	salecan	Agrobacterium tumefaciens
BGC0002362.3	0.35	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001380.3	0.35	saccharide	salecan	Agrobacterium sp. ZX09
BGC0000896.5	0.34	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0001377.5	0.33	PKS	uncialamycin	Streptomyces uncialis
BGC0000692.5	0.32	saccharide	apramycin	Streptoalloteichus hindustanus
BGC0001292.5	0.32	other (other)	A33853	Streptomyces sp. NRRL 12068

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.15 out of 27.04

Confidence: medium

Additional weak hits (1):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.85 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 43 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 9,395,650 - 9,417,741 nt. (total: 22,092 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BV401_RS38910: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

BV401_RS38915: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.41	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.40	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001221.5	0.40	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000515.4	0.39	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0002535.2	0.39	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002346.3	0.39	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000506.4	0.39	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000511.5	0.39	ribosomal	ericin S	Bacillus subtilis
BGC0001789.3	0.39	ribosomal	suicin 90-1330	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.41	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002316.2	0.40	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001221.5	0.40	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000515.4	0.39	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0002535.2	0.39	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0002346.3	0.39	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000506.4	0.39	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000511.5	0.39	ribosomal	ericin S	Bacillus subtilis
BGC0001789.3	0.39	ribosomal	suicin 90-1330	Streptococcus suis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.80 out of 29.51

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.03 out of 36.53

Confidence: medium

Additional weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.49 out of 30.22

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.36 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.39 out of 20.97

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 13 - 93; Score: 66.4

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
DosR	Hypoxia stress response regulator

NZ_CP019458.1 - Region 44 - T1PKS

Download region GenBank file

Download region SVG

Location: 9,445,023 - 9,524,731 nt. (total: 79,709 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BV401_RS39095: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

BV401_RS39140: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS39185: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BV401_RS39195: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BV401_RS39225: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acylase glycosyltransferase transferase transketolase

BV401_RS39105: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

BV401_RS39130: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BV401_RS39150: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BV401_RS39230: transketolase

smcogs: SMCOG1204: transketolase

Hydrolases: esterase

BV401_RS39145: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

BV401_RS39110: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

BV401_RS39180: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

BV401_RS39235: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

BV401_RS39125: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS39135: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002291.3	0.93	PKS	efomycin K, efomycin L	Streptomyces sp. M56
BGC0000053.5	0.83	PKS	elaiophylin	Unknown. Unclassified.
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.73	PKS	oronofacic acid	Pseudomonas syringae
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000018.5	0.63	PKS	angolamycin	Streptomyces eurythermus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002291.3	0.93	PKS	efomycin K, efomycin L	Streptomyces sp. M56
BGC0000053.5	0.83	PKS	elaiophylin	Unknown. Unclassified.
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.73	PKS	oronofacic acid	Pseudomonas syringae
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000018.5	0.63	PKS	angolamycin	Streptomyces eurythermus

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

Additional weak hits (23):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.28 out of 29.51

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.74 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.79 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.75 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.01 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.47 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.77 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.29 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.22 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.04 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.05 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.88 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.86 out of 29.38

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.06 out of 27.18

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.95 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.89 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.61 out of 24.78

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 63, location 9445022 - 9524731:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccemal) + (Me-ohmal) + (pk) + (pk - ccmal) + (ccmal)
Non-colinear ordering:: BV401_RS44035 + BV401_RS39125 + BV401_RS39130 + BV401_RS39135 + BV401_RS39140

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS44035: mal - emal

PKS_AT (514..804): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 212.0
inactive: 118.5
Methoxymalonyl-CoA: 58.0
Methylmalonyl-CoA: 43.3
Benzoyl-CoA: 26.3
Acetyl-CoA: 22.4
Isobutyryl-CoA: 22.0
Propionyl-CoA: 21.1
fatty_acid: 18.8
Ethylmalonyl-CoA: 12.0
CHC-CoA: 7.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1522..1820): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 95.8%; Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 216.2
Methylmalonyl-CoA: 195.9
Methoxymalonyl-CoA: 177.9
trans-1,2-CPDA: 143.2
2-Methylbutyryl-CoA: 139.7
CHC-CoA: 115.8
Malonyl-CoA: 111.9
Propionyl-CoA: 106.2
Isobutyryl-CoA: 75.8
Benzoyl-CoA: 73.4
3-Methylbutyryl-CoA: 46.7
Acetyl-CoA: 45.5
fatty_acid: 42.9
inactive: 18.9

