GCF_001905825.1 - 40 region(s)

Download region SVG

Location: 358,062 - 397,821 nt. (total: 39,760 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

AMK27_RS01735: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: methyltransferase

AMK27_RS01690: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase

AMK27_RS01740: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.98 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.72 out of 27.04

Confidence: medium

Additional weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.36 out of 21.55

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 358061 - 397821:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS01740: X

AMP-binding (20..492): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QAQLHVFGNALGASIFLWA-------ETVVATGR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AMK27_RS01755: X

AMP-binding (43..418): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor

NZ_LIVV01000001.1 - Region 2 - lanthipeptide-class-ii,terpene

Download region SVG

Location: 399,014 - 432,062 nt. (total: 33,049 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AMK27_RS01855: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: hydrolase

AMK27_RS01820: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

AMK27_RS01860: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

AMK27_RS01905: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.93	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000518.3	0.25	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000908.3	0.24	other (other)	melanin	Streptomyces avermitilis
BGC0001572.3	0.24	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000525.5	0.18	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000554.4	0.17	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002434.2	0.16	NRPS, PKS	clifednamide D, clifednamide E, clifednamide F, clifednamide G, clifednamide H, clifednamide I, clifednamide J	Kitasatospora sp.
BGC0001468.5	0.16	other (trna-derived)	bicyclomycin	Streptomyces cinnamoneus
BGC0001441.5	0.16	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0001210.5	0.15	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.76	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001210.5	0.46	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000626.3	0.45	ribosomal	thuricin	Bacillus thuringiensis
BGC0000516.4	0.45	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0000517.4	0.45	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001910.4	0.44	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000527.5	0.44	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000518.3	0.44	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AMK27_RS01860: T1TS

Domain 1 (8 - 336): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

Additional weak hits (12):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.96 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.40 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.22 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.18 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.61 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.43 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.57 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.92 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.32 out of 27.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.87 out of 32.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

Lanthipeptides

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_LIVV01000001.1 - Region 3 - terpene

Download region SVG

Location: 707,686 - 729,884 nt. (total: 22,199 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase hydratase

AMK27_RS03145: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

AMK27_RS03185: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

AMK27_RS03215: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000658.3	0.56	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001972.4	0.33	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000711.5	0.32	saccharide	neomycin	Streptomyces fradiae
BGC0000709.5	0.32	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000252.5	0.31	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0002196.2	0.30	PKS	clavatol	Penicillium crustosum
BGC0000143.5	0.30	PKS	salinomycin	Streptomyces albus
BGC0002657.2	0.27	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000109.5	0.26	PKS	LL-F28249α	Streptomyces cyaneogriseus subsp. noncyanogenus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000658.3	0.56	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001972.4	0.33	other (other)	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0000711.5	0.32	saccharide	neomycin	Streptomyces fradiae
BGC0000709.5	0.32	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000252.5	0.31	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0002196.2	0.30	PKS	clavatol	Penicillium crustosum
BGC0000143.5	0.30	PKS	salinomycin	Streptomyces albus
BGC0002657.2	0.27	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000109.5	0.26	PKS	LL-F28249α	Streptomyces cyaneogriseus subsp. noncyanogenus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

AMK27_RS03185: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (335 - 695): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.63 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.75 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.20 out of 27.04

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.10 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000001.1 - Region 4 - ectoine

Download region SVG

Location: 769,387 - 779,803 nt. (total: 10,417 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

AMK27_RS03435: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.84	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.84	other (ectoine)	ectoine	Streptomyces sp.
BGC0000856.3	0.71	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.84	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.84	other (ectoine)	ectoine	Streptomyces sp.
BGC0000856.3	0.71	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (2):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000001.1 - Region 5 - NRPS,T1PKS,terpene-precursor

Download region SVG

Location: 970,605 - 1,027,144 nt. (total: 56,540 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AMK27_RS04370: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK27_RS04375: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: methyltransferase

AMK27_RS04540: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: protease

AMK27_RS04400: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Isomerases: racemase

AMK27_RS04345: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

AMK27_RS04365: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase synthetase

AMK27_RS04430: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK27_RS04510: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000622.5	0.36	ribosomal	megacin	Bacillus megaterium
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000622.5	0.50	ribosomal	megacin	Bacillus megaterium
BGC0000595.3	0.46	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0001161.5	0.46	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001162.3	0.46	PKS	1-heptadecene	Moorea producens JHB

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AMK27_RS04510: PT_FPPS_like

Domain 1 (48 - 344): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.49 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.07 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.64 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.90 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.78 out of 27.04

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.19 out of 23.43

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.65 out of 20.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 970604 - 1027144:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - ohmal - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 970604 - 1023804:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - ohmal - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS04430: fatty_acid - mal - X

CAL_domain (148..459): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 42.1
NH2: 38.5
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1355..1645): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Ethylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 125.5
Methylmalonyl-CoA: 72.3
Methoxymalonyl-CoA: 67.9
Ethylmalonyl-CoA: 47.3
CHC-CoA: 45.4
inactive: 42.0
Propionyl-CoA: 36.5
Isobutyryl-CoA: 30.3
2-Methylbutyryl-CoA: 26.5
trans-1,2-CPDA: 22.8
fatty_acid: 22.5
Benzoyl-CoA: 9.5
Acetyl-CoA: 7.6
3-Methylbutyryl-CoA: 4.4

AMP-binding (2834..3259): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWAAFDASVRQASSHVGGEANLYGPTESTINATF
Nearest Stachelhaus code(s):: Gln DACSTGVINK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000001.1 - Region 6 - hydrogen-cyanide

Download region SVG

Location: 1,073,636 - 1,086,635 nt. (total: 13,000 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

AMK27_RS04780: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AMK27_RS04790: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

AMK27_RS04805: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acetyltransferase

AMK27_RS04810: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: deaminase

AMK27_RS04775: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001865.4	0.33	PKS	elsinochrome C	Parastagonospora nodorum SN15
BGC0001057.4	0.32	NRPS, PKS	zearalenone	Fusarium graminearum
BGC0001108.5	0.32	NRPS, PKS	pederin, pseudopederin, pederone	Uncultured bacterium
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002083.3	0.31	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0002169.3	0.31	NRPS, PKS	acurin A	Aspergillus aculeatus ATCC 16872
BGC0000154.4	0.30	PKS	stipitatic acid	Talaromyces stipitatus ATCC 10500
BGC0002556.2	0.30	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001865.4	0.33	PKS	elsinochrome C	Parastagonospora nodorum SN15
BGC0001057.4	0.32	NRPS, PKS	zearalenone	Fusarium graminearum
BGC0001108.5	0.32	NRPS, PKS	pederin, pseudopederin, pederone	Uncultured bacterium
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002083.3	0.31	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0002169.3	0.31	NRPS, PKS	acurin A	Aspergillus aculeatus ATCC 16872
BGC0000154.4	0.30	PKS	stipitatic acid	Talaromyces stipitatus ATCC 10500
BGC0002556.2	0.30	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.30 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.06 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.29 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.28 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000001.1 - Region 7 - lanthipeptide-class-iii

Download region SVG

Location: 1,131,829 - 1,154,525 nt. (total: 22,697 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase hydrolase

AMK27_RS05060: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

AMK27_RS05155: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

AMK27_RS05095: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000757.3	0.47	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000756.3	0.46	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0002700.2	0.45	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000737.3	0.43	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000789.3	0.43	saccharide	O-antigen	Escherichia coli
BGC0002111.3	0.42	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000752.3	0.40	saccharide	capsular polysaccharide	Actinobacillus pleuropneumoniae serovar 6 str. Femo
BGC0002701.2	0.40	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0000739.3	0.40	saccharide	capsular polysaccharide	Pasteurella multocida

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000757.3	0.47	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000756.3	0.46	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0002700.2	0.45	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000737.3	0.43	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000789.3	0.43	saccharide	O-antigen	Escherichia coli
BGC0002111.3	0.42	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000752.3	0.40	saccharide	capsular polysaccharide	Actinobacillus pleuropneumoniae serovar 6 str. Femo
BGC0002701.2	0.40	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0000739.3	0.40	saccharide	capsular polysaccharide	Pasteurella multocida

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (8):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.96 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.13 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.09 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.65 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.53 out of 26.85

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism

NZ_LIVV01000001.1 - Region 8 - CDPS

Download region SVG

Location: 1,206,191 - 1,226,961 nt. (total: 20,771 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000496.5	0.37	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.36	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001862.4	0.35	ribosomal	pallidocin	Aeribacillus pallidus
BGC0001864.3	0.34	ribosomal	listeriocytocin	Listeria monocytogenes SLCC2540
BGC0000516.4	0.33	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0002116.3	0.32	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0001210.5	0.32	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000527.5	0.31	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001468.5	0.31	other (trna-derived)	bicyclomycin	Streptomyces cinnamoneus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000496.5	0.37	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.36	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001862.4	0.35	ribosomal	pallidocin	Aeribacillus pallidus
BGC0001864.3	0.34	ribosomal	listeriocytocin	Listeria monocytogenes SLCC2540
BGC0000516.4	0.33	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0002116.3	0.32	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0001210.5	0.32	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000527.5	0.31	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001468.5	0.31	other (trna-derived)	bicyclomycin	Streptomyces cinnamoneus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.84 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.89 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.46 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.11 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.06 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.52 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.28 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LIVV01000001.1 - Region 9 - terpene

Download region SVG

Location: 1,274,403 - 1,295,293 nt. (total: 20,891 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK27_RS05730: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

AMK27_RS05755: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

AMK27_RS05760: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001444.5	0.36	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001850.4	0.36	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001940.3	0.35	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0000101.5	0.35	PKS	emodin, monodictyphenone, shamixanthone	Aspergillus nidulans FGSC A4
BGC0002062.2	0.34	PKS	agnestin A, agnestin B	Paecilomyces divaricatus
BGC0002726.2	0.34	PKS	4-chloropinselin, pinselin, chloromonilinic acid B, chloromonilinic acid D, 4-hydroxyvertixanthone	Bipolaris sorokiniana
BGC0001596.3	0.33	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000391.5	0.33	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0002477.3	0.32	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001444.5	0.36	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001850.4	0.36	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001940.3	0.35	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0000101.5	0.35	PKS	emodin, monodictyphenone, shamixanthone	Aspergillus nidulans FGSC A4
BGC0002062.2	0.34	PKS	agnestin A, agnestin B	Paecilomyces divaricatus
BGC0002726.2	0.34	PKS	4-chloropinselin, pinselin, chloromonilinic acid B, chloromonilinic acid D, 4-hydroxyvertixanthone	Bipolaris sorokiniana
BGC0001596.3	0.33	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000391.5	0.33	NRPS	methylpendolmycin, pendolmycin	Marinactinospora thermotolerans
BGC0002477.3	0.32	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

AMK27_RS05720: PT_phytoene_like

Domain 1 (16 - 272): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.40 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.11 out of 28.19

Confidence: medium

Additional weak hits (6):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.55 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.33 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.92 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.35 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ZuR variant 1	Zinc-responsive repressor

NZ_LIVV01000001.1 - Region 10 - NRPS-like,T1PKS

Download region SVG

Location: 1,375,525 - 1,441,490 nt. (total: 65,966 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: formyltransferase glycosyltransferase halogenase

AMK27_RS06200: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

AMK27_RS06225: halogenase

smcogs: SMCOG1119: halogenase

AMK27_RS06235: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: esterase

AMK27_RS06285: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

AMK27_RS06245: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK27_RS41125: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

AMK27_RS43470: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.91	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.91	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.90	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002175.3	0.56	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.56	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.13 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.28 out of 27.04

Confidence: medium

Additional weak hits (9):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.35 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.17 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.66 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.70 out of 26.85

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.66 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 14, location 1375524 - 1441490:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - ccmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS06235: Gly - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (599..983): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAITFDISLLELQALSGGEWNLYGPTEATIWAAA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (2835..3125): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 123.3
inactive: 64.2
Methoxymalonyl-CoA: 58.4
Methylmalonyl-CoA: 46.3
fatty_acid: 34.6
Propionyl-CoA: 31.3
Ethylmalonyl-CoA: 27.0
Isobutyryl-CoA: 22.5
2-Methylbutyryl-CoA: 10.6
Benzoyl-CoA: 10.2
Acetyl-CoA: 5.8
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AMK27_RS06245: mal

PKS_AT (1799..2091): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 117.8
inactive: 58.5
Methoxymalonyl-CoA: 51.1
Methylmalonyl-CoA: 41.1
fatty_acid: 34.2
Propionyl-CoA: 28.8
Ethylmalonyl-CoA: 26.5
Isobutyryl-CoA: 17.2
Acetyl-CoA: 11.0
Benzoyl-CoA: 10.8
2-Methylbutyryl-CoA: 9.1
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000011.1 - Region 1 - CDPS

Download region SVG

Location: 1 - 18,194 nt. (total: 18,194 nt) Show pHMM detection rules used

Region on contig edge.

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AMK27_RS34695: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK27_RS34725: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: aminotransferase

AMK27_RS34720: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: dehalogenase

AMK27_RS34710: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001986.3	0.58	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001948.3	0.51	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002458.3	0.51	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002482.2	0.40	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0002582.3	0.39	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0002000.4	0.39	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001986.3	0.58	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001948.3	0.51	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002458.3	0.51	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002482.2	0.40	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0002582.3	0.39	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0002000.4	0.39	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (10):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.68 out of 32.74

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 39.62

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.41 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.00 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.63 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.02 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.72 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.93 out of 23.43

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein

NZ_LIVV01000012.1 - Region 1 - lanthipeptide-class-iv,terpene

Download region SVG

Location: 147,661 - 172,935 nt. (total: 25,275 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

AMK27_RS37060: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.54	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.50	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.46	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.45	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.45	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.41	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000504.5	0.31	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000518.3	0.31	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000500.5	0.30	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.60	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.59	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.56	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.56	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.55	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000563.4	0.53	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.53	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000518.3	0.47	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002306.2	0.47	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000504.5	0.46	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AMK27_RS37045

allorf_150684_150905

Leader:

MTLRIDVSRLLDVQAQSVPEDEDVRVAD

Core:

HSALAVVACHKTCMPRPTTADRVRARRVRLAPHIRPASHAGPSGE

Core with dehydrations:

HDhaALAVVACysHKDhbCysMPRPDhbDhbADRVRARRVRLAPHIRPADhaHAGPDhaGE

antiSMASH-DB 4.0 matches for allorf_150684_150905

100.0%

NZ_LIVV01000012.1:

Lanthipeptides: allorf_150684_150905_lanthipeptide

1

HSALAVVACHKTCMPRPTTADRVRARRVRLAPHIRPASHAGPSGE

45

HSALAVVACHKTCMPRPTTADRVRARRVRLAPHIRPASHAGPSGE

1

HSALAVVACHKTCMPRPTTADRVRARRVRLAPHIRPASHAGPSGE

45

22.2%

NZ_PUPX01000001.1:

Lanthipeptides: allorf_1091992_1092165_lanthipeptide

16

RPTTADRVRARRVRLAPHIRPASHAGPSG

44

+P T R+ R+ IRPA P+G

5

QPCTLGRLLITVGRIKLIIRPAGDQLPTG

33

20.0%

NZ_CP020570.1and 15 others:

NZ_CP020570.1 Lanthipeptides: allorf_2516141_2516284_lanthipeptideNZ_CP020570.1 Lanthipeptides: allorf_2516141_2516284_lanthipeptideNZ_CP070242.1 Lanthipeptides: allorf_2528027_2528170_lanthipeptideNZ_CP070242.1 Lanthipeptides: allorf_2528027_2528170_lanthipeptideNZ_CP070242.1 Lanthipeptides: allorf_2528027_2528170_lanthipeptideNZ_CP070260.1 Lanthipeptides: allorf_5476524_5476667_lanthipeptideNZ_CP070260.1 Lanthipeptides: allorf_5476524_5476667_lanthipeptideNZ_CP070260.1 Lanthipeptides: allorf_5476524_5476667_lanthipeptideNZ_CP070260.1 Lanthipeptides: allorf_5476524_5476667_lanthipeptideNZ_JAJDST010000044.1 Lanthipeptides: allorf_029750_029893_lanthipeptideNZ_JAJDST010000044.1 Lanthipeptides: allorf_029750_029893_lanthipeptideNZ_JAJDST010000044.1 Lanthipeptides: allorf_029750_029893_lanthipeptideNZ_WWGL01000034.1 Lanthipeptides: allorf_1026403_1026546_lanthipeptideNZ_WWGL01000034.1 Lanthipeptides: allorf_1026403_1026546_lanthipeptideNZ_WWGL01000034.1 Lanthipeptides: allorf_1026403_1026546_lanthipeptide

Lanthipeptides: allorf_2516141_2516284_lanthipeptide

14

MPRPTTADRVRARRVRLAPH

33

M P RVR R++R+AP

1

MGAPGGFGRVRGRKMRVAPR

20

with 3 more sequence matches

20.0%

NZ_CP058556.1and 4 others:

NZ_CP058556.1 Lanthipeptides: allorf_5603706_5603849_lanthipeptideNZ_CP058556.1 Lanthipeptides: allorf_5603706_5603849_lanthipeptideNZ_CP058556.1 Lanthipeptides: allorf_5603706_5603849_lanthipeptideNZ_CP059898.1 Lanthipeptides: allorf_2457020_2457163_lanthipeptide

Lanthipeptides: allorf_5603706_5603849_lanthipeptide

14

MPRPTTADRVRARRVRLAPH

33

M P RVR R++R AP

1

MGAPGGFGRVRGRKMRAAPR

20

15.6%

NZ_CP019687.1and 1 other:

NZ_CP019717.1 Lanthipeptides: ERICV_RS20670_lanthipeptide

Lanthipeptides: BXP28_RS22835_lanthipeptide

1

HSALAVVACHKTCMPR

16

H AL V +K PR

12

HEALEVKTAYKDWFPR

27

15.0%

NZ_FNPT01000004.1:

Lanthipeptides: allorf_345034_345240_lanthipeptide

13

CMPRPTTADRVRARRVRLAPHIRP

36

C PR D + RVR+A + P

29

CPPRRVAPDTITTERVRIASDLHP

52

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Chain length	Initial cyclisations	Functional groups
sesquiterpene	C15	C1-C6	none
diterpene	C20	C1-C6	none
diterpene	C20	C1-C7 + C6-C10	none
sesterterpene	C25	C1-C7 + C6-C10	none

Genes with terpene domains:

AMK27_RS37055: TS_UbiA

Domain 1 (3 - 265): UbiA type terpene synthase

Reactions:: FPP → sesquiterpene_C1-C6; GGPP → diterpene_C1-C6; GGPP → diterpene_C1-C7/C6-C10; GFPP → sesterterpene_C1-C7/C6-C10

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

Additional weak hits (6):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.22 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.04 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Lanthipeptides

Terpene

TFBS Finder

Core peptide predictions

allorf_150684_150905 - Class III

Cleavage pHMM score: -1.00

RODEO score: 0

Monoisotopic mass: 4727.5 Da

Molecular weight: 4730.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4748.5 Da N = 1; 4766.5 Da N = 2; 4784.5 Da N = 3; 4802.5 Da N = 4

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000013.1 - Region 1 - terpene-precursor

Download region SVG

Location: 18,145 - 39,206 nt. (total: 21,062 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AMK27_RS37340: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AMK27_RS37360: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Ligases: synthetase

AMK27_RS37315: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transporter

AMK27_RS37290: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000688.4	0.39	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000688.4	0.39	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AMK27_RS37315: PT_FPPS_like

Domain 1 (62 - 349): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (6):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.48 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.70 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.42 out of 23.43

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.94 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.75 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsR	Pleiotropic regulatory for antibiotic production

NZ_LIVV01000013.1 - Region 2 - terpene

Download region SVG

Location: 51,239 - 78,823 nt. (total: 27,585 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK27_RS37510: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

AMK27_RS37520: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

AMK27_RS37515: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.76	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.70	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.64	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.64	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.63	terpene	isorenieratene	Streptomyces argillaceus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000640.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.76	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.70	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.64	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.64	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.63	terpene	isorenieratene	Streptomyces argillaceus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000640.3	0.51	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

AMK27_RS37490: Lycopene_cycl

Domain 1 (4 - 379): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

AMK27_RS37505: PT_phytoene_like

Domain 1 (16 - 315): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

AMK27_RS37515: PT_FPPS_like

Domain 1 (48 - 359): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.37 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.12 out of 36.54

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.85 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.03 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.67 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_LIVV01000014.1 - Region 1 - NRPS-like,T1PKS,arylpolyene,butyrolactone,other

Download region SVG

Location: 7,592 - 123,151 nt. (total: 115,560 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
butyrolactone: AfsA
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

AMK27_RS38015: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK27_RS38065: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

AMK27_RS38070: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

AMK27_RS38120: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

AMK27_RS38130: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

AMK27_RS38140: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

AMK27_RS38150: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK27_RS38155: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

AMK27_RS38195: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK27_RS38245: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

AMK27_RS38275: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK27_RS38325: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

AMK27_RS38335: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

AMK27_RS38380: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AMK27_RS38390: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AMK27_RS38415: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

Transferases: acyltransferase methyltransferase

AMK27_RS38115: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AMK27_RS38175: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

AMK27_RS38190: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AMK27_RS38240: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase phosphatase

AMK27_RS38180: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AMK27_RS38320: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

AMK27_RS38400: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: dehydratase lyase

AMK27_RS38285: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

AMK27_RS38300: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

AMK27_RS38305: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

AMK27_RS38315: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: isomerase

AMK27_RS38210: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

AMK27_RS38055: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK27_RS38160: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK27_RS38170: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK27_RS38215: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

AMK27_RS38265: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK27_RS38290: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AMK27_RS38340: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK27_RS38345: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK27_RS38405: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Translocases: transport transporter

AMK27_RS38185: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

AMK27_RS38230: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.95	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.67	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002347.3	0.60	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0002031.3	0.55	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0001596.3	0.53	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0000274.5	0.53	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0002478.3	0.53	PKS	rubiginone A2, rubiginone J, rubiginone K, rubiginone L, rubiginone M, rubiginone N, ochromycinone, rubiginone B2	Streptomyces sp. CB02414
BGC0001335.5	0.53	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0000279.5	0.51	PKS	xantholipin	Streptomyces flavogriseus
BGC0000632.5	0.51	saccharide, terpene	brasilicardin A	Nocardia terpenica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.81 out of 18.57

Confidence: medium

Additional weak hits (16):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.57 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.77 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.01 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.05 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.98 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.43 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.88 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.96 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.29 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.76 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.33 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.71 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 7591 - 123151:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 36230 - 78015:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS38055: mal

PKS_AT (620..845): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Propionyl-CoA: 58.3%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 76.1
Methoxymalonyl-CoA: 51.0
Methylmalonyl-CoA: 47.0
inactive: 34.5
Isobutyryl-CoA: 28.0
Ethylmalonyl-CoA: 20.4
Propionyl-CoA: 20.0
fatty_acid: 12.9
trans-1,2-CPDA: 10.5
2-Methylbutyryl-CoA: 9.1
Benzoyl-CoA: 7.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AMK27_RS38170: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (13..408): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDSAFGVSTYEVHVLTGGDRAMYGATEVSSFAAY
Nearest Stachelhaus code(s):: ohMan NVYHLGMVFK (76% 8Å match); Hpg NVYHLGMLFK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMK27_RS38205: X

AMP-binding (102..333): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SRMPFGDVFTAGVCLVLGERALYGSQEALCIATG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AMK27_RS38220: X

AMP-binding (90..284): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSHA---FWGMAGLLAGAEFNAAGTTEFGGVFMF
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AMK27_RS38265: X

AMP-binding (18..387): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SRMG------SFYSVVAGELNVYGTTEIGHALLA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AMK27_RS38340: X

AMP-binding (101..353): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QATLYGYSVLSRDGGCGGDHDGYGLSEAGPNVAL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis

NZ_LIVV01000002.1 - Region 1 - T2PKS,azole-containing-RiPP

Download region SVG

Location: 1 - 40,217 nt. (total: 40,217 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AMK27_RS07445: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK27_RS07465: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

AMK27_RS07485: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AMK27_RS07590: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

AMK27_RS07600: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: PPTase acylase aminotransferase glycosyltransferase transferase

AMK27_RS07425: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AMK27_RS07460: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

AMK27_RS07550: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

AMK27_RS07560: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

AMK27_RS07565: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

AMK27_RS07580: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: hydrolase

AMK27_RS07510: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: cyclase dehydratase

AMK27_RS07450: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

AMK27_RS07570: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AMK27_RS07575: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

AMK27_RS07430: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK27_RS07435: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AMK27_RS07595: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000195.5	0.47	PKS	alnumycin A, alnumycin B, alnumycin C, alnumycin P, prealnumycin, thalnumycin A, thalnumycin B, K1115A, 1,6-dihydro-8-propylanthraquinone	Streptomyces sp. CM020
BGC0000813.3	0.40	other (other)	K-252a	Nonomuraea longicatena
BGC0000277.5	0.40	PKS	urdamycin	Streptomyces fradiae
BGC0000278.3	0.38	PKS	urdamycin	Streptomyces fradiae
BGC0000827.3	0.38	other (other)	staurosporine	Salinispora arenicola CNS-205
BGC0002361.3	0.37	PKS, saccharide	baikalomycin B, baikalomycin A, baikalomycin C	Streptomyces sp. IB201691-2A2
BGC0000791.3	0.35	saccharide	O-antigen	Cronobacter sakazakii
BGC0000790.3	0.35	saccharide	O-antigen	Escherichia coli
BGC0000826.5	0.35	other (other)	staurosporine	Streptomyces clavuligerus ATCC 27064
BGC0000825.5	0.35	other (other)	staurosporine	Streptomyces sp. TP-A0274

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000278.3	0.71	PKS	urdamycin	Streptomyces fradiae
BGC0000231.5	0.67	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.66	PKS	oviedomycin	Streptomyces antibioticus
BGC0000195.5	0.65	PKS	alnumycin A, alnumycin B, alnumycin C, alnumycin P, prealnumycin, thalnumycin A, thalnumycin B, K1115A, 1,6-dihydro-8-propylanthraquinone	Streptomyces sp. CM020
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000253.4	0.58	PKS	oviedomycin	Streptomyces antibioticus
BGC0002000.4	0.58	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.79 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (9):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.12 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.99 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.08 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.49 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.40 out of 28.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.49 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.19 out of 28.14

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

RREFinder

Type II PKS

TFBS Finder

Azole RiPPs

NRPS/PKS substrate predictions

AMK27_RS07425: mal

PKS_AT (8..297): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.0
Methylmalonyl-CoA: 43.9
Methoxymalonyl-CoA: 42.6
inactive: 21.4
Propionyl-CoA: 20.2
Benzoyl-CoA: 8.4
Ethylmalonyl-CoA: 7.1
CHC-CoA: 4.1
2-Methylbutyryl-CoA: 1.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 0 - 92; Score: 48.1; RRE type: Cyanobactin_D_RRE; Location: 1 - 69; Score: 46.6; RRE type: NHLP_CD_RRE; Location: 0 - 88; Score: 41.6

Type II PKS gene cluster prediction details

Cluster section:: 0 to 40217
Starter unit(s):: butyryl-CoA (Score: 696.0; E-value: 1.99e-172)
Malonyl elongations:: 7 (Score: 686.1; E-value: 3.1e-209)
Product class(es):: benzoisochromanequinone
Product molecular weight(s):: butyryl-CoA_7: 697 Da

AMK27_RS07420: ACP (Score: 76.0; E-value: 4.1e-24)
AMK27_RS07425: AT (Score: 372.5; E-value: 4.2e-114); AT AAC18106.1_Frenolicin_butyryl-CoA (Score: 223.0; E-value: 1.92e-73)
AMK27_RS07430: KS (Score: 778.0; E-value: 4.7e-237)
AMK27_RS07435: CLF 7 (Score: 686.1; E-value: 3.1e-209)
AMK27_RS07440: ACP (Score: 100.9; E-value: 6.7e-32)
AMK27_RS07445: KR C9 (Score: 460.5; E-value: 3.4e-141)
AMK27_RS07450: CYC C7-C12 (Score: 316.8; E-value: 2.7e-97)
AMK27_RS07455: CYC C5-C14 (Score: 448.8; E-value: 1.9e-137)
AMK27_RS07485: KR (Score: 158.3; E-value: 6.5e-49)
AMK27_RS07550: GT (Score: 413.3; E-value: 3e-126)
AMK27_RS07560: GT (Score: 421.3; E-value: 1.1e-128)
AMK27_RS07595: KSIII (Score: 414.8; E-value: 6.2e-127); KSIII ACI88883.1_Alnumycin_butyryl-CoA (Score: 473.0; E-value: 1.99e-172)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_LIVV01000002.1 - Region 2 - terpene

Download region SVG

Location: 176,777 - 203,395 nt. (total: 26,619 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK27_RS08250: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

AMK27_RS08290: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase transferase

AMK27_RS08245: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

AMK27_RS08315: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Ligases: synthetase

AMK27_RS08295: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.71	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.71	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

AMK27_RS08280: PT_phytoene_like

Domain 1 (19 - 294): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

AMK27_RS08285: PT_phytoene_like

Domain 1 (17 - 305): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

AMK27_RS08295: PT_FPPS_like

Domain 1 (72 - 364): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

AMK27_RS08300: T2TS

Domain 1 (42 - 669): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.69 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.58 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.44 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_LIVV01000002.1 - Region 3 - RiPP-like

Download region SVG

Location: 249,283 - 260,149 nt. (total: 10,867 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer

AMK27_RS08560: flavodoxin

smcogs: SMCOG1134: flavodoxin

AMK27_RS08580: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: hydrolase

AMK27_RS08590: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000249.5	0.40	PKS	nogalamycin	Streptomyces nogalater
BGC0000243.4	0.32	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001188.3	0.32	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0001882.3	0.31	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0001137.5	0.30	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0001203.4	0.29	NRPS, PKS	Clarexpoxcin A, Clarexpoxcin B, Clarexpoxcin C, Clarexpoxcin D, Clarexpoxcin E	uncultured bacterium AR_456
BGC0000335.4	0.26	NRPS, PKS	cystomanamide A, cystomanamide B, cystomanamide C, cystomanamide D	Cystobacter fuscus
BGC0000981.3	0.25	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E6
BGC0001942.3	0.24	NRPS, PKS	malonomycin	Streptomyces rimosus subsp. paromomycinus
BGC0001532.4	0.23	NRPS	bogorol A	Brevibacillus laterosporus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000249.5	0.40	PKS	nogalamycin	Streptomyces nogalater
BGC0000243.4	0.32	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001188.3	0.32	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0001882.3	0.31	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0001137.5	0.30	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0001203.4	0.29	NRPS, PKS	Clarexpoxcin A, Clarexpoxcin B, Clarexpoxcin C, Clarexpoxcin D, Clarexpoxcin E	uncultured bacterium AR_456
BGC0000335.4	0.26	NRPS, PKS	cystomanamide A, cystomanamide B, cystomanamide C, cystomanamide D	Cystobacter fuscus
BGC0000981.3	0.25	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E6
BGC0001942.3	0.24	NRPS, PKS	malonomycin	Streptomyces rimosus subsp. paromomycinus
BGC0001532.4	0.23	NRPS	bogorol A	Brevibacillus laterosporus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LIVV01000002.1 - Region 4 - lanthipeptide-class-iii

BGC0000553.3 (SSGG_RS09925):

Download region SVG

Location: 282,580 - 305,225 nt. (total: 22,646 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK27_RS08710: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.83	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.69	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.58	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000546.3	0.55	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.83	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.69	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.58	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000546.3	0.55	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AMK27_RS08705

AMK27_RS08700

Leader:

MNLFDLQSLETPKDEAIGDVE

Core:

TGSRASLLLCGDSSLSVTTCN

Core with dehydrations:

DhbGDhaRADhaLLLCysGDDhaDhaLDhaVDhbDhbCysN

antiSMASH-DB 4.0 matches for AMK27_RS08700

100.0%

NC_018750.1and 67 others:

NC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNZ_BBNO01000003.1 Lanthipeptides: TU31_RS37940_lanthipeptideNZ_BMTO01000007.1 Lanthipeptides: IE136_RS15615_lanthipeptideNZ_BMUN01000001.1 Lanthipeptides: IE238_RS00740_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS05015_lanthipeptideNZ_CP015866.1 Lanthipeptides: Spa2297_RS27800_lanthipeptideNZ_CP017157.1 Lanthipeptides: SL103_RS15895_lanthipeptideNZ_CP019457.1 Lanthipeptides: BXT88_RS03410_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS35355_lanthipeptideNZ_CP019779.1 Lanthipeptides: STRMOE7_RS03775_lanthipeptideNZ_CP023691.1 Lanthipeptides: CP981_RS03050_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS04700_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34970_lanthipeptideNZ_CP029042.1 Lanthipeptides: DDE74_RS03525_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029541.1 Lanthipeptides: DKG71_RS05245_lanthipeptideNZ_CP034353.1 Lanthipeptides: D1J63_RS04900_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35250_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS09720_lanthipeptideNZ_CP046905.1 Lanthipeptides: GPZ77_RS32930_lanthipeptideNZ_CP047140.1 Lanthipeptides: GLX30_RS11420_lanthipeptideNZ_CP050976.1 Lanthipeptides: HEP86_RS04470_lanthipeptideNZ_CP054920.1 Lanthipeptides: HUT15_RS04615_lanthipeptideNZ_CP060825.1 Lanthipeptides: IAG43_RS32355_lanthipeptideNZ_CP074111.1 Lanthipeptides: KE639_RS31630_lanthipeptideNZ_CP084681.1 Lanthipeptides: KI385_RS00885_lanthipeptideNZ_CP085300.1 Lanthipeptides: LJA35_RS05220_lanthipeptideNZ_CP086217.1 Lanthipeptides: LJ741_RS03435_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS09690_lanthipeptideNZ_CP098437.1 Lanthipeptides: NCG97_RS34740_lanthipeptideNZ_CP099468.1 Lanthipeptides: NFX46_RS16770_lanthipeptideNZ_CP101137.1 Lanthipeptides: M6G08_RS24535_lanthipeptideNZ_CP102609.1 Lanthipeptides: NUT86_RS03980_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33560_lanthipeptideNZ_CP114202.1 Lanthipeptides: STRLI_RS35870_lanthipeptideNZ_CP114203.1 Lanthipeptides: STRNI_RS37360_lanthipeptideNZ_CP114205.1 Lanthipeptides: STRTU_RS33380_lanthipeptideNZ_JACHJE010000006.1 Lanthipeptides: FHS32_RS15850_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00800_lanthipeptideNZ_JAFEJA010000002.1 Lanthipeptides: JE024_RS34830_lanthipeptideNZ_JAGPYC010000033.1 Lanthipeptides: KBZ00_RS31440_lanthipeptideNZ_JAHLXF010000022.1 Lanthipeptides: KQY13_RS30555_lanthipeptideNZ_JAIHBQ010000001.1 Lanthipeptides: K4902_RS04515_lanthipeptideNZ_JAJJMU010000026.1 Lanthipeptides: LOC25_RS31275_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAPKNL010000004.1 Lanthipeptides: OSI21_RS07750_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0131905_lanthipeptideNZ_KN039948.1 Lanthipeptides: FM21_RS29525_lanthipeptideNZ_LIPF01000004.1 Lanthipeptides: AMK11_RS16660_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVX01000004.1 Lanthipeptides: AMK29_RS15650_lanthipeptideNZ_LIWB01000010.1 Lanthipeptides: AMK33_RS24360_lanthipeptideNZ_MPOH02000012.1 Lanthipeptides: BM536_RS17150_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_RAIF01000032.1 Lanthipeptides: EBH09_RS35480_lanthipeptideNZ_SOPG01000008.1 Lanthipeptides: E0I08_RS17090_lanthipeptide

Lanthipeptides: SVEN_RS32110_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLSVTTCN

1

TGSRASLLLCGDSSLSVTTCN

21

95.2%

NZ_BBOK01000011.1and 23 others:

NZ_BEWD01000001.1 Lanthipeptides: Sru02f_RS01660_lanthipeptideNZ_BMSL01000016.1 Lanthipeptides: IE215_RS23330_lanthipeptideNZ_BMUC01000023.1 Lanthipeptides: IE172_RS32210_lanthipeptideNZ_BMVQ01000005.1 Lanthipeptides: IE283_RS17035_lanthipeptideNZ_BMWI01000025.1 Lanthipeptides: IE253_RS33945_lanthipeptideNZ_CP012382.1 Lanthipeptides: SAM23877_RS30085_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS29010_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS34495_lanthipeptideNZ_CP043959.1 Lanthipeptides: F3L20_RS19105_lanthipeptideNZ_CP045547.1 Lanthipeptides: GEV49_RS05730_lanthipeptideNZ_CP054939.1 Lanthipeptides: HUT14_RS29815_lanthipeptideNZ_CP094918.1 Lanthipeptides: MTR79_RS16715_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS05020_lanthipeptideNZ_JAAIFS010000001.1 Lanthipeptides: GUR47_RS02255_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS05695_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS34110_lanthipeptideNZ_MQUH01000025.1 Lanthipeptides: BSZ07_RS33280_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS10360_lanthipeptideNZ_RSEG01000006.1 Lanthipeptides: EIA57_RS12710_lanthipeptideNZ_SOAV01000001.1 Lanthipeptides: EV562_RS04520_lanthipeptideNZ_VIUV01000020.1 Lanthipeptides: FB570_RS34060_lanthipeptideNZ_WHZR01000001.1 Lanthipeptides: STPH1_RS04005_lanthipeptideNZ_WXVT01000001.1 Lanthipeptides: STPH2_RS03995_lanthipeptide

Lanthipeptides: APK71_RS25550_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLS+TTCN

1

TGSRASLLLCGDSSLSITTCN

21

95.2%

NZ_BMSV01000002.1and 18 others:

NZ_BMTP01000009.1 Lanthipeptides: IE109_RS18470_lanthipeptideNZ_CP007699.2 Lanthipeptides: T261_RS39185_lanthipeptideNZ_CP020042.1 Lanthipeptides: B4U46_RS32710_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS23100_lanthipeptideNZ_CP023692.1 Lanthipeptides: CP980_RS04735_lanthipeptideNZ_CP028158.1 Lanthipeptides: C6361_RS04660_lanthipeptideNZ_CP028159.1 Lanthipeptides: C6W10_RS01185_lanthipeptideNZ_CP034279.1 Lanthipeptides: EIZ62_RS28660_lanthipeptideNZ_CP102332.1 Lanthipeptides: NRO40_RS01140_lanthipeptideNZ_FNHI01000003.1 Lanthipeptides: BLT82_RS06465_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09875_lanthipeptideNZ_JAGGOI010000031.1 Lanthipeptides: J7E87_RS22160_lanthipeptideNZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10785_lanthipeptideNZ_JAPNLM010000003.1 Lanthipeptides: OTB16_RS07305_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIYH01000004.1 Lanthipeptides: AMK26_RS17765_lanthipeptideNZ_NBCN01000003.1 Lanthipeptides: BKD26_RS06570_lanthipeptide

Lanthipeptides: IE106_RS06150_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GSRASLLLCGDSSLSVTTCN

1

GSRASLLLCGDSSLSVTTCN

20

with 73 more sequence matches

Only the first 10 are displayed here.

95.2%

NZ_BMTU01000009.1and 1 other:

NZ_JACHJI010000005.1 Lanthipeptides: FHS37_RS15430_lanthipeptide

Lanthipeptides: IE118_RS22890_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

+GSRASLLLCGDSSLSVTTCN

1

SGSRASLLLCGDSSLSVTTCN

21

95.2%

NZ_BNCA01000002.1and 1 other:

NZ_CP049782.1 Lanthipeptides: G7Z12_RS34445_lanthipeptide

Lanthipeptides: IE314_RS02760_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLSV+TCN

1

TGSRASLLLCGDSSLSVSTCN

21

90.5%

NZ_CP048835.1:

Lanthipeptides: C8250_RS00390_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GSRASLLLCG+SSLSVTTCN

2

GSRASLLLCGNSSLSVTTCN

21

90.5%

NZ_GG657758.1and 1 other:

NZ_JACHEM010000005.1 Lanthipeptides: HNQ79_RS11445_lanthipeptide

Lanthipeptides: SSRG_RS03855_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

+GSRASLLLCGDSSLS+TTCN

1

SGSRASLLLCGDSSLSITTCN

21

90.5%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GS+ASLLLCGDSSLSVTTCN

2

GSQASLLLCGDSSLSVTTCN

21

85.7%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS17975_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GS ASLLLCGDSSLS+TTCN

2

GSEASLLLCGDSSLSLTTCN

21

85.7%

NZ_CP077658.1:

Lanthipeptides: KQY30_RS33045_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

SRASLLLCGDSSLSV TCN

1

ASRASLLLCGDSSLSVVTCN

20

85.7%

NZ_CP092183.1:

Lanthipeptides: COUCH_RS09775_lanthipeptide

4

RASLLLCGDSSLSVTTCN

21

RASLLLCGDSSLSVTTCN

1

RASLLLCGDSSLSVTTCN

18

85.7%

NZ_FOET01000001.1and 2 others:

NZ_FOSG01000005.1 Lanthipeptides: BM237_RS08435_lanthipeptideNZ_PDKQ02000044.1 Lanthipeptides: BFM75_RS16855_lanthipeptide

Lanthipeptides: BMY40_RS02540_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GS ASLLLCGDSSLSVTTC

2

GSEASLLLCGDSSLSVTTCR

21

83.3%

NZ_CP007574.1and 6 others:

NZ_CP007574.1 Lanthipeptides: DC74_RS36920_lanthipeptideNZ_CP026094.1 Lanthipeptides: SE95_RS37250_lanthipeptideNZ_CP104098.1 Lanthipeptides: N1H47_RS36625_lanthipeptideNZ_CP104098.1 Lanthipeptides: N1H47_RS36625_lanthipeptideNZ_CP119144.1 Lanthipeptides: P0D74_RS03260_lanthipeptideNZ_CP119144.1 Lanthipeptides: P0D74_RS03260_lanthipeptide

Lanthipeptides: DC74_RS36920_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLSVTTC

4

TGSRASLLLCGDSSLSVTTCK

24

MIBiG 4.0 matches for AMK27_RS08700

59.1%

Lanthipeptide: SRO15-2212

1

TGSRASLLLCGDSSLSVTTCN

21

TGS+ SLL+C SSLSV C

1

TGSQVSLLVCEYSSLSVVLCT

21

Lanthipeptide(s) for AMK27_RS08715

AMK27_RS08700

Leader:

MNLFDLQSLETPKDEAIGDVE

Core:

TGSRASLLLCGDSSLSVTTCN

Core with dehydrations:

DhbGDhaRADhaLLLCysGDDhaDhaLDhaVDhbDhbCysN

antiSMASH-DB 4.0 matches for AMK27_RS08700

100.0%

NC_018750.1and 67 others:

NC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNZ_BBNO01000003.1 Lanthipeptides: TU31_RS37940_lanthipeptideNZ_BMTO01000007.1 Lanthipeptides: IE136_RS15615_lanthipeptideNZ_BMUN01000001.1 Lanthipeptides: IE238_RS00740_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS05015_lanthipeptideNZ_CP015866.1 Lanthipeptides: Spa2297_RS27800_lanthipeptideNZ_CP017157.1 Lanthipeptides: SL103_RS15895_lanthipeptideNZ_CP019457.1 Lanthipeptides: BXT88_RS03410_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS35355_lanthipeptideNZ_CP019779.1 Lanthipeptides: STRMOE7_RS03775_lanthipeptideNZ_CP023691.1 Lanthipeptides: CP981_RS03050_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS04700_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34970_lanthipeptideNZ_CP029042.1 Lanthipeptides: DDE74_RS03525_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029541.1 Lanthipeptides: DKG71_RS05245_lanthipeptideNZ_CP034353.1 Lanthipeptides: D1J63_RS04900_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35250_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS09720_lanthipeptideNZ_CP046905.1 Lanthipeptides: GPZ77_RS32930_lanthipeptideNZ_CP047140.1 Lanthipeptides: GLX30_RS11420_lanthipeptideNZ_CP050976.1 Lanthipeptides: HEP86_RS04470_lanthipeptideNZ_CP054920.1 Lanthipeptides: HUT15_RS04615_lanthipeptideNZ_CP060825.1 Lanthipeptides: IAG43_RS32355_lanthipeptideNZ_CP074111.1 Lanthipeptides: KE639_RS31630_lanthipeptideNZ_CP084681.1 Lanthipeptides: KI385_RS00885_lanthipeptideNZ_CP085300.1 Lanthipeptides: LJA35_RS05220_lanthipeptideNZ_CP086217.1 Lanthipeptides: LJ741_RS03435_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS09690_lanthipeptideNZ_CP098437.1 Lanthipeptides: NCG97_RS34740_lanthipeptideNZ_CP099468.1 Lanthipeptides: NFX46_RS16770_lanthipeptideNZ_CP101137.1 Lanthipeptides: M6G08_RS24535_lanthipeptideNZ_CP102609.1 Lanthipeptides: NUT86_RS03980_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33560_lanthipeptideNZ_CP114202.1 Lanthipeptides: STRLI_RS35870_lanthipeptideNZ_CP114203.1 Lanthipeptides: STRNI_RS37360_lanthipeptideNZ_CP114205.1 Lanthipeptides: STRTU_RS33380_lanthipeptideNZ_JACHJE010000006.1 Lanthipeptides: FHS32_RS15850_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00800_lanthipeptideNZ_JAFEJA010000002.1 Lanthipeptides: JE024_RS34830_lanthipeptideNZ_JAGPYC010000033.1 Lanthipeptides: KBZ00_RS31440_lanthipeptideNZ_JAHLXF010000022.1 Lanthipeptides: KQY13_RS30555_lanthipeptideNZ_JAIHBQ010000001.1 Lanthipeptides: K4902_RS04515_lanthipeptideNZ_JAJJMU010000026.1 Lanthipeptides: LOC25_RS31275_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAPKNL010000004.1 Lanthipeptides: OSI21_RS07750_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0131905_lanthipeptideNZ_KN039948.1 Lanthipeptides: FM21_RS29525_lanthipeptideNZ_LIPF01000004.1 Lanthipeptides: AMK11_RS16660_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVX01000004.1 Lanthipeptides: AMK29_RS15650_lanthipeptideNZ_LIWB01000010.1 Lanthipeptides: AMK33_RS24360_lanthipeptideNZ_MPOH02000012.1 Lanthipeptides: BM536_RS17150_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_RAIF01000032.1 Lanthipeptides: EBH09_RS35480_lanthipeptideNZ_SOPG01000008.1 Lanthipeptides: E0I08_RS17090_lanthipeptide

Lanthipeptides: SVEN_RS32110_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLSVTTCN

1

TGSRASLLLCGDSSLSVTTCN

21

95.2%

NZ_BBOK01000011.1and 23 others:

NZ_BEWD01000001.1 Lanthipeptides: Sru02f_RS01660_lanthipeptideNZ_BMSL01000016.1 Lanthipeptides: IE215_RS23330_lanthipeptideNZ_BMUC01000023.1 Lanthipeptides: IE172_RS32210_lanthipeptideNZ_BMVQ01000005.1 Lanthipeptides: IE283_RS17035_lanthipeptideNZ_BMWI01000025.1 Lanthipeptides: IE253_RS33945_lanthipeptideNZ_CP012382.1 Lanthipeptides: SAM23877_RS30085_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS29010_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS34495_lanthipeptideNZ_CP043959.1 Lanthipeptides: F3L20_RS19105_lanthipeptideNZ_CP045547.1 Lanthipeptides: GEV49_RS05730_lanthipeptideNZ_CP054939.1 Lanthipeptides: HUT14_RS29815_lanthipeptideNZ_CP094918.1 Lanthipeptides: MTR79_RS16715_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS05020_lanthipeptideNZ_JAAIFS010000001.1 Lanthipeptides: GUR47_RS02255_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS05695_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS34110_lanthipeptideNZ_MQUH01000025.1 Lanthipeptides: BSZ07_RS33280_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS10360_lanthipeptideNZ_RSEG01000006.1 Lanthipeptides: EIA57_RS12710_lanthipeptideNZ_SOAV01000001.1 Lanthipeptides: EV562_RS04520_lanthipeptideNZ_VIUV01000020.1 Lanthipeptides: FB570_RS34060_lanthipeptideNZ_WHZR01000001.1 Lanthipeptides: STPH1_RS04005_lanthipeptideNZ_WXVT01000001.1 Lanthipeptides: STPH2_RS03995_lanthipeptide

Lanthipeptides: APK71_RS25550_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLS+TTCN

1

TGSRASLLLCGDSSLSITTCN

21

95.2%

NZ_BMSV01000002.1and 18 others:

NZ_BMTP01000009.1 Lanthipeptides: IE109_RS18470_lanthipeptideNZ_CP007699.2 Lanthipeptides: T261_RS39185_lanthipeptideNZ_CP020042.1 Lanthipeptides: B4U46_RS32710_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS23100_lanthipeptideNZ_CP023692.1 Lanthipeptides: CP980_RS04735_lanthipeptideNZ_CP028158.1 Lanthipeptides: C6361_RS04660_lanthipeptideNZ_CP028159.1 Lanthipeptides: C6W10_RS01185_lanthipeptideNZ_CP034279.1 Lanthipeptides: EIZ62_RS28660_lanthipeptideNZ_CP102332.1 Lanthipeptides: NRO40_RS01140_lanthipeptideNZ_FNHI01000003.1 Lanthipeptides: BLT82_RS06465_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09875_lanthipeptideNZ_JAGGOI010000031.1 Lanthipeptides: J7E87_RS22160_lanthipeptideNZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10785_lanthipeptideNZ_JAPNLM010000003.1 Lanthipeptides: OTB16_RS07305_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIYH01000004.1 Lanthipeptides: AMK26_RS17765_lanthipeptideNZ_NBCN01000003.1 Lanthipeptides: BKD26_RS06570_lanthipeptide

Lanthipeptides: IE106_RS06150_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GSRASLLLCGDSSLSVTTCN

1

GSRASLLLCGDSSLSVTTCN

20

with 73 more sequence matches

Only the first 10 are displayed here.

95.2%

NZ_BMTU01000009.1and 1 other:

NZ_JACHJI010000005.1 Lanthipeptides: FHS37_RS15430_lanthipeptide

Lanthipeptides: IE118_RS22890_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

+GSRASLLLCGDSSLSVTTCN

1

SGSRASLLLCGDSSLSVTTCN

21

95.2%

NZ_BNCA01000002.1and 1 other:

NZ_CP049782.1 Lanthipeptides: G7Z12_RS34445_lanthipeptide

Lanthