GCF_001905885.1 - 41 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_LIYH01000001.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NI-siderophore	254,584	284,359	High	desferrioxamin B/desferrioxamine E	other:other
Region 1.2	HR-T2PKS,phosphonate	334,443	382,181	Low	coprisamide C/coprisamide D	NRPS:Type I
Region 1.3	terpene	406,025	427,134
Region 1.4	triceptide	646,890	668,191
Region 1.5	NRPS,t3nrps-iterative,T1PKS	683,023	776,022	Low	SCO-2138	ribosomal:unmodified
Region 1.6	lanthipeptide-class-iii	862,180	884,867	Medium	SapB	ribosomal:RiPP:Lanthipeptide
Region 1.7	ectoine	1,386,891	1,397,289	High	ectoine	other:other

NZ_LIYH01000010.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	terpene-precursor,RiPP-like	26,769	47,758
Region 2.2	terpene	194,010	212,667	Medium	hopene	terpene

NZ_LIYH01000012.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	NRPS-like,NRPS	1	40,306

NZ_LIYH01000002.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	terpene	24,059	49,277	Low	stlassin	ribosomal:RiPP
Region 6.2	NRPS-like	467,445	509,319	High	streptothricin F/streptothricin E/streptothricin D/streptothricin C	NRPS:Type I
Region 6.3	other,T1PKS	1,018,432	1,075,662	Low	stambomycin A/stambomycin B/stambomycin C/stambomycin D	PKS:Type I+saccharide:hybrid/tailoring

NZ_LIYH01000003.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	redox-cofactor	45,544	67,647
Region 7.2	lassopeptide	225,564	248,144	High	citrulassin D	ribosomal:RiPP
Region 7.3	NI-siderophore	331,750	364,898	Medium	speibonoxamine/desoxy-desferrioxamine D1/desferrioxamine D1/desferrioxamine B/didesoxy-desferrioxamine D1/desoxy-desferrioxamine B/didesoxy-desferrioxamine B	other:other
Region 7.4	RiPP-like	472,968	484,443	Low	14-hydroxyisochainin	PKS:Modular type I
Region 7.5	hydrogen-cyanide	533,024	545,822	Low	aborycin	ribosomal:RiPP
Region 7.6	thioamide-NRP,t3nrps-iterative,terpene,NRPS-like,arylpolyene,NRPS,terpene-precursor	603,277	802,753	High	tiancilactone A/tiancilactone B/tiancilactone C/tiancilactone D/tiancilactone E/tiancilactone F/tiancilactone G/tiancilactone H	terpene
Region 7.7	NI-siderophore	859,271	892,052

NZ_LIYH01000004.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	NRPS,lanthipeptide-class-iii	100,091	144,077	High	SapB	ribosomal:RiPP:Lanthipeptide
Region 8.2	T1PKS,terpene	300,142	346,591
Region 8.3	lanthipeptide-class-iii	382,841	405,447	Medium	SapB	ribosomal:RiPP:Lanthipeptide
Region 8.4	lanthipeptide-class-i	465,724	490,780
Region 8.5	amglyccycl	543,874	565,070
Region 8.6	terpene	758,043	780,379	High	geosmin	terpene:Sesquiterpene
Region 8.7	NRPS,T1PKS,T2PKS	838,374	931,391	Medium	tetracenomycin C	PKS:Type II

NZ_LIYH01000005.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	lanthipeptide-class-i	250,065	275,342
Region 9.2	linaridin	517,007	537,552	Low	legonaridin	ribosomal:RiPP
Region 9.3	lassopeptide	571,883	594,447	High	citrulassin D	ribosomal:RiPP
Region 9.4	melanin	789,381	799,773

NZ_LIYH01000006.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	CDPS	50,522	71,295

NZ_LIYH01000007.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	lassopeptide	194,153	216,759	Low	stenothricin	NRPS:Type I

NZ_LIYH01000008.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	thioamitides	6,543	29,028
Region 12.2	T3PKS	106,404	147,588	High	flaviolin/1,3,6,8-tetrahydroxynaphthalene	PKS
Region 12.3	T3PKS	215,784	256,869	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 12.4	T1PKS	258,100	305,698
Region 12.5	NRPS-like,T1PKS	333,373	404,834	Medium	uncialamycin	PKS

NZ_LIYH01000009.1 (Streptomyces sp. CB03234)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	NRPS-like,melanin	18,100	60,652	Low	melanin	other:other
Region 13.2	NRPS	155,595	200,097
Region 13.3	T2PKS,azole-containing-RiPP,PKS-like	211,914	303,666	Low	trioxacarcin A	PKS

No secondary metabolite regions were found in these records:: NZ_LIYH01000011.1 (Streptomyces sp. CB03234); NZ_LIYH01000013.1 (Streptomyces sp. CB03234)

Compact view

NZ_LIYH01000001.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 254,584 - 284,359 nt. (total: 29,776 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AMK26_RS01225: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

AMK26_RS01250: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase transferase

AMK26_RS01260: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

AMK26_RS01265: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: decarboxylase

AMK26_RS01230: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

AMK26_RS01255: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.84	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000940.5	0.83	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.83	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.64	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.60	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.84	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000940.5	0.83	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.83	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.64	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.60	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 26.85

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.38 out of 27.04

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.94 out of 36.53

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.79 out of 26.85

Confidence: medium

Additional weak hits (11):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.23 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.82 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.23 out of 23.43

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.27 out of 25.88

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.08 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.40 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
RutR	Regulator of the pyrimidine and purine metabolism

NZ_LIYH01000001.1 - Region 2 - HR-T2PKS,phosphonate

Download region GenBank file

Download region SVG

Location: 334,443 - 382,181 nt. (total: 47,739 nt) Show pHMM detection rules used

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))
phosphonate: (phosphonates and minimum(1, [2-Hacid_dh_C, Aldedh, Aminotran_1_2, Aminotran_5, AurF, CTP_transf_like, DUF4992, Fe-ADH, HMGL-like, Metallophos_2, NTP_transf_3, NTP_transf_5, PALP, PEP_mutase, TPP_enzyme_C, TPP_enzyme_N, phosphonates]) and not (phosphonatesHydrolase or phosphonatesMeIsocitrateLyase))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

AMK26_RS01570: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

AMK26_RS01600: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK26_RS01610: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acyltransferase aminotransferase methyltransferase

AMK26_RS01550: acyltransferase

smcogs: SMCOG1141: acyltransferase

AMK26_RS01555: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

AMK26_RS01565: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

AMK26_RS01615: acyltransferase

smcogs: SMCOG1141: acyltransferase

AMK26_RS01710: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthase

AMK26_RS01590: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS01625: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS01630: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AMK26_RS01645: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002036.4	0.44	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0000897.5	0.38	other (other)	dehydrophos	Streptomyces luridus
BGC0000926.5	0.34	other (other)	rhizocticin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000937.5	0.34	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001739.3	0.34	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001859.4	0.32	other (phosphonate)	fosfomycin	Pseudomonas syringae
BGC0000904.5	0.30	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0002670.2	0.30	other (other)	fosfonochlorin	Fusarium oxysporum f. sp. lycopersici 4287
BGC0000938.5	0.25	other (aminocoumarin)	fosfomycin	Streptomyces fradiae
BGC0002000.4	0.25	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002036.4	0.56	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0002711.2	0.54	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0001987.2	0.51	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001197.5	0.51	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002510.2	0.51	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000897.5	0.51	other (other)	dehydrophos	Streptomyces luridus
BGC0000937.5	0.50	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0001739.3	0.50	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (15):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.10 out of 28.14

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.36 out of 25.88

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.25 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.54 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.78 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.44 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.26 out of 27.18

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.08 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.05 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.97 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.81 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.97 out of 23.43

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor

NZ_LIYH01000001.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 406,025 - 427,134 nt. (total: 21,110 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase phosphate reductase

AMK26_RS01870: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS01910: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

Transferases: methyltransferase

AMK26_RS01860: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

AMK26_RS01865: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000902.4	0.41	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0000285.5	0.39	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001197.5	0.38	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001336.5	0.38	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001959.4	0.37	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0001840.2	0.36	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001972.4	0.35	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000902.4	0.41	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.39	terpene	raimonol	Streptomyces anulatus
BGC0000285.5	0.39	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001197.5	0.38	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001336.5	0.38	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001959.4	0.37	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0001840.2	0.36	NRPS, PKS	detoxin S1	Streptomyces sp. NRRL S-325
BGC0001972.4	0.35	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AMK26_RS01865: T1TS

Domain 1 (5 - 323): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (5):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.42 out of 32.74

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.04 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.54 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.30 out of 26.06

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.44 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000001.1 - Region 4 - triceptide

Download region GenBank file

Download region SVG

Location: 646,890 - 668,191 nt. (total: 21,302 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Translocases: permease

AMK26_RS02920: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002293.2	0.29	NRPS	ohmyungsamycin A, ohmyungsamycin B	Streptomyces sp.
BGC0002347.3	0.27	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0000722.5	0.26	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. jinggangensis
BGC0001414.5	0.25	NRPS	griselimycin	Streptomyces muensis
BGC0000715.5	0.25	saccharide	actinospectacin	Streptomyces spectabilis
BGC0000277.5	0.23	PKS	urdamycin	Streptomyces fradiae
BGC0000699.5	0.23	saccharide	hygromycin A	Streptomyces hygroscopicus subsp. hygroscopicus
BGC0001079.5	0.22	PKS, terpene	napyradiomycin A80915C, napyradiomycin 2, napyradiomycin 3, napyradiomycin 4	Streptomyces aculeolatus
BGC0000949.5	0.21	NRPS	A-500359 A, A-500359 B	Streptomyces griseus
BGC0000224.4	0.21	PKS	fredericamycin A	Streptomyces griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002293.2	0.29	NRPS	ohmyungsamycin A, ohmyungsamycin B	Streptomyces sp.
BGC0002347.3	0.27	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0000722.5	0.26	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. jinggangensis
BGC0001414.5	0.25	NRPS	griselimycin	Streptomyces muensis
BGC0000715.5	0.25	saccharide	actinospectacin	Streptomyces spectabilis
BGC0000277.5	0.23	PKS	urdamycin	Streptomyces fradiae
BGC0000699.5	0.23	saccharide	hygromycin A	Streptomyces hygroscopicus subsp. hygroscopicus
BGC0001079.5	0.22	PKS, terpene	napyradiomycin A80915C, napyradiomycin 2, napyradiomycin 3, napyradiomycin 4	Streptomyces aculeolatus
BGC0000949.5	0.21	NRPS	A-500359 A, A-500359 B	Streptomyces griseus
BGC0000224.4	0.21	PKS	fredericamycin A	Streptomyces griseus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

Additional weak hits (7):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.57 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.01 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.16 out of 25.88

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.28 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.73 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000001.1 - Region 5 - NRPS,T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 683,023 - 776,022 nt. (total: 93,000 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AMK26_RS03175: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

AMK26_RS03265: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK26_RS03325: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

AMK26_RS03435: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acylase aminotransferase methyltransferase transferase

AMK26_RS03160: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AMK26_RS03165: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AMK26_RS03240: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AMK26_RS03285: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AMK26_RS03355: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

AMK26_RS03410: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

AMK26_RS03170: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AMK26_RS03425: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: decarboxylase

AMK26_RS03345: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

AMK26_RS03185: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS03195: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AMK26_RS03210: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS03215: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK26_RS03220: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS03290: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS03350: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AMK26_RS03395: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS03405: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.24	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	1.11	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	1.10	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	1.08	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	1.07	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	1.07	NRPS	peramine	Epichloe festucae
BGC0001128.4	1.04	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.02	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	1.00	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.98	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.67	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.21 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.87 out of 26.85

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 22.15 out of 23.43

Confidence: strong

Additional weak hits (17):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.18 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.32 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.34 out of 31.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.96 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.78 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.88 out of 35.63

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.63 out of 28.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.23 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.44 out of 29.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.50 out of 27.04

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.29 out of 36.54

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.15 out of 23.43

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.79 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.65 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 683022 - 776022:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe - Val) + (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS03210: Phe - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (11..404): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVFEMTLVCAGEFNAYGPTEATVWATV
Nearest Stachelhaus code(s):: Phe DAFTVAAVWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1075..1477): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LGTAFDALTFEGFLLVGGDINGYGPTETTTFAVC
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (79% 8Å match); Ile DAFFLGVTFK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMK26_RS03215: X

A-OX (516..1288): X

No predictions made

AMK26_RS03220: mal

PKS_AT (539..829): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%; inactive: 54.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 113.7
inactive: 56.1
Methoxymalonyl-CoA: 48.1
Methylmalonyl-CoA: 44.2
Propionyl-CoA: 30.7
fatty_acid: 16.0
Isobutyryl-CoA: 14.3
Benzoyl-CoA: 11.0
Ethylmalonyl-CoA: 10.1
2-Methylbutyryl-CoA: 6.8
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AMK26_RS03290: X

AMP-binding (11..382): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TALAFHVHVLGGFGVSGSAIERYGMTETLMNTSV
Nearest Stachelhaus code(s):: Glu DVLKVGAVNK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

AMK26_RS03410: mal

PKS_AT (6..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 66.5
Methoxymalonyl-CoA: 33.9
inactive: 23.6
Methylmalonyl-CoA: 22.6
fatty_acid: 13.2
CHC-CoA: 9.4
Isobutyryl-CoA: 8.5
Propionyl-CoA: 7.2
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000001.1 - Region 6 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 862,180 - 884,867 nt. (total: 22,688 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK26_RS03980: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.64	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.62	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.57	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.57	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000513.3	0.57	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000553.3	0.53	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.48	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.47	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.64	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.62	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.57	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.57	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000513.3	0.57	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000553.3	0.53	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.48	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.47	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (10):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.20 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.71 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.16 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.75 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_LIYH01000001.1 - Region 7 - ectoine

Download region GenBank file

Download region SVG

Location: 1,386,891 - 1,397,289 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

AMK26_RS06285: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AMK26_RS06300: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.87	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.87	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.83 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.03 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.63 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.57 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.65 out of 27.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
MexT	Global virulence regulator

NZ_LIYH01000010.1 - Region 1 - RiPP-like,terpene-precursor

Download region GenBank file

Download region SVG

Location: 26,769 - 47,758 nt. (total: 20,990 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

AMK26_RS34300: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

AMK26_RS34285: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthetase

AMK26_RS34275: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.40	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.36	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001555.4	0.35	ribosomal	colicin V	Escherichia coli chi7122
BGC0000623.3	0.34	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000588.5	0.32	ribosomal	microcin L	Escherichia coli
BGC0002698.2	0.32	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000518.3	0.30	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002699.2	0.29	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000617.5	0.29	ribosomal	coagulin	Bacillus coagulans
BGC0000677.5	0.28	terpene	cyclooctatin	Streptomyces melanosporofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0001555.4	0.52	ribosomal	colicin V	Escherichia coli chi7122
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000590.5	0.50	ribosomal	microcin N	Escherichia coli
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000659.3	0.49	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.49	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002699.2	0.49	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000588.5	0.49	ribosomal	microcin L	Escherichia coli
BGC0000658.3	0.48	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AMK26_RS34275: PT_FPPS_like

Domain 1 (38 - 307): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.46 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.51 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.42 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.96 out of 36.53

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.38 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000010.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 194,010 - 212,667 nt. (total: 18,658 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK26_RS34975: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

AMK26_RS35010: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: transferase

AMK26_RS34970: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthetase

AMK26_RS35015: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000644.3	0.47	terpene	carotenoid	Dietzia sp. CQ4
BGC0000638.3	0.47	terpene	carotenoid	Pantoea ananatis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000644.3	0.47	terpene	carotenoid	Dietzia sp. CQ4
BGC0000638.3	0.47	terpene	carotenoid	Pantoea ananatis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

AMK26_RS35000: PT_phytoene_like

Domain 1 (19 - 275): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

AMK26_RS35005: PT_phytoene_like

Domain 1 (16 - 304): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

AMK26_RS35015: PT_FPPS_like

Domain 1 (74 - 365): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

AMK26_RS35020: T2TS

Domain 1 (26 - 658): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

Additional weak hits (3):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.66 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NZ_LIYH01000012.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 40,306 nt. (total: 40,306 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK26_RS35345: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: esterase

AMK26_RS35340: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: lyase

AMK26_RS35355: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

AMK26_RS35330: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK26_RS35335: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK26_RS35350: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.84	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.83	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.81	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.79	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.79	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001825.4	0.78	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.78	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.71	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (7):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.26 out of 32.93

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.94 out of 30.25

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.18 out of 32.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.89 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 40306:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - Ser) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 35853:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - Ser) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS35330: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (226..623): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LGTGFDASTFEGWLVVGGDVNGYGPTENTTFSLT
Nearest Stachelhaus code(s):: Val DAFWVGGTFK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK26_RS35335: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (257..659): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEINLYGPTEATVDVTH
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK26_RS35350: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (358..756): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGSQVFGGEVNMFGITETTVHVTA
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (100% 8Å match); aThr DFWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000002.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 24,059 - 49,277 nt. (total: 25,219 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AMK26_RS06850: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK26_RS06890: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acetyltransferase aminotransferase

AMK26_RS06905: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

AMK26_RS06915: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: cyclase

AMK26_RS06885: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: mutase

AMK26_RS06920: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthetase

AMK26_RS06860: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.58	terpene	astallatene	Arabidopsis thaliana
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002162.3	0.54	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.54	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.53	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0002309.2	0.48	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000894.4	0.46	other (other)	citrinin	Monascus aurantiacus
BGC0001528.4	0.46	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0000678.5	0.46	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000231.5	0.44	PKS	griseusin A, griseusin B	Streptomyces griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.58	terpene	astallatene	Arabidopsis thaliana
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002162.3	0.54	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.54	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.53	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0002309.2	0.48	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000894.4	0.46	other (other)	citrinin	Monascus aurantiacus
BGC0001528.4	0.46	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0000678.5	0.46	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000231.5	0.44	PKS	griseusin A, griseusin B	Streptomyces griseus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AMK26_RS06860: PT_FPPS_like

Domain 1 (64 - 343): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

AMK26_RS06885: T1TS

Domain 1 (8 - 314): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (8):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.79 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.83 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.30 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.47 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.49 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_LIYH01000002.1 - Region 2 - NRPS-like

Download region GenBank file

Download region SVG

Location: 467,445 - 509,319 nt. (total: 41,875 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

AMK26_RS09080: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

AMK26_RS09025: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase lyase

AMK26_RS09050: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

AMK26_RS09060: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

AMK26_RS09035: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS09075: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS09100: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK26_RS09135: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000432.6	0.78	NRPS	streptothricin F, streptothricin E, streptothricin D, streptothricin C	Streptomyces rochei NBRC 12908
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.64	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.64	NRPS	epichloenin A	Epichloe festucae
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000432.6	0.78	NRPS	streptothricin F, streptothricin E, streptothricin D, streptothricin C	Streptomyces rochei NBRC 12908
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.64	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.64	NRPS	epichloenin A	Epichloe festucae
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.19 out of 30.22

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.32 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.27 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.26 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 467444 - 509319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS09035: bLys

Search NORINE for peptide: strict or relaxed

AMP-binding (11..403): bLys

nrpys: bLys

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VPLHGDTSLEEPVLVIGGELNTYGSTETALVTHA
Nearest Stachelhaus code(s):: bLys DTEVVGTLVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK26_RS09075: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (12..416): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAVCFDVLIEEPELVVGGEAHVYGLTECTVSSTM
Nearest Stachelhaus code(s):: Arg DVENVGVISK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
NtrC	Nitrogen regulatory protein C

NZ_LIYH01000002.1 - Region 3 - T1PKS,other

Download region GenBank file

Download region SVG

Location: 1,018,432 - 1,075,662 nt. (total: 57,231 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AMK26_RS11750: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: methyltransferase

AMK26_RS11635: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: glucanase glucosidase

AMK26_RS11655: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

AMK26_RS11670: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

AMK26_RS11795: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Lyases: hydratase

AMK26_RS11810: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthase

AMK26_RS11740: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.77	PKS	esperamicin	Actinomadura verrucosospora
BGC0001164.3	0.43	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000924.5	0.34	other (other)	pyrrolnitrin	Pseudomonas chlororaphis
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001060.5	0.31	PKS	dynemicin A	Micromonospora chersina
BGC0001377.5	0.29	PKS	uncialamycin	Streptomyces uncialis
BGC0002387.2	0.28	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001366.5	0.26	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000821.5	0.26	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0000923.3	0.26	other (other)	paerucumarin	Pseudomonas aeruginosa PAO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.71	PKS	esperamicin	Actinomadura verrucosospora
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002285.2	0.50	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001060.5	0.49	PKS	dynemicin A	Micromonospora chersina
BGC0000924.5	0.48	other (other)	pyrrolnitrin	Pseudomonas chlororaphis
BGC0001285.5	0.47	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0000711.5	0.45	saccharide	neomycin	Streptomyces fradiae
BGC0000518.3	0.44	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (11):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.13 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.60 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.44 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.41 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.62 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.36 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.44 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

AMK26_RS11740: mal

PKS_AT (714..936): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 90.1
Methoxymalonyl-CoA: 68.5
Methylmalonyl-CoA: 54.7
Isobutyryl-CoA: 49.8
fatty_acid: 36.9
Ethylmalonyl-CoA: 30.6
inactive: 18.8
Propionyl-CoA: 18.1
Acetyl-CoA: 15.8
CHC-CoA: 12.5
Benzoyl-CoA: 12.2
3-Methylbutyryl-CoA: 9.4
trans-1,2-CPDA: 5.8
2-Methylbutyryl-CoA: 5.6

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000003.1 - Region 1 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 45,544 - 67,647 nt. (total: 22,104 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AMK26_RS13430: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: methyltransferase

AMK26_RS13455: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase

AMK26_RS13395: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000597.4	0.39	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000353.5	0.38	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000871.4	0.37	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622
BGC0000067.5	0.36	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002711.2	0.36	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001037.5	0.36	NRPS, PKS	pseurotin, azaspirene	Aspergillus fumigatus Af293
BGC0001007.5	0.35	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001940.3	0.35	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0000813.3	0.34	other (other)	K-252a	Nonomuraea longicatena
BGC0002342.3	0.34	NRPS, PKS	myxofacycline C, myxofacycline D, myxofacycline G, myxofacycline E, myxofacycline A, myxofacycline F, myxofacycline B	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000597.4	0.39	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000353.5	0.38	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0000871.4	0.37	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622
BGC0000067.5	0.36	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002711.2	0.36	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001037.5	0.36	NRPS, PKS	pseurotin, azaspirene	Aspergillus fumigatus Af293
BGC0001007.5	0.35	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001940.3	0.35	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0000813.3	0.34	other (other)	K-252a	Nonomuraea longicatena
BGC0002342.3	0.34	NRPS, PKS	myxofacycline C, myxofacycline D, myxofacycline G, myxofacycline E, myxofacycline A, myxofacycline F, myxofacycline B	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

Additional weak hits (10):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.49 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.17 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.83 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.24 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.58 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.45 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.07 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.93 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.95 out of 28.19

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 26 - 109; Score: 58.1

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator

NZ_LIYH01000003.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 225,564 - 248,144 nt. (total: 22,581 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AMK26_RS14325: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: hydrolase

AMK26_RS14270: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.86	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.86	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.84	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.77	ribosomal	citrulassin A	Streptomyces albulus
BGC0001889.2	0.73	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.71	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0002053.3	0.65	ribosomal	ulleungdin	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.86	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.86	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.84	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.77	ribosomal	citrulassin A	Streptomyces albulus
BGC0001889.2	0.73	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.71	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0002053.3	0.65	ribosomal	ulleungdin	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 24.14 out of 26.12

Confidence: medium

Additional weak hits (10):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.59 out of 39.62

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.52 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.84 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.42 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.69 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.99 out of 32.93

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 83; Score: 90.7; RRE type: Lasso_Fused_RRE; Location: 0 - 58; Score: 25.2

TFBS definitions

Regulator	Description
LuxO	Repressor of luminescence

NZ_LIYH01000003.1 - Region 3 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 331,750 - 364,898 nt. (total: 33,149 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AMK26_RS14785: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

AMK26_RS14800: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

AMK26_RS14820: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Hydrolases: hydrolase

AMK26_RS14715: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: decarboxylase

AMK26_RS14770: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.67	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.64	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002469.2	0.63	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.62	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.61	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000941.3	0.60	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.5	0.59	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002073.3	0.59	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000940.5	0.59	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002305.2	0.57	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.67	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.64	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002469.2	0.63	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.62	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.61	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000941.3	0.60	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.5	0.59	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002073.3	0.59	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0000940.5	0.59	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002305.2	0.57	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.36 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.74 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.98 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.27 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.89 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.91 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_LIYH01000003.1 - Region 4 - RiPP-like

Download region GenBank file

Download region SVG

Location: 472,968 - 484,443 nt. (total: 11,476 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AMK26_RS15325: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AMK26_RS15375: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase

AMK26_RS15320: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001909.3	0.34	PKS	strobilurin A	Strobilurus tenacellus
BGC0001768.4	0.32	NRPS	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0002746.3	0.30	ribosomal	dendrothelin A	Dendrothele bispora CBS 962.96
BGC0000723.5	0.28	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0002788.2	0.28	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000010.3	0.26	PKS	aflatoxin	Aspergillus flavus
BGC0002244.3	0.25	PKS	3'-methoxy-1,2-dehydropenicillide, pestalotiollide B, pestalotiollide C, 1,2-dehydropenicillide, 3-methoxy-1,2-dehydropenicillide, 1,2-epoxy-3,4-didehydropenicillide	Neopestalotiopsis clavispora
BGC0000935.5	0.25	PKS, other (aminocoumarin)	esmeraldin	Streptomyces antibioticus
BGC0000152.3	0.25	PKS	sterigmatocystin	Aspergillus nidulans
BGC0002010.4	0.24	NRPS, PKS	streptophenazine B, streptophenazine C, streptophenazine F, streptophenazine G, streptophenazine H	Streptomyces sp. CNB091

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001909.3	0.34	PKS	strobilurin A	Strobilurus tenacellus
BGC0001768.4	0.32	NRPS	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0002746.3	0.30	ribosomal	dendrothelin A	Dendrothele bispora CBS 962.96
BGC0000723.5	0.28	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0002788.2	0.28	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000010.3	0.26	PKS	aflatoxin	Aspergillus flavus
BGC0002244.3	0.25	PKS	3'-methoxy-1,2-dehydropenicillide, pestalotiollide B, pestalotiollide C, 1,2-dehydropenicillide, 3-methoxy-1,2-dehydropenicillide, 1,2-epoxy-3,4-didehydropenicillide	Neopestalotiopsis clavispora
BGC0000935.5	0.25	PKS, other (aminocoumarin)	esmeraldin	Streptomyces antibioticus
BGC0000152.3	0.25	PKS	sterigmatocystin	Aspergillus nidulans
BGC0002010.4	0.24	NRPS, PKS	streptophenazine B, streptophenazine C, streptophenazine F, streptophenazine G, streptophenazine H	Streptomyces sp. CNB091

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.06 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LIYH01000003.1 - Region 5 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 533,024 - 545,822 nt. (total: 12,799 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

AMK26_RS15565: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

AMK26_RS15575: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AMK26_RS15595: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: methyltransferase

AMK26_RS15585: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001464.3	0.42	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0001463.4	0.42	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida
BGC0002284.3	0.41	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000259.3	0.38	PKS	prodigiosin	Serratia marcescens
BGC0000738.3	0.38	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0002675.2	0.38	PKS	prodigiosin	Pseudoalteromonas rubra
BGC0000736.3	0.36	saccharide	capsular polysaccharide	Mannheimia haemolytica
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000890.5	0.36	other (aminocoumarin)	pentabromopseudilin	Pseudoalteromonas phenolica O-BC30

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001464.3	0.42	other (other)	tetrabromopyrrole	Pseudoalteromonas sp. PS5
BGC0001463.4	0.42	other (other)	2,3,4,5-tetrabromopyrrole	Pseudoalteromonas piscicida
BGC0002284.3	0.41	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000259.3	0.38	PKS	prodigiosin	Serratia marcescens
BGC0000738.3	0.38	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0002675.2	0.38	PKS	prodigiosin	Pseudoalteromonas rubra
BGC0000736.3	0.36	saccharide	capsular polysaccharide	Mannheimia haemolytica
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000890.5	0.36	other (aminocoumarin)	pentabromopseudilin	Pseudoalteromonas phenolica O-BC30

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.02 out of 23.79

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

Additional weak hits (5):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.07 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.71 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.77 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.16 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.22 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor
IolR	Regulator of the inositol catabolism

NZ_LIYH01000003.1 - Region 6 - NRPS,NRPS-like,arylpolyene,t3nrps-iterative,terpene,terpene-precursor,thioamide-NRP

Download region GenBank file

Download region SVG

Location: 603,277 - 802,753 nt. (total: 199,477 nt) Show pHMM detection rules used

thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
arylpolyene: (APE_KS1 or APE_KS2)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AMK26_RS15940: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS15990: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

AMK26_RS16040: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS16065: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS16080: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS16105: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AMK26_RS16110: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

AMK26_RS16150: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

AMK26_RS16205: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

AMK26_RS16220: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

AMK26_RS16230: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK26_RS16335: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS16340: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

AMK26_RS16370: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: Halogenation acylase halogenase methyltransferase transferase

AMK26_RS16020: methyltransferase

smcogs: SMCOG1089: methyltransferase

AMK26_RS16030: methyltransferase

smcogs: SMCOG1089: methyltransferase

AMK26_RS16035: methyltransferase

smcogs: SMCOG1089: methyltransferase

AMK26_RS16050: flavin-dependent trp 5 halogenase

halogenases: flavin-dependent trp 5 halogenase
MITE: MITE0000030Halogenation (identity: 64.50%)
smcogs: SMCOG1119: halogenase

AMK26_RS16160: methyltransferase

smcogs: SMCOG1089: methyltransferase

AMK26_RS16380: ambiguous flavin-dependent halogenase

halogenases: ambiguous flavin-dependent halogenase

AMK26_RS16410: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AMK26_RS16435: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: deaminase dehalogenase esterase hydrolase

AMK26_RS15995: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AMK26_RS16195: thioesterase

smcogs: SMCOG1004: thioesterase

AMK26_RS16215: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

AMK26_RS16255: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

AMK26_RS16285: thioesterase

smcogs: SMCOG1004: thioesterase

AMK26_RS37735: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase dehydratase lyase

AMK26_RS15870: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

AMK26_RS16010: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

AMK26_RS16025: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AMK26_RS16460: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase synthetase

AMK26_RS15965: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS16075: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS16090: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

AMK26_RS16210: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AMK26_RS16245: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS16265: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS16270: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS16320: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK26_RS16330: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS16415: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

AMK26_RS16455: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

AMK26_RS15885: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

AMK26_RS16490: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002019.3	2.89	terpene	tiancilactone A, tiancilactone B, tiancilactone C, tiancilactone D, tiancilactone E, tiancilactone F, tiancilactone G, tiancilactone H	Streptomyces sp. CB03234
BGC0001132.4	1.79	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	1.46	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002274.2	1.40	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002369.2	1.11	PKS	maduralactomycin A, maduralactomycin B, actinospirol A, actinospirol B	Actinomadura rubteroloni
BGC0002504.2	1.10	PKS	nocardiopsistin A, nocardiopsistin B, nocardiopsistin C	Nocardiopsis sp.
BGC0001363.5	1.08	NRPS, PKS	ralsolamycin	Ralstonia solanacearum GMI1000
BGC0002514.3	1.07	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0000306.5	1.05	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002019.3	0.99	terpene	tiancilactone A, tiancilactone B, tiancilactone C, tiancilactone D, tiancilactone E, tiancilactone F, tiancilactone G, tiancilactone H	Streptomyces sp. CB03234
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Terpene cluster 1 (649,157 - 673,017):

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AMK26_RS16090: PT_FPPS_like

Domain 1 (38 - 328): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

AMK26_RS16100: T2TS

Domain 1 (282 - 589): Type 2 terpene synthase

Subtype: unknown

Terpene cluster 2 (762,440 - 783,388):

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AMK26_RS16415: PT_FPPS_like

Domain 1 (28 - 313): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.03 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.50 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.15 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (22):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.90 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.43 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.14 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.77 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.56 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.33 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.13 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.58 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.81 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.33 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.15 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.76 out of 20.01

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.59 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.11 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.78 out of 20.01

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.77 out of 25.88

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 603276 - 714074:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (D-X - Val - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 670543 - 714074:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (D-X - Val - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 680385 - 802753:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (D-X - Val - X) + (D-Leu - Asp - D-X) + (D-Asn) + (Acetyl-CoA)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 680385 - 721519:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (D-X - Val - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 691207 - 767805:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (D-Leu - Asp - D-X) + (D-X - Val - X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 759900 - 802753:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS15965: X

AMP-binding (15..420): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GITLFDYGLNQQPVSTSGGFLMYGLTEA-FRSTY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AMK26_RS16075: X

AMP-binding (9..392): X

nrpys: clAnt

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VGYGHGAMVFPMFLIYGAARQAYGLTEAGGVVAT
Nearest Stachelhaus code(s):: clAnt GAFFIGAGVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK26_RS16220: X

AMP-binding (241..646): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAQASVTGEMNAYGLTETSDDTNH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (91% 8Å match); dnmeProp or Dab DIWQSTADDK (82% 8Å match); Asp DIWQSTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK26_RS16320: X - Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (1493..1871): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAAAFDIAVMELEA-TAGETNLYGPTETTVYSTG
Nearest Stachelhaus code(s):: Ala DIFQLALVYK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (3021..3412): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTYEVWLWTGGDCNGYGPTETTTFALS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4075..4468): X

nrpys: Ile, Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTYEAFMWTGGEVHVYGPTETTTFATC
Nearest Stachelhaus code(s):: Ile or Val DAYFWGVTFK (91% 8Å match); Val DAYFWGVTFK (85% 8Å match); Ile DAYFWGVTFK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK26_RS16325: Leu - Asp - X

Search NORINE for peptide: strict or relaxed

AMP-binding (463..851): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSESFDASVLEMLIVVGGDVNAYGPTESTVAATI
Nearest Stachelhaus code(s):: Leu DALLVGAVAK (88% 8Å match); 3OH-Leu DALLVGAVAK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1978..2375): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YWTSFDLTVTATKALLGGEWNVYGPTEATVNVTE
Nearest Stachelhaus code(s):: Asp DLTKLGVVNK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3041..3435): X

nrpys: Ser, Thr, Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHVFDVSLADMQIGVGGEINVYGPSETTVCATM
Nearest Stachelhaus code(s):: Trp DVSQIGAVCK (74% 8Å match)
Stachelhaus code match:: 70% (weak)

AMK26_RS16330: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (1032..1422): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YYVSFDLTVTAGKAVVGGEINEYGPTEATVGCVE
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK26_RS16435: mal

PKS_AT (8..297): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 104.9
Methylmalonyl-CoA: 68.6
Methoxymalonyl-CoA: 63.9
trans-1,2-CPDA: 38.1
Propionyl-CoA: 35.7
2-Methylbutyryl-CoA: 29.7
CHC-CoA: 27.7
Ethylmalonyl-CoA: 26.6
inactive: 23.0
Acetyl-CoA: 15.2
fatty_acid: 13.3
Benzoyl-CoA: 11.2
Isobutyryl-CoA: 9.1
3-Methylbutyryl-CoA: 0.0

AMK26_RS16455: Acetyl-CoA

CAL_domain (40..449): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 22.5
fatty_acid: 21.7
shikimic_acid: 0.0
NH2: 0.0
AHBA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000003.1 - Region 7 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 859,271 - 892,052 nt. (total: 32,782 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AMK26_RS16790: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

AMK26_RS16840: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

AMK26_RS16785: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.51	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.51	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.78 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.31 out of 27.18

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (10):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.83 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.59 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.92 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.19 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.11 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000004.1 - Region 1 - NRPS,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 100,091 - 144,077 nt. (total: 43,987 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AMK26_RS17745: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: acyltransferase

AMK26_RS17720: acyltransferase

smcogs: SMCOG1141: acyltransferase

Ligases: ligase synthase

AMK26_RS17625: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

AMK26_RS17730: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS17750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

AMK26_RS17790: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.97	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000496.5	0.64	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.77	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000496.5	0.65	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AMK26_RS17760

AMK26_RS17765

Leader:

MTLLDLQSMETPKEEATGDIAT

Core:

GSRASLLLCGDSSLSVTTCN

Core with dehydrations:

GDhaRADhaLLLCysGDDhaDhaLDhaVDhbDhbCysN

antiSMASH-DB 4.0 matches for AMK26_RS17765

95.2%

NC_018750.1and 88 others:

NC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNZ_BBNO01000003.1 Lanthipeptides: TU31_RS37940_lanthipeptideNZ_BMSV01000002.1 Lanthipeptides: IE106_RS06150_lanthipeptideNZ_BMTO01000007.1 Lanthipeptides: IE136_RS15615_lanthipeptideNZ_BMTP01000009.1 Lanthipeptides: IE109_RS18470_lanthipeptideNZ_BMTU01000009.1 Lanthipeptides: IE118_RS22890_lanthipeptideNZ_BMUN01000001.1 Lanthipeptides: IE238_RS00740_lanthipeptideNZ_CP007699.2 Lanthipeptides: T261_RS39185_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS05015_lanthipeptideNZ_CP015866.1 Lanthipeptides: Spa2297_RS27800_lanthipeptideNZ_CP017157.1 Lanthipeptides: SL103_RS15895_lanthipeptideNZ_CP019457.1 Lanthipeptides: BXT88_RS03410_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS35355_lanthipeptideNZ_CP019779.1 Lanthipeptides: STRMOE7_RS03775_lanthipeptideNZ_CP020042.1 Lanthipeptides: B4U46_RS32710_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS23100_lanthipeptideNZ_CP023691.1 Lanthipeptides: CP981_RS03050_lanthipeptideNZ_CP023692.1 Lanthipeptides: CP980_RS04735_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS04700_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34970_lanthipeptideNZ_CP028158.1 Lanthipeptides: C6361_RS04660_lanthipeptideNZ_CP028159.1 Lanthipeptides: C6W10_RS01185_lanthipeptideNZ_CP029042.1 Lanthipeptides: DDE74_RS03525_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029541.1 Lanthipeptides: DKG71_RS05245_lanthipeptideNZ_CP034279.1 Lanthipeptides: EIZ62_RS28660_lanthipeptideNZ_CP034353.1 Lanthipeptides: D1J63_RS04900_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35250_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS09720_lanthipeptideNZ_CP046905.1 Lanthipeptides: GPZ77_RS32930_lanthipeptideNZ_CP047140.1 Lanthipeptides: GLX30_RS11420_lanthipeptideNZ_CP050976.1 Lanthipeptides: HEP86_RS04470_lanthipeptideNZ_CP054920.1 Lanthipeptides: HUT15_RS04615_lanthipeptideNZ_CP060825.1 Lanthipeptides: IAG43_RS32355_lanthipeptideNZ_CP074111.1 Lanthipeptides: KE639_RS31630_lanthipeptideNZ_CP084681.1 Lanthipeptides: KI385_RS00885_lanthipeptideNZ_CP085300.1 Lanthipeptides: LJA35_RS05220_lanthipeptideNZ_CP086217.1 Lanthipeptides: LJ741_RS03435_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS09690_lanthipeptideNZ_CP098437.1 Lanthipeptides: NCG97_RS34740_lanthipeptideNZ_CP099468.1 Lanthipeptides: NFX46_RS16770_lanthipeptideNZ_CP101137.1 Lanthipeptides: M6G08_RS24535_lanthipeptideNZ_CP102332.1 Lanthipeptides: NRO40_RS01140_lanthipeptideNZ_CP102609.1 Lanthipeptides: NUT86_RS03980_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33560_lanthipeptideNZ_CP114202.1 Lanthipeptides: STRLI_RS35870_lanthipeptideNZ_CP114203.1 Lanthipeptides: STRNI_RS37360_lanthipeptideNZ_CP114205.1 Lanthipeptides: STRTU_RS33380_lanthipeptideNZ_FNHI01000003.1 Lanthipeptides: BLT82_RS06465_lanthipeptideNZ_JACHJE010000006.1 Lanthipeptides: FHS32_RS15850_lanthipeptideNZ_JACHJI010000005.1 Lanthipeptides: FHS37_RS15430_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00800_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09875_lanthipeptideNZ_JAFEJA010000002.1 Lanthipeptides: JE024_RS34830_lanthipeptideNZ_JAGGOI010000031.1 Lanthipeptides: J7E87_RS22160_lanthipeptideNZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10785_lanthipeptideNZ_JAGPYC010000033.1 Lanthipeptides: KBZ00_RS31440_lanthipeptideNZ_JAHLXF010000022.1 Lanthipeptides: KQY13_RS30555_lanthipeptideNZ_JAIHBQ010000001.1 Lanthipeptides: K4902_RS04515_lanthipeptideNZ_JAJJMU010000026.1 Lanthipeptides: LOC25_RS31275_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAPKNL010000004.1 Lanthipeptides: OSI21_RS07750_lanthipeptideNZ_JAPNLM010000003.1 Lanthipeptides: OTB16_RS07305_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0131905_lanthipeptideNZ_KN039948.1 Lanthipeptides: FM21_RS29525_lanthipeptideNZ_LIPF01000004.1 Lanthipeptides: AMK11_RS16660_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVX01000004.1 Lanthipeptides: AMK29_RS15650_lanthipeptideNZ_LIWB01000010.1 Lanthipeptides: AMK33_RS24360_lanthipeptideNZ_LIYH01000004.1 Lanthipeptides: AMK26_RS17765_lanthipeptideNZ_MPOH02000012.1 Lanthipeptides: BM536_RS17150_lanthipeptideNZ_NBCN01000003.1 Lanthipeptides: BKD26_RS06570_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_RAIF01000032.1 Lanthipeptides: EBH09_RS35480_lanthipeptideNZ_SOPG01000008.1 Lanthipeptides: E0I08_RS17090_lanthipeptide

Lanthipeptides: SVEN_RS32110_lanthipeptide

1

GSRASLLLCGDSSLSVTTCN

20

GSRASLLLCGDSSLSVTTCN

2

GSRASLLLCGDSSLSVTTCN

21

90.5%

NZ_BBOK01000011.1and 45 others:

NZ_BEWD01000001.1 Lanthipeptides: Sru02f_RS01660_lanthipeptideNZ_BMSL01000016.1 Lanthipeptides: IE215_RS23330_lanthipeptideNZ_BMUC01000023.1 Lanthipeptides: IE172_RS32210_lanthipeptideNZ_BMVE01000003.1 Lanthipeptides: IE248_RS10435_lanthipeptideNZ_BMVL01000005.1 Lanthipeptides: IE257_RS16230_lanthipeptideNZ_BMVQ01000005.1 Lanthipeptides: IE283_RS17035_lanthipeptideNZ_BMWI01000025.1 Lanthipeptides: IE253_RS33945_lanthipeptideNZ_CM002280.1 Lanthipeptides: M877_RS44575_lanthipeptideNZ_CP011664.1 Lanthipeptides: M444_RS30240_lanthipeptideNZ_CP012382.1 Lanthipeptides: SAM23877_RS30085_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS29010_lanthipeptideNZ_CP018047.1 Lanthipeptides: BBN63_RS03065_lanthipeptideNZ_CP020039.1 Lanthipeptides: B4U39_RS34445_lanthipeptideNZ_CP020555.1 Lanthipeptides: B6R96_RS03515_lanthipeptideNZ_CP023701.1 Lanthipeptides: CP968_RS29065_lanthipeptideNZ_CP029189.1 Lanthipeptides: DEJ51_RS31910_lanthipeptideNZ_CP033581.1 Lanthipeptides: EES41_RS31595_lanthipeptideNZ_CP034350.1 Lanthipeptides: D1J60_RS32970_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS34495_lanthipeptideNZ_CP043638.1 Lanthipeptides: F1D59_RS34930_lanthipeptideNZ_CP043959.1 Lanthipeptides: F3L20_RS19105_lanthipeptideNZ_CP045547.1 Lanthipeptides: GEV49_RS05730_lanthipeptideNZ_CP048397.1 Lanthipeptides: SSPS47_RS31455_lanthipeptideNZ_CP054939.1 Lanthipeptides: HUT14_RS29815_lanthipeptideNZ_CP094918.1 Lanthipeptides: MTR79_RS16715_lanthipeptideNZ_CP115936.1 Lanthipeptides: PET44_RS28650_lanthipeptideNZ_CP116355.1 Lanthipeptides: KPP03845_RS32700_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS05020_lanthipeptideNZ_GG657758.1 Lanthipeptides: SSRG_RS03855_lanthipeptideNZ_JAAIFS010000001.1 Lanthipeptides: GUR47_RS02255_lanthipeptideNZ_JACHEM010000005.1 Lanthipeptides: HNQ79_RS11445_lanthipeptideNZ_JAFLQY010000003.1 Lanthipeptides: J0X20_RS29030_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS05695_lanthipeptideNZ_LIVP01000027.1 Lanthipeptides: AMK15_RS28680_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS34110_lanthipeptideNZ_LWLD01000038.1 Lanthipeptides: A6A28_RS28600_lanthipeptideNZ_ML123038.1 Lanthipeptides: EES37_RS30340_lanthipeptideNZ_MQUH01000025.1 Lanthipeptides: BSZ07_RS33280_lanthipeptideNZ_NNBM01000002.1 Lanthipeptides: CG724_RS07855_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS10360_lanthipeptideNZ_RSEG01000006.1 Lanthipeptides: EIA57_RS12710_lanthipeptideNZ_SOAV01000001.1 Lanthipeptides: EV562_RS04520_lanthipeptideNZ_VIUV01000020.1 Lanthipeptides: FB570_RS34060_lanthipeptideNZ_WHZR01000001.1 Lanthipeptides: STPH1_RS04005_lanthipeptideNZ_WXVT01000001.1 Lanthipeptides: STPH2_RS03995_lanthipeptide

Lanthipeptides: APK71_RS25550_lanthipeptide

1

GSRASLLLCGDSSLSVTTCN

20

GSRASLLLCGDSSLS+TTCN

2

GSRASLLLCGDSSLSITTCN

21

90.5%

NZ_BNCA01000002.1and 1 other:

NZ_CP049782.1 Lanthipeptides: G7Z12_RS34445_lanthipeptide

Lanthipeptides: IE314_RS02760_lanthipeptide

1

GSRASLLLCGDSSLSVTTCN

20

GSRASLLLCGDSSLSV+TCN

2

GSRASLLLCGDSSLSVSTCN

21

with 69 more sequence matches

Only the first 10 are displayed here.

90.5%

NZ_CP048835.1:

Lanthipeptides: C8250_RS00390_lanthipeptide

1

GSRASLLLCGDSSLSVTTCN

20

GSRASLLLCG+SSLSVTTCN

2

GSRASLLLCGNSSLSVTTCN

21

90.5%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

1

GSRASLLLCGDSSLSVTTCN

20

GS+ASLLLCGDSSLSVTTCN

2

GSQASLLLCGDSSLSVTTCN

21

90.0%

NZ_CP077658.1:

Lanthipeptides: KQY30_RS33045_lanthipeptide

1

GSRASLLLCGDSSLSVTTCN

20

SRASLLLCGDSSLSV TCN

1

ASRASLLLCGDSSLSVVTCN

20

90.0%

NZ_CP092183.1:

Lanthipeptides: COUCH_RS09775_lanthipeptide

3

RASLLLCGDSSLSVTTCN

20

RASLLLCGDSSLSVTTCN

1

RASLLLCGDSSLSVTTCN

18

85.7%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS17975_lanthipeptide

1

GSRASLLLCGDSSLSVTTCN

20

GS ASLLLCGDSSLS+TTCN

2

GSEASLLLCGDSSLSLTTCN

21

85.7%

NZ_FOET01000001.1and 2 others:

NZ_FOSG01000005.1 Lanthipeptides: BM237_RS08435_lanthipeptideNZ_PDKQ02000044.1 Lanthipeptides: BFM75_RS16855_lanthipeptide

Lanthipeptides: BMY40_RS02540_lanthipeptide

1

GSRASLLLCGDSSLSVTTCN

20

GS ASLLLCGDSSLSVTTC

2

GSEASLLLCGDSSLSVTTCR

21

85.0%

NC_015434.1and 26 others:

NZ_CP045309.1 Lanthipeptides: GCE86_RS12520_lanthipeptideNZ_CP046104.1 Lanthipeptides: GKC29_RS19975_lanthipeptideNZ_CP059322.1 Lanthipeptides: H1D33_RS20095_lanthipeptideNZ_CP059322.1 Lanthipeptides: H1D33_RS20090_lanthipeptideNZ_FMCR01000005.1 Lanthipeptides: GA0070561_RS23835_lanthipeptideNZ_FMCS01000001.1 Lanthipeptides: GA0070214_RS02345_lanthipeptideNZ_FMCU01000002.1 Lanthipeptides: GA0070216_RS07020_lanthipeptideNZ_FMCU01000002.1 Lanthipeptides: GA0070216_RS07015_lanthipeptideNZ_FMCU01000002.1 Lanthipeptides: GA0070216_RS07010_lanthipeptideNZ_FMDM01000002.1 Lanthipeptides: GA0070213_RS04970_lanthipeptideNZ_HF570108.1 Lanthipeptides: MILUP08_RS22425_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09870_lanthipeptideNZ_JAFEUO010000005.1 Lanthipeptides: JQN84_RS18770_lanthipeptideNZ_JAFEUO010000005.1 Lanthipeptides: JQN84_RS18765_lanthipeptideNZ_JAGFWR010000037.1 Lanthipeptides: JQN83_RS31375_lanthipeptideNZ_JAGFWR010000037.1 Lanthipeptides: JQN83_RS31370_lanthipeptideNZ_JAGPXN010000015.1 Lanthipeptides: KBX06_RS19685_lanthipeptideNZ_JAGPXN010000015.1 Lanthipeptides: KBX06_RS19680_lanthipeptideNZ_JAGPXW010000002.1 Lanthipeptides: KBX71_RS04195_lanthipeptideNZ_LT607409.1 Lanthipeptides: GA0070612_RS21605_lanthipeptideNZ_LT607733.1 Lanthipeptides: GA0070610_RS13855_lanthipeptideNZ_LT607733.1 Lanthipeptides: GA0070610_RS13850_lanthipeptideNZ_LT607752.1 Lanthipeptides: GA0070623_RS04340_lanthipeptideNZ_LT607752.1 Lanthipeptides: GA0070623_RS04335_lanthipeptideNZ_LT607752.1 Lanthipeptides: GA0070623_RS04330_lanthipeptideNZ_RBAK01000011.1 Lanthipeptides: D7223_RS24620_lanthipeptide

Lanthipeptides: VAB18032_RS17930_lanthipeptide

4

ASLLLCGDSSLSVTTCN

20

ASLLLCGDSSLSVTTCN

1

ASLLLCGDSSLSVTTCN

17

85.0%

NZ_BMXJ01000002.1and 3 others:

NZ_CP099837.1 Lanthipeptides: NE857_RS18075_lanthipeptideNZ_KI911536.1 Lanthipeptides: B042_RS0117070_lanthipeptideNZ_VWVU01000023.1 Lanthipeptides: FYX01_RS21045_lanthipeptide

Lanthipeptides: IE195_RS04480_lanthipeptide

2

SRASLLLCGDSSLSVTTC

19

S ASLLLCGDSSLSVTTC

2

STASLLLCGDSSLSVTTC

19

80.0%

NZ_BBOL01000008.1and 7 others:

NZ_BBOL01000008.1 Lanthipeptides: LPU61_RS25375_lanthipeptideNZ_CP058322.1 Lanthipeptides: HXZ27_RS14120_lanthipeptideNZ_CP058322.1 Lanthipeptides: HXZ27_RS14115_lanthipeptideNZ_FMCT01000009.1 Lanthipeptides: GA0070563_RS21095_lanthipeptideNZ_FMCT01000009.1 Lanthipeptides: GA0070563_RS21090_lanthipeptideNZ_FMCW01000007.1 Lanthipeptides: GA0070558_RS08825_lanthipeptideNZ_FMCW01000007.1 Lanthipeptides: GA0070558_RS08820_lanthipeptide

Lanthipeptides: LPU61_RS25380_lanthipeptide

4

ASLLLCGDSSLSVTTCN

20

ASLLLCGDS LSVTTCN

1

ASLLLCGDSGLSVTTCN

17

80.0%

NZ_BMQY01000002.1and 1 other:

NZ_PGGW01000069.1 Lanthipeptides: CUT44_RS29865_lanthipeptide

Lanthipeptides: IEY99_RS07885_lanthipeptide

4

ASLLLCGDSSLSVTTCN

20

ASLLLCGDSSLSVTTC+

1

ASLLLCGDSSLSVTTCD

17

MIBiG 4.0 matches for AMK26_RS17765

54.5%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

GSRASLLLCGDSSLSVTTCN

20

GS+ SLL+C SSLSV C

2

GSQVSLLVCEYSSLSVVLCT

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.50 out of 25.88

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.23 out of 26.85

Confidence: medium

Additional weak hits (8):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.42 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.27 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.28 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.52 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.71 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.55 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.71 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

AMK26_RS17765 - Class III

Cleavage pHMM score: 30.90

RODEO score: 0

Monoisotopic mass: 1856.9 Da

Molecular weight: 1858.1 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1876.1 Da N = 1; 1894.1 Da N = 2; 1912.1 Da N = 3; 1930.2 Da N = 4; 1948.2 Da N = 5

Predicted core structure(s)

For candidate cluster 1, location 100090 - 144077:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS17730: X

AMP-binding (474..875): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGAGFDVAVLEAKLVVGGDLASYGPTESTVLATV
Nearest Stachelhaus code(s):: Glu DVLKVGAVNK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMK26_RS17750: X

AMP-binding (35..434): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTSSVDVSVQDMDLITGGSVNAYGPTEATVTATL
Nearest Stachelhaus code(s):: Arg DVGDIGAVTK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
PsrA	Oleic acid responsive regulator
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000004.1 - Region 2 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 300,142 - 346,591 nt. (total: 46,450 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AMK26_RS18575: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AMK26_RS18600: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: acylase methyltransferase

AMK26_RS18605: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AMK26_RS18655: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase

AMK26_RS18625: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase

AMK26_RS18650: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	1.23	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	1.03	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.61	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.31	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.31	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.31	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.30	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.30	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.29	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.85	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

AMK26_RS18650: T1TS

Domain 1 (33 - 434): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.00 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (12):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.11 out of 27.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.98 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.85 out of 29.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.29 out of 30.98

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.25 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.25 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.50 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.23 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 300141 - 346591:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS18605: pk

PKS_AT (558..853): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 143.1
Ethylmalonyl-CoA: 123.8
Methoxymalonyl-CoA: 115.6
Malonyl-CoA: 99.1
Propionyl-CoA: 89.1
2-Methylbutyryl-CoA: 83.2
Isobutyryl-CoA: 75.8
trans-1,2-CPDA: 64.3
fatty_acid: 61.9
Acetyl-CoA: 61.2
CHC-CoA: 42.4
3-Methylbutyryl-CoA: 39.0
inactive: 36.7
Benzoyl-CoA: 21.6

Link to PARAS substrate predictor

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000004.1 - Region 3 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 382,841 - 405,447 nt. (total: 22,607 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.67	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.55	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.49	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002700.2	0.48	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.67	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.55	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.49	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002700.2	0.48	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AMK26_RS18890

AMK26_RS36220

Leader:

MTILDLQGMETSYRR

Core:

PPKGSRASKHCGASGLSLLLC

Core with dehydrations:

PPKGDhaRADhaKHCysGADhaGLDhaLLLCys

antiSMASH-DB 4.0 matches for AMK26_RS36220

100.0%

NZ_LIYH01000004.1:

Lanthipeptides: AMK26_RS36220_lanthipeptide

1

PPKGSRASKHCGASGLSLLLC

21

PPKGSRASKHCGASGLSLLLC

1

PPKGSRASKHCGASGLSLLLC

21

77.3%

NZ_CP075691.1:

Lanthipeptides: KKZ08_RS01100_lanthipeptide

1

PPKGSRASKHC-GASGLSLLLC

21

PP GSRASK C GAS SLLLC

1

PPPGSRASKQCSGASRYSLLLC

22

77.3%

NZ_RQJW01000008.1:

Lanthipeptides: EHO50_RS30030_lanthipeptide

1

PPKGSRASKHC-GASGLSLLLC

21

PP GSRASK C G S LSLLLC

1

PPPGSRASKGCGGGSRLSLLLC

22

with 32 more sequence matches

Only the first 10 are displayed here.

61.9%

NZ_NBCN01000003.1:

Lanthipeptides: BKD26_RS38955_lanthipeptide

5

SRASKHCG-ASGLSLLLC

21

S ASK+CG AS LS+LLC

2

SGASKYCGGASRLSVLLC

19

60.0%

NZ_CP024989.1and 1 other:

NZ_JABXWH010000020.1 Lanthipeptides: HW845_RS38655_lanthipeptide

Lanthipeptides: CVT30_RS32985_lanthipeptide

1

PPKGSRASKHC----GASGLSLLLC

21

PP GSRASK C G S SLL C

1

PPPGSRASKGCIVGGGGSIFSLLFC

25

52.2%

NZ_CP102509.1:

Lanthipeptides: JIW86_RS37035_lanthipeptide

4

GSRASKH-CGASGLSLLLC

21

GSRAS CG S LSL C

4

GSRASLLLCGDSSLSLTTC

22

50.0%

NZ_CP024894.1and 1 other:

NZ_SDLS01000004.1 Lanthipeptides: EIZ45_RS09385_lanthipeptide

Lanthipeptides: CU254_RS16295_lanthipeptide

5

SRASKHCGASGLSLLLC

21

S S CG S LSLLLC

5

SHYSAWCGESTLSLLLC

21

50.0%

NZ_CP091381.1:

Lanthipeptides: L3Q65_RS08355_lanthipeptide

5

SRASKHCGASGLSLLLC

21

S S CG S LSLLLC

5

SHYSAWCGDSTLSLLLC

21

50.0%

NZ_KB912942.1:

Lanthipeptides: AMYBE_RS44660_lanthipeptide

5

SRASKHCGASGLSLLLC

21

S S HCG S LSLLLC

7

SHFSLHCGDSTLSLLLC

23

50.0%

NZ_LWSF01000028.1:

Lanthipeptides: allorf_078284_078409_lanthipeptide

5

SRASKHCGASGLSLLLC

21

S S CG S LSLLLC

5

SHCSTECGESTLSLLLC

21

47.6%

NZ_FNCN01000003.1:

Lanthipeptides: allorf_178077_178187_lanthipeptide

5

SRASKHCGA-SGLSLLLC

21

S S+ CG S LSLL+C

1

SHYSRGCGGGSWLSLLIC

18

43.5%

NZ_CP007155.1:

Lanthipeptides: KALB_RS46315_lanthipeptide

12

GASGLSLLLC

21

GASGLSLLLC

12

GASGLSLLLC

21

42.9%

NZ_JACDUR010000005.1:

Lanthipeptides: allorf_0025156_0025278_lanthipeptide

12

GASGLSLLLC

21

GAS LSLLLC

10

GASWLSLLLC

19

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.12 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.43 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.07 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.92 out of 20.01

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

AMK26_RS36220 - Class III

Cleavage pHMM score: -0.20

RODEO score: 0

Monoisotopic mass: 2009.1 Da

Molecular weight: 2010.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2028.4 Da N = 1; 2046.4 Da N = 2

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_LIYH01000004.1 - Region 4 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 465,724 - 490,780 nt. (total: 25,057 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK26_RS19215: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

AMK26_RS19245: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase hydrolase

AMK26_RS19170: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AMK26_RS19225: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: cyclase

AMK26_RS19200: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001723.5	0.38	PKS	oviedomycin	Streptomyces antibioticus
BGC0000188.5	0.37	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0000612.4	0.36	ribosomal	thiocillin I	Bacillus cereus ATCC 14579
BGC0002000.4	0.36	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001723.5	0.38	PKS	oviedomycin	Streptomyces antibioticus
BGC0000188.5	0.37	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001810.3	0.37	PKS	trehangelin	Polymorphospora rubra
BGC0000612.4	0.36	ribosomal	thiocillin I	Bacillus cereus ATCC 14579
BGC0002000.4	0.36	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

Additional weak hits (7):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.91 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.62 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.04 out of 24.78

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 288 - 374; Score: 26.4

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor

NZ_LIYH01000004.1 - Region 5 - amglyccycl

Download region GenBank file

Download region SVG

Location: 543,874 - 565,070 nt. (total: 21,197 nt) Show pHMM detection rules used

amglyccycl: (DOIS or ValA or salQ or strH or strK1 or strK2 or NeoL or SpcFG or SpcDK_glyc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK26_RS19550: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Ligases: synthase

AMK26_RS19520: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

AMK26_RS19525: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.52	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002496.3	0.45	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001928.2	0.41	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000903.3	0.39	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000548.4	0.39	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000545.5	0.39	ribosomal	ruminococcin A	[Ruminococcus] gnavus E1
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.52	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002496.3	0.45	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001928.2	0.41	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000496.5	0.41	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000903.3	0.39	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000548.4	0.39	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000545.5	0.39	ribosomal	ruminococcin A	[Ruminococcus] gnavus E1
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (4):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.01 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.33 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.02 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.79 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_LIYH01000004.1 - Region 6 - terpene

Download region GenBank file

Download region SVG

Location: 758,043 - 780,379 nt. (total: 22,337 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK26_RS20555: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase hydratase

AMK26_RS20470: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

AMK26_RS20515: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

AMK26_RS20465: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000658.3	0.56	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001135.5	0.55	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000933.3	0.44	other (other)	xiamenmycin A	Streptomyces xiamenensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000658.3	0.56	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001135.5	0.55	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000933.3	0.44	other (other)	xiamenmycin A	Streptomyces xiamenensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

AMK26_RS20515: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (330 - 695): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.12 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (8):

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.63 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.71 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.75 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.21 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.01 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000004.1 - Region 7 - NRPS,T1PKS,T2PKS

Download region GenBank file

Download region SVG

Location: 838,374 - 931,391 nt. (total: 93,018 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

AMK26_RS21170: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Lyases: cyclase

AMK26_RS21140: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

AMK26_RS21165: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

AMK26_RS20890: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AMK26_RS20915: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS21150: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS21155: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000275.4	0.72	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000231.5	0.66	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 22.22 out of 23.05

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.41 out of 23.79

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

Additional weak hits (17):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.34 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.85 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.42 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.16 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.38 out of 26.85

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.26 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.19 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.45 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.58 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.07 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.18 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.87 out of 20.01

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.45 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.81 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 838373 - 931391:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - mal - Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 838373 - 889395:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - mal - Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS20915: Leu - mal - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (30..466): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: FSTH-GAFLLYLWALCGGEVPAWGMAETVTAVTF
Nearest Stachelhaus code(s):: 2S-Hic GILWLGASGK (50% 8Å match); Val DAFWLGATFK (38% 8Å match); bOH-Val DALWLGGTFK (29% 8Å match)
Stachelhaus code match:: 70% (weak)

PKS_AT (1236..1519): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 115.5
inactive: 55.2
Methylmalonyl-CoA: 41.2
Methoxymalonyl-CoA: 37.6
Propionyl-CoA: 33.6
2-Methylbutyryl-CoA: 24.5
fatty_acid: 17.6
trans-1,2-CPDA: 16.3
CHC-CoA: 14.8
Benzoyl-CoA: 14.2
Acetyl-CoA: 12.4
Ethylmalonyl-CoA: 9.7
3-Methylbutyryl-CoA: 8.6
Isobutyryl-CoA: 7.9

AMP-binding (2648..3038): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LAHTFDVSVQETFMFSAGEYNQYGPTETSVIVTS
Nearest Stachelhaus code(s):: Pro DVQFAAQVVK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 876635 to 931391
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)

AMK26_RS21030: CYC (Score: 26.0; E-value: 1.3e-08)
AMK26_RS21140: CYC C4-C21/C2-C23|C2-C19 (Score: 152.9; E-value: 5.8e-48)
AMK26_RS21145: CYC C5-C18 (Score: 194.3; E-value: 1.6e-60)
AMK26_RS21150: KS (Score: 736.6; E-value: 1.7e-224)
AMK26_RS21155: CLF (Score: 635.6; E-value: 7.4e-194)
AMK26_RS21160: ACP (Score: 96.6; E-value: 1.5e-30)
AMK26_RS21165: CYC C9-C14 (Score: 231.1; E-value: 1e-71)
AMK26_RS21170: MET (Score: 278.2; E-value: 2.1e-85)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000005.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 250,065 - 275,342 nt. (total: 25,278 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

AMK26_RS22505: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

AMK26_RS22510: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001727.3	0.40	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000518.3	0.40	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000514.5	0.39	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0000529.5	0.35	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000703.4	0.26	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000796.3	0.26	saccharide	S-layer glycan	Paenibacillus alvei

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001727.3	0.40	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000518.3	0.40	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000514.5	0.39	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0000529.5	0.35	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000703.4	0.26	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000796.3	0.26	saccharide	S-layer glycan	Paenibacillus alvei

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.71 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.33 out of 20.01

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.48 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.22 out of 30.98

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 248; Score: 59.7

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000005.1 - Region 2 - linaridin

Download region GenBank file

Download region SVG

Location: 517,007 - 537,552 nt. (total: 20,546 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK26_RS23740: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

AMK26_RS23755: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

AMK26_RS23765: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

AMK26_RS23725: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001188.3	0.50	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0001735.5	0.49	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0002319.3	0.45	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0000583.5	0.45	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002150.2	0.44	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.44	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000582.4	0.43	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001188.3	0.50	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0001735.5	0.49	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0002319.3	0.45	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0000583.5	0.45	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002150.2	0.44	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.44	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0000582.4	0.43	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.42	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.91 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.40 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.45 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.78 out of 39.62

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor

NZ_LIYH01000005.1 - Region 3 - lassopeptide

Download region GenBank file

Download region SVG

Location: 571,883 - 594,447 nt. (total: 22,565 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

AMK26_RS24040: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.86	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.85	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.84	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.77	ribosomal	citrulassin A	Streptomyces albulus
BGC0001889.2	0.73	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.71	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0002053.3	0.65	ribosomal	ulleungdin	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.86	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.85	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.84	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.77	ribosomal	citrulassin A	Streptomyces albulus
BGC0001889.2	0.73	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001781.4	0.71	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0002053.3	0.65	ribosomal	ulleungdin	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.11 out of 24.78

Confidence: medium

Additional weak hits (5):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.85 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.40 out of 26.85

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.27 out of 29.65

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 83; Score: 88.5

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response

NZ_LIYH01000005.1 - Region 4 - melanin

Download region GenBank file

Download region SVG

Location: 789,381 - 799,773 nt. (total: 10,393 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

AMK26_RS25005: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.81	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.39	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.30	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.81	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.39	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.30	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (8):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.24 out of 27.18

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.43 out of 20.01

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.89 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.89 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.19 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_LIYH01000006.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 50,522 - 71,295 nt. (total: 20,774 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AMK26_RS25905: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

AMK26_RS25915: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001948.3	0.67	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001986.3	0.56	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001336.5	0.39	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002825.2	0.37	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0001468.5	0.37	other (trna-derived)	bicyclomycin	Streptomyces cinnamoneus
BGC0000821.5	0.36	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001483.4	0.36	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002434.2	0.35	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.
BGC0002239.2	0.35	NRPS, PKS	GKK1032 A2, pyrrocidine A, pyrrocidine B	Acremonium sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001948.3	0.67	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001986.3	0.56	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001336.5	0.39	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002825.2	0.37	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0001468.5	0.37	other (trna-derived)	bicyclomycin	Streptomyces cinnamoneus
BGC0000821.5	0.36	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001483.4	0.36	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002434.2	0.35	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.
BGC0002239.2	0.35	NRPS, PKS	GKK1032 A2, pyrrocidine A, pyrrocidine B	Acremonium sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.35 out of 23.79

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.89 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.14 out of 23.79

Confidence: medium

Additional weak hits (13):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.70 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.14 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.60 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.45 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.50 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.19 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.48 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.30 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_LIYH01000007.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 194,153 - 216,759 nt. (total: 22,607 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: phosphate reductase

AMK26_RS29545: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

Transferases: acyltransferase aminotransferase kinase

AMK26_RS29465: acyltransferase

smcogs: SMCOG1141: acyltransferase

AMK26_RS29530: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AMK26_RS29535: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Hydrolases: hydrolase

AMK26_RS29495: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: lyase

AMK26_RS29485: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthase

AMK26_RS29490: argininosuccinate synthase

smcogs: SMCOG1291: argininosuccinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001781.4	0.72	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001645.3	0.71	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.4	0.71	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001552.3	0.66	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001550.3	0.64	ribosomal	citrulassin D	Streptomyces katrae
BGC0001634.3	0.62	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002298.2	0.62	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001889.2	0.61	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001493.5	0.61	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001781.4	0.72	ribosomal	sphaericin	Planomonospora sphaerica
BGC0001645.3	0.71	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.4	0.71	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001552.3	0.66	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001550.3	0.64	ribosomal	citrulassin D	Streptomyces katrae
BGC0001634.3	0.62	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002298.2	0.62	ribosomal	lassomycin-like peptide	Sanguibacter keddieii DSM 10542
BGC0001889.2	0.61	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001493.5	0.61	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.25 out of 26.85

Confidence: medium

Additional weak hits (5):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.29 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.17 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.18 out of 28.19

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 85; Score: 79.1

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism

NZ_LIYH01000008.1 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 6,543 - 29,028 nt. (total: 22,486 nt) Show pHMM detection rules used

Region on contig edge.

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase

AMK26_RS30870: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

AMK26_RS30900: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.48	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002013.4	0.45	ribosomal	curacozole	Streptomyces curacoi
BGC0002560.3	0.39	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001157.6	0.39	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000625.5	0.38	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000469.6	0.37	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000477.3	0.37	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0001696.5	0.37	ribosomal	neothioviridamide	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.48	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002013.4	0.45	ribosomal	curacozole	Streptomyces curacoi
BGC0002560.3	0.39	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001157.6	0.39	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000625.5	0.38	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0000469.6	0.37	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000477.3	0.37	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0001696.5	0.37	ribosomal	neothioviridamide	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.62 out of 29.72

Confidence: medium

Additional weak hits (12):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.24 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.15 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.55 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.45 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.00 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.74 out of 26.85

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.28 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.72 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.86 out of 26.85

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 36.53

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.76 out of 29.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
NtrC	Nitrogen regulatory protein C

NZ_LIYH01000008.1 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 106,404 - 147,588 nt. (total: 41,185 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AMK26_RS31430: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS31485: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

AMK26_RS31495: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase

AMK26_RS31345: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

AMK26_RS31500: isochorismatase

smcogs: SMCOG1027: isochorismatase

AMK26_RS31515: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthase

AMK26_RS31425: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.85	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.70	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000285.5	0.59	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001336.5	0.47	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001485.4	0.44	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001078.5	0.44	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.85	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.70	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000285.5	0.59	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001336.5	0.47	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000280.5	0.45	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001986.3	0.45	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001485.4	0.44	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001078.5	0.44	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (16):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.65 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.50 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.91 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.28 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.09 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.10 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.74 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.34 out of 31.73

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.71 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.64 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.59 out of 30.98

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein

NZ_LIYH01000008.1 - Region 3 - T3PKS

Download region GenBank file

Download region SVG

Location: 215,784 - 256,869 nt. (total: 41,086 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AMK26_RS31925: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: methyltransferase

AMK26_RS31920: Methylation

MITE: MITE0000155Methylation (identity: 76.20%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Hydrolases: hydrolase

AMK26_RS31860: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: decarboxylase

AMK26_RS31980: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

AMK26_RS31915: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.83	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001778.5	0.46	other (other)	showdomycin	Streptomyces showdoensis
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000883.5	0.43	other (other)	arginomycin	Streptomyces arginensis
BGC0001647.3	0.42	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001197.5	0.41	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.41	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001964.2	0.40	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.83	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001778.5	0.46	other (other)	showdomycin	Streptomyces showdoensis
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000883.5	0.43	other (other)	arginomycin	Streptomyces arginensis
BGC0001647.3	0.42	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001197.5	0.41	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001483.4	0.41	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001964.2	0.40	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.60 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.08 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.82 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.88 out of 27.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000008.1 - Region 4 - T1PKS

Download region GenBank file

Download region SVG

Location: 258,100 - 305,698 nt. (total: 47,599 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

AMK26_RS32045: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AMK26_RS32050: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AMK26_RS32055: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

AMK26_RS32080: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

AMK26_RS32100: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

AMK26_RS32110: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

AMK26_RS32120: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: aminotransferase methyltransferase

AMK26_RS32060: aminotransferase

smcogs: SMCOG1019: aminotransferase

AMK26_RS32185: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthase

AMK26_RS32125: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS32130: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.02 out of 26.85

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 30.30 out of 32.74

Confidence: strong

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 29.70 out of 30.98

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.68 out of 30.11

Confidence: medium

Additional weak hits (16):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.09 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.17 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.42 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.03 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.53 out of 26.85

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.80 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.20 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.00 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.99 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 258099 - 305698:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS32125: pk

PKS_AT (551..842): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 66.7%; CE-Malonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 114.1
Malonyl-CoA: 107.4
Methoxymalonyl-CoA: 106.9
Ethylmalonyl-CoA: 75.2
Propionyl-CoA: 65.9
Isobutyryl-CoA: 56.9
2-Methylbutyryl-CoA: 45.6
CHC-CoA: 45.3
trans-1,2-CPDA: 45.0
inactive: 44.9
Benzoyl-CoA: 38.6
Acetyl-CoA: 35.2
fatty_acid: 23.2
3-Methylbutyryl-CoA: 18.6

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
FuR variant 2	Ferric Uptake Regulator
NuR	Nickel-responsive regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_LIYH01000008.1 - Region 5 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 333,373 - 404,834 nt. (total: 71,462 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: Cyclization Dioxygenation dehydrogenase methyltransferase oxidoreductase oxygenase

AMK26_RS32460: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK26_RS32490: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

AMK26_RS32565: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK26_RS32575: Dioxygenation

MITE: MITE0000096Dioxygenation (identity: 100.00%)
smcogs: SMCOG1042: O-methyltransferase

AMK26_RS32580: Cyclization

MITE: MITE0000095Cyclization (identity: 100.00%)

AMK26_RS32585: Dioxygenation

MITE: MITE0000094Dioxygenation (identity: 100.00%)

AMK26_RS32590: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase methyltransferase

AMK26_RS32385: aminotransferase

smcogs: SMCOG1019: aminotransferase

AMK26_RS32535: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AMK26_RS32575: Dioxygenation

MITE: MITE0000096Dioxygenation (identity: 100.00%)
smcogs: SMCOG1042: O-methyltransferase

AMK26_RS35935: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: hydrolase

AMK26_RS32325: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

AMK26_RS32455: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: dehydratase

AMK26_RS32390: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

AMK26_RS32405: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK26_RS32545: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS35930: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.38	PKS	esperamicin	Actinomadura verrucosospora
BGC0000894.4	0.34	other (other)	citrinin	Monascus aurantiacus
BGC0001641.4	0.32	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.32	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.31	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.31	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.31	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002404.2	0.31	other (other)	falcarindiol	Solanum lycopersicum
BGC0002135.2	0.30	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.30	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.09 out of 23.79

Confidence: medium

Additional weak hits (11):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.19 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.79 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.36 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.80 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.75 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.67 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.39 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.95 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.70 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 333372 - 404834:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 358504 - 404834:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS35930: X

AMP-binding (396..822): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: SARSFDSSVAGGLCTVAGEVNEYGPTEATVWASY
Nearest Stachelhaus code(s):: His DSALIAEVWK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMK26_RS32545: mal

PKS_AT (623..856): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 62.5%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 72.9
Methoxymalonyl-CoA: 36.4
Methylmalonyl-CoA: 35.0
inactive: 32.6
fatty_acid: 24.1
2-Methylbutyryl-CoA: 14.7
Ethylmalonyl-CoA: 11.6
Propionyl-CoA: 9.3
CHC-CoA: 8.4
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_LIYH01000009.1 - Region 1 - NRPS-like,melanin

Download region GenBank file

Download region SVG

Location: 18,100 - 60,652 nt. (total: 42,553 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AMK26_RS32820: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acetyltransferase acyltransferase

AMK26_RS32830: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

AMK26_RS32870: acyltransferase

smcogs: SMCOG1141: acyltransferase

Ligases: ligase

AMK26_RS32890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

AMK26_RS32885: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	1.02	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	1.01	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.59	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.56	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.54	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.28	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.27	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.26	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001250.4	0.26	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.26	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.79	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0000662.5	0.48	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.47	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000866.5	0.47	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.90 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.11 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (13):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.23 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.62 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.44 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.80 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.44 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.89 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.72 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.44 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 18099 - 60652:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS32890: X

AMP-binding (15..380): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NSILYGLSV--SAGTQAGGFVMYGQTEATARMAY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIYH01000009.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 155,595 - 200,097 nt. (total: 44,503 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AMK26_RS33540: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS33570: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

AMK26_RS33585: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: methyltransferase transferase

AMK26_RS33390: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

AMK26_RS33470: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

AMK26_RS33590: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: dehydratase

AMK26_RS33385: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AMK26_RS33395: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

AMK26_RS33490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS33495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.74 out of 27.04

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.74 out of 20.01

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.12 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.15 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 155594 - 200097:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AMK26_RS33490: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (40..441): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGSAWDGFTLEGWLLTGGETNGYGPVETCVFTTA
Nearest Stachelhaus code(s):: Val DALWLGGVFK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMK26_RS33495: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (494..895): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWQAFDVAFQEAFVITAGEENQYGPSETHVVTAH
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_LIYH01000009.1 - Region 3 - PKS-like,T2PKS,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 211,914 - 303,666 nt. (total: 91,753 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

AMK26_RS33655: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AMK26_RS33665: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AMK26_RS33685: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

AMK26_RS33750: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AMK26_RS33855: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AMK26_RS33925: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS33945: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK26_RS33970: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

AMK26_RS33975: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

AMK26_RS33980: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

AMK26_RS33990: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AMK26_RS34010: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

AMK26_RS34045: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

AMK26_RS34055: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK26_RS34060: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: PPTase acylase aminotransferase glycosyltransferase methyltransferase transferase

AMK26_RS33745: methyltransferase

smcogs: SMCOG1089: methyltransferase

AMK26_RS33795: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AMK26_RS33815: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AMK26_RS33850: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AMK26_RS33885: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

AMK26_RS33905: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

AMK26_RS33915: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

AMK26_RS38640: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Lyases: cyclase dehydratase

AMK26_RS33875: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

AMK26_RS33890: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AMK26_RS33950: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

AMK26_RS33690: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AMK26_RS33735: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

AMK26_RS33805: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AMK26_RS33810: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK26_RS33860: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK26_RS33955: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.75	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.62	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.60	PKS	oviedomycin	Streptomyces antibioticus
BGC0002277.2	0.58	NRPS	atromentin	Suillus grevillei
BGC0000275.4	0.56	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000272.3	0.56	PKS	spore pigment	Streptomyces collinus
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001833.4	0.54	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002154.2	0.53	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.67	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002277.2	0.62	NRPS	atromentin	Suillus grevillei
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0000278.3	0.61	PKS	urdamycin	Streptomyces fradiae
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000234.5	0.60	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001163.3	0.59	PKS	1-heptadecene	Moorea producens 3L

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.93 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

Additional weak hits (15):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.62 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.74 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.00 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.48 out of 32.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.18 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.79 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.83 out of 23.43

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.42 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.81 out of 26.12

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

RREFinder

Type II PKS

TFBS Finder

Azole RiPPs

NRPS/PKS substrate predictions

AMK26_RS33795: mal

PKS_AT (242..522): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 69.5
Methoxymalonyl-CoA: 43.6
Methylmalonyl-CoA: 42.1
Propionyl-CoA: 30.8
inactive: 21.6
Ethylmalonyl-CoA: 9.1
Acetyl-CoA: 8.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
Isobutyryl-CoA: -2.3

AMK26_RS33850: mal

PKS_AT (95..377): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 123.5
Methoxymalonyl-CoA: 79.0
inactive: 75.2
Methylmalonyl-CoA: 73.5
Propionyl-CoA: 38.7
Isobutyryl-CoA: 33.9
Ethylmalonyl-CoA: 32.2
2-Methylbutyryl-CoA: 22.7
trans-1,2-CPDA: 11.5
Acetyl-CoA: 9.0
CHC-CoA: 7.5
fatty_acid: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AMK26_RS33860: NH2

CAL_domain (40..470): NH2

minowa: NH2

Prediction, score:

NH2: 157.9
Acetyl-CoA: 65.4
fatty_acid: 39.3
AHBA: 11.6
shikimic_acid: 0.0

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 6 - 105; Score: 71.5; RRE type: NHLP_CD_RRE; Location: 5 - 100; Score: 52.6; RRE type: Cyanobactin_D_RRE; Location: 3 - 80; Score: 49.1

Type II PKS gene cluster prediction details

Cluster section:: 211913 to 284396
Starter unit(s):: 2-methylbutyryl-CoA (Score: 750.0; E-value: 5.79e-164)
propionyl-CoA (Score: 149.0; E-value: 1.08e-44)
Malonyl elongations:: 8|9 (Score: 668.9; E-value: 5.2e-204)
Product class(es):: angucycline
anthracycline
aureolic acid
tetracycline
Product molecular weight(s):: 2-methylbutyryl-CoA_8: 585 Da
2-methylbutyryl-CoA_9: 627 Da
propionyl-CoA_8: 557 Da
propionyl-CoA_9: 599 Da

AMK26_RS33795: AT (Score: 416.3; E-value: 2e-127); AT ADB23379.1_TLN-05220/TLN-05223_2-methylbutyryl-CoA (Score: 298.0; E-value: 2.61e-96)
AMK26_RS33800: ACP (Score: 112.3; E-value: 1.9e-35)
AMK26_RS33805: CLF 8|9 (Score: 668.9; E-value: 5.2e-204)
AMK26_RS33810: KS (Score: 754.3; E-value: 7.2e-230)
AMK26_RS33850: AT (Score: 198.0; E-value: 4.8e-61); AT ABC00730.1_Cosmomycin_propionyl-CoA (Score: 149.0; E-value: 1.08e-44)
AMK26_RS33875: CYC C7-C12 (Score: 455.1; E-value: 2.2e-139)
AMK26_RS33905: GT (Score: 358.5; E-value: 1.4e-109)
AMK26_RS33955: KSIII (Score: 454.3; E-value: 6e-139); KSIII AKT74268.1_Trioxacarcin_2-methylbutyryl-CoA (Score: 452.0; E-value: 5.79e-164)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
RpoN	Regulator of nitrogen assimilation and virulence

Core peptide predictions

No core peptides found.