BV401_RS39125: mmal

PKS_AT (590..884): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.7
Ethylmalonyl-CoA: 210.5
Methoxymalonyl-CoA: 175.1
2-Methylbutyryl-CoA: 154.6
trans-1,2-CPDA: 125.3
Propionyl-CoA: 119.4
CHC-CoA: 117.3
Malonyl-CoA: 99.0
Isobutyryl-CoA: 88.0
3-Methylbutyryl-CoA: 67.8
Benzoyl-CoA: 60.4
Acetyl-CoA: 50.2
fatty_acid: 45.8
inactive: 28.2

BV401_RS39130: pk

PKS_AT (568..859): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 223.9
Methylmalonyl-CoA: 220.8
Methoxymalonyl-CoA: 179.0
2-Methylbutyryl-CoA: 152.3
trans-1,2-CPDA: 130.3
Propionyl-CoA: 115.6
CHC-CoA: 104.4
Malonyl-CoA: 98.0
Isobutyryl-CoA: 71.8
Benzoyl-CoA: 55.5
3-Methylbutyryl-CoA: 54.6
Acetyl-CoA: 42.2
fatty_acid: 35.7
inactive: 24.5

BV401_RS39135: pk - mal

PKS_AT (572..864): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 228.1
Methylmalonyl-CoA: 224.3
Methoxymalonyl-CoA: 182.8
2-Methylbutyryl-CoA: 159.8
trans-1,2-CPDA: 133.3
Propionyl-CoA: 118.0
CHC-CoA: 105.4
Malonyl-CoA: 100.3
Isobutyryl-CoA: 70.2
Benzoyl-CoA: 54.9
3-Methylbutyryl-CoA: 52.7
Acetyl-CoA: 40.7
fatty_acid: 35.5
inactive: 23.8

PKS_AT (2103..2402): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.4
inactive: 115.9
Methoxymalonyl-CoA: 58.3
Methylmalonyl-CoA: 39.9
Propionyl-CoA: 28.6
Benzoyl-CoA: 19.5
Acetyl-CoA: 19.4
Ethylmalonyl-CoA: 12.4
Isobutyryl-CoA: 10.6
2-Methylbutyryl-CoA: 10.1
fatty_acid: 9.6
CHC-CoA: 5.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS39140: mal

PKS_AT (566..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.1
inactive: 93.0
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 45.3
Propionyl-CoA: 31.2
Ethylmalonyl-CoA: 24.2
Acetyl-CoA: 23.0
Benzoyl-CoA: 21.5
Isobutyryl-CoA: 20.7
CHC-CoA: 14.2
2-Methylbutyryl-CoA: 11.9
fatty_acid: 8.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019458.1 - Region 45 - T1PKS

Download region GenBank file

Download region SVG

Location: 9,616,152 - 9,789,809 nt. (total: 173,658 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BV401_RS39720: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BV401_RS39730: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

BV401_RS39755: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BV401_RS39815: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

BV401_RS39900: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BV401_RS39915: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: acylase aminotransferase kinase methyltransferase

BV401_RS39700: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BV401_RS39780: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

BV401_RS39860: methyltransferase

smcogs: SMCOG1089: methyltransferase

BV401_RS39935: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase esterase

BV401_RS39765: thioesterase

smcogs: SMCOG1004: thioesterase

BV401_RS39895: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Isomerases: isomerase

BV401_RS39695: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

BV401_RS39715: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS39865: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS39870: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS39875: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS39880: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS39885: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS39910: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS39930: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BV401_RS39940: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BV401_RS39960: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.78	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000114.5	0.72	PKS	nigericin	Streptomyces violaceusniger
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000114.5	0.88	PKS	nigericin	Streptomyces violaceusniger
BGC0001276.3	0.77	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.68	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.67	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000067.5	0.67	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (25):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.95 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.08 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.08 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.74 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.91 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.40 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.52 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.27 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.29 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.55 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.27 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.24 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.90 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.95 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.77 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.79 out of 23.43

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.36 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 64, location 9616151 - 9789809:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-mal) + (Me-ohmal) + (ohmal - ohmal - ohmal) + (Me-redmal) + (Me-ccmal) + (ccmal - Me-redmal) + (Me-ccmal - redmal) + (Me-redmal)
Non-colinear ordering:: BV401_RS39865 + BV401_RS45720 + BV401_RS39940 + BV401_RS39935 + BV401_RS39930 + BV401_RS39875 + BV401_RS39880 + BV401_RS39720

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 65, location 9616151 - 9662568:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 66, location 9657867 - 9789809:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-mal) + (Me-ohmal) + (ohmal - ohmal - ohmal) + (Me-redmal) + (Me-ccmal) + (ccmal - Me-redmal) + (Me-ccmal - redmal)
Non-colinear ordering:: BV401_RS39865 + BV401_RS45720 + BV401_RS39940 + BV401_RS39935 + BV401_RS39930 + BV401_RS39875 + BV401_RS39880

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS39720: mmal

PKS_AT (564..859): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Malonyl-CoA: 75.0%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 147.0
Ethylmalonyl-CoA: 132.0
Methoxymalonyl-CoA: 125.3
Malonyl-CoA: 98.5
2-Methylbutyryl-CoA: 91.9
Isobutyryl-CoA: 87.0
Propionyl-CoA: 85.0
trans-1,2-CPDA: 77.7
Acetyl-CoA: 61.1
CHC-CoA: 48.3
fatty_acid: 37.9
3-Methylbutyryl-CoA: 35.9
inactive: 34.9
Benzoyl-CoA: 17.9

BV401_RS39865: mal - mmal

PKS_AT (541..848): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 207.5
inactive: 92.1
Methoxymalonyl-CoA: 72.7
Methylmalonyl-CoA: 63.0
Isobutyryl-CoA: 42.1
Ethylmalonyl-CoA: 28.9
Acetyl-CoA: 28.7
Propionyl-CoA: 27.0
Benzoyl-CoA: 26.8
CHC-CoA: 17.7
fatty_acid: 13.3
3-Methylbutyryl-CoA: 13.2
2-Methylbutyryl-CoA: 9.8
trans-1,2-CPDA: -0.3

PKS_AT (1582..1885): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 202.3
Ethylmalonyl-CoA: 196.7
Methoxymalonyl-CoA: 170.7
trans-1,2-CPDA: 131.3
2-Methylbutyryl-CoA: 127.1
Propionyl-CoA: 111.2
Malonyl-CoA: 101.3
CHC-CoA: 89.7
Isobutyryl-CoA: 72.8
Benzoyl-CoA: 46.2
fatty_acid: 43.7
Acetyl-CoA: 39.3
3-Methylbutyryl-CoA: 22.9
inactive: 19.4

BV401_RS39875: mal - mmal

PKS_AT (596..895): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.5
inactive: 118.5
Methoxymalonyl-CoA: 51.6
Methylmalonyl-CoA: 41.7
Isobutyryl-CoA: 25.5
Propionyl-CoA: 24.8
Acetyl-CoA: 18.7
Benzoyl-CoA: 15.9
2-Methylbutyryl-CoA: 7.5
Ethylmalonyl-CoA: 6.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2397..2700): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.5
Ethylmalonyl-CoA: 199.8
Methoxymalonyl-CoA: 173.8
trans-1,2-CPDA: 142.6
2-Methylbutyryl-CoA: 133.0
Propionyl-CoA: 121.3
Malonyl-CoA: 109.4
CHC-CoA: 94.9
Isobutyryl-CoA: 73.9
Benzoyl-CoA: 60.3
fatty_acid: 54.4
Acetyl-CoA: 53.2
3-Methylbutyryl-CoA: 27.3
inactive: 23.5

BV401_RS39880: mmal - mal

PKS_AT (565..865): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.1
Ethylmalonyl-CoA: 208.1
Methoxymalonyl-CoA: 174.5
2-Methylbutyryl-CoA: 135.2
trans-1,2-CPDA: 133.0
Propionyl-CoA: 115.0
CHC-CoA: 112.7
Malonyl-CoA: 107.3
Isobutyryl-CoA: 66.4
Benzoyl-CoA: 64.4
fatty_acid: 50.5
Acetyl-CoA: 50.2
3-Methylbutyryl-CoA: 40.3
inactive: 24.8

PKS_AT (2360..2648): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 171.9
inactive: 90.9
Methylmalonyl-CoA: 58.0
Methoxymalonyl-CoA: 57.2
fatty_acid: 35.3
Propionyl-CoA: 32.0
Isobutyryl-CoA: 30.1
Acetyl-CoA: 23.8
2-Methylbutyryl-CoA: 19.4
Ethylmalonyl-CoA: 11.9
CHC-CoA: 11.8
Benzoyl-CoA: 8.6
trans-1,2-CPDA: 7.4
3-Methylbutyryl-CoA: 0.0

BV401_RS45720: mmal

PKS_AT (587..887): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.3
Ethylmalonyl-CoA: 205.5
Methoxymalonyl-CoA: 174.9
trans-1,2-CPDA: 123.1
2-Methylbutyryl-CoA: 121.8
Propionyl-CoA: 107.2
Malonyl-CoA: 106.8
CHC-CoA: 95.8
Isobutyryl-CoA: 62.5
Benzoyl-CoA: 43.7
Acetyl-CoA: 40.3
fatty_acid: 35.4
inactive: 22.2
3-Methylbutyryl-CoA: 13.9

BV401_RS39930: mmal

PKS_AT (576..876): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 205.6
Ethylmalonyl-CoA: 197.6
Methoxymalonyl-CoA: 171.1
2-Methylbutyryl-CoA: 144.5
trans-1,2-CPDA: 123.4
Propionyl-CoA: 120.1
Malonyl-CoA: 98.3
CHC-CoA: 97.2
Isobutyryl-CoA: 69.9
fatty_acid: 46.5
Acetyl-CoA: 46.4
Benzoyl-CoA: 46.3
3-Methylbutyryl-CoA: 36.1
inactive: 17.3

BV401_RS39935: mmal

PKS_AT (576..876): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.4
Ethylmalonyl-CoA: 192.1
Methoxymalonyl-CoA: 170.7
2-Methylbutyryl-CoA: 146.8
trans-1,2-CPDA: 123.3
Propionyl-CoA: 120.8
Malonyl-CoA: 102.2
CHC-CoA: 89.4
Isobutyryl-CoA: 71.1
fatty_acid: 52.5
Benzoyl-CoA: 48.7
Acetyl-CoA: 43.6
3-Methylbutyryl-CoA: 36.6
inactive: 17.2

BV401_RS39940: mal - mal - mal

PKS_AT (583..882): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 173.2
inactive: 77.9
Methoxymalonyl-CoA: 58.3
Methylmalonyl-CoA: 53.1
fatty_acid: 33.8
Isobutyryl-CoA: 29.7
Propionyl-CoA: 28.7
Ethylmalonyl-CoA: 18.9
Benzoyl-CoA: 16.3
trans-1,2-CPDA: 15.7
2-Methylbutyryl-CoA: 15.7
Acetyl-CoA: 15.0
CHC-CoA: 9.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (2151..2454): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 170.8
inactive: 72.1
Methoxymalonyl-CoA: 63.7
Methylmalonyl-CoA: 52.4
Propionyl-CoA: 34.0
fatty_acid: 28.0
2-Methylbutyryl-CoA: 21.6
Isobutyryl-CoA: 19.8
Ethylmalonyl-CoA: 19.0
Acetyl-CoA: 14.4
trans-1,2-CPDA: 13.8
Benzoyl-CoA: 8.6
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3702..3996): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.7
inactive: 79.4
Methoxymalonyl-CoA: 67.4
Methylmalonyl-CoA: 56.7
Propionyl-CoA: 34.8
fatty_acid: 29.7
Isobutyryl-CoA: 29.1
2-Methylbutyryl-CoA: 25.9
Ethylmalonyl-CoA: 22.6
trans-1,2-CPDA: 16.7
Acetyl-CoA: 15.3
CHC-CoA: 11.3
Benzoyl-CoA: 8.4
3-Methylbutyryl-CoA: 0.0

BV401_RS39960: X

AMP-binding (27..439): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FYQAWAYGYFAGAASAAGERDHYGSTELGMVVAH
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
OsdR	Development and stress management regulator

NZ_CP019458.1 - Region 46 - T1PKS

Download region GenBank file

Download region SVG

Location: 10,005,573 - 10,029,028 nt. (total: 23,456 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BV401_RS40995: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase

BV401_RS41005: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000037.4	0.58	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000037.4	0.58	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.04 out of 18.57

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

Additional weak hits (4):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.58 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.45 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.65 out of 30.25

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BV401_RS41005: mmal

PKS_AT (573..871): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 230.8
Ethylmalonyl-CoA: 230.2
Methoxymalonyl-CoA: 188.7
2-Methylbutyryl-CoA: 155.9
trans-1,2-CPDA: 135.3
Malonyl-CoA: 115.5
Propionyl-CoA: 114.0
CHC-CoA: 108.1
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 68.1
Acetyl-CoA: 43.8
3-Methylbutyryl-CoA: 41.4
fatty_acid: 34.9
inactive: 33.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis

NZ_CP019459.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 24,239 - 24,237 nt. (total: 46,798 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

BV401_RS41030: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BV401_RS43745: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BV401_RS45675: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.75	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 24238 - 24237:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal) + (Me-ccmal) + (pk)
Non-colinear ordering:: BV401_RS45675 + BV401_RS43745 + BV401_RS41020

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS41030: mmal

PKS_AT (565..863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 230.8
Ethylmalonyl-CoA: 230.2
Methoxymalonyl-CoA: 188.7
2-Methylbutyryl-CoA: 155.9
trans-1,2-CPDA: 135.3
Malonyl-CoA: 115.5
Propionyl-CoA: 114.0
CHC-CoA: 108.1
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 68.1
Acetyl-CoA: 43.8
3-Methylbutyryl-CoA: 41.4
fatty_acid: 34.9
inactive: 33.5

BV401_RS45675: mmal

PKS_AT (565..863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 230.8
Ethylmalonyl-CoA: 230.2
Methoxymalonyl-CoA: 188.7
2-Methylbutyryl-CoA: 155.9
trans-1,2-CPDA: 135.3
Malonyl-CoA: 115.5
Propionyl-CoA: 114.0
CHC-CoA: 108.1
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 68.1
Acetyl-CoA: 43.8
3-Methylbutyryl-CoA: 41.4
fatty_acid: 34.9
inactive: 33.5

BV401_RS41020: pk - mal

PKS_AT (960..1258): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 236.0
Methylmalonyl-CoA: 231.8
Methoxymalonyl-CoA: 189.1
2-Methylbutyryl-CoA: 153.1
trans-1,2-CPDA: 137.1
Malonyl-CoA: 117.8
Propionyl-CoA: 113.3
CHC-CoA: 109.1
Isobutyryl-CoA: 89.0
Benzoyl-CoA: 65.7
3-Methylbutyryl-CoA: 48.2
inactive: 44.2
Acetyl-CoA: 40.3
fatty_acid: 31.7

PKS_AT (2520..2712): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 134.4
inactive: 59.8
Methoxymalonyl-CoA: 54.6
Methylmalonyl-CoA: 50.8
Acetyl-CoA: 28.8
Ethylmalonyl-CoA: 23.7
Isobutyryl-CoA: 23.1
Propionyl-CoA: 18.8
Benzoyl-CoA: 16.0
fatty_acid: 13.0
2-Methylbutyryl-CoA: 10.6
CHC-CoA: 9.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

BV401_RS43745: mmal

PKS_AT (565..863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 230.8
Ethylmalonyl-CoA: 230.2
Methoxymalonyl-CoA: 188.7
2-Methylbutyryl-CoA: 155.9
trans-1,2-CPDA: 135.3
Malonyl-CoA: 115.5
Propionyl-CoA: 114.0
CHC-CoA: 108.1
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 68.1
Acetyl-CoA: 43.8
3-Methylbutyryl-CoA: 41.4
fatty_acid: 34.9
inactive: 33.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019462.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 15,584 nt. (total: 15,584 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

BV401_RS45440: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BV401_RS45455: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

BV401_RS45435: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.62	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000037.4	0.62	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

Additional weak hits (7):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.48 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 27.04

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BV401_RS45440: pk

PKS_AT (527..825): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 236.0
Methylmalonyl-CoA: 231.8
Methoxymalonyl-CoA: 189.1
2-Methylbutyryl-CoA: 153.1
trans-1,2-CPDA: 137.1
Malonyl-CoA: 117.8
Propionyl-CoA: 113.3
CHC-CoA: 109.1
Isobutyryl-CoA: 89.0
Benzoyl-CoA: 65.7
3-Methylbutyryl-CoA: 48.2
inactive: 44.2
Acetyl-CoA: 40.3
fatty_acid: 31.7

BV401_RS45455: mmal

PKS_AT (1..200): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 117.3
Ethylmalonyl-CoA: 113.1
Methoxymalonyl-CoA: 90.5
trans-1,2-CPDA: 57.2
2-Methylbutyryl-CoA: 57.2
Malonyl-CoA: 48.8
Isobutyryl-CoA: 47.0
Propionyl-CoA: 41.2
CHC-CoA: 31.3
Benzoyl-CoA: 30.5
3-Methylbutyryl-CoA: 28.6
fatty_acid: 16.8
Acetyl-CoA: 16.4
inactive: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019463.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 15,586 nt. (total: 15,586 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BV401_RS45375: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae
BGC0000353.5	0.41	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000160.3	0.41	PKS	terreic acid	Aspergillus terreus NIH2624
BGC0001163.3	0.38	PKS	1-heptadecene	Moorea producens 3L
BGC0001162.3	0.38	PKS	1-heptadecene	Moorea producens JHB
BGC0001161.5	0.38	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0000043.5	0.38	PKS	curacin A	Moorea producens 19L

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae
BGC0000353.5	0.41	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000160.3	0.41	PKS	terreic acid	Aspergillus terreus NIH2624
BGC0001163.3	0.38	PKS	1-heptadecene	Moorea producens 3L
BGC0001162.3	0.38	PKS	1-heptadecene	Moorea producens JHB
BGC0001161.5	0.38	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0000043.5	0.38	PKS	curacin A	Moorea producens 19L

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.50 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 27.04

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.48 out of 27.55

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 15586:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal - pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BV401_RS45375: mmal - pk - mal

PKS_AT (565..863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 230.8
Ethylmalonyl-CoA: 230.2
Methoxymalonyl-CoA: 188.7
2-Methylbutyryl-CoA: 155.9
trans-1,2-CPDA: 135.3
Malonyl-CoA: 115.5
Propionyl-CoA: 114.0
CHC-CoA: 108.1
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 68.1
Acetyl-CoA: 43.8
3-Methylbutyryl-CoA: 41.4
fatty_acid: 34.9
inactive: 33.5

PKS_AT (2295..2593): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 236.0
Methylmalonyl-CoA: 231.8
Methoxymalonyl-CoA: 189.1
2-Methylbutyryl-CoA: 153.1
trans-1,2-CPDA: 137.1
Malonyl-CoA: 117.8
Propionyl-CoA: 113.3
CHC-CoA: 109.1
Isobutyryl-CoA: 89.0
Benzoyl-CoA: 65.7
3-Methylbutyryl-CoA: 48.2
inactive: 44.2
Acetyl-CoA: 40.3
fatty_acid: 31.7

PKS_AT (3855..4024): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 120.2
inactive: 56.7
Methoxymalonyl-CoA: 44.7
Methylmalonyl-CoA: 43.6
Acetyl-CoA: 28.4
Isobutyryl-CoA: 21.8
Propionyl-CoA: 17.0
Ethylmalonyl-CoA: 15.1
Benzoyl-CoA: 15.0
fatty_acid: 12.6
2-Methylbutyryl-CoA: 9.1
CHC-CoA: 8.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP019464.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 15,601 nt. (total: 15,601 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

BV401_RS45680: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000037.4	0.58	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000037.4	0.58	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002171.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.56	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

Additional weak hits (7):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.48 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 27.04

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BV401_RS45680: mmal

PKS_AT (565..863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 230.8
Ethylmalonyl-CoA: 230.2
Methoxymalonyl-CoA: 188.7
2-Methylbutyryl-CoA: 155.9
trans-1,2-CPDA: 135.3
Malonyl-CoA: 115.5
Propionyl-CoA: 114.0
CHC-CoA: 108.1
Isobutyryl-CoA: 85.6
Benzoyl-CoA: 68.1
Acetyl-CoA: 43.8
3-Methylbutyryl-CoA: 41.4
fatty_acid: 34.9
inactive: 33.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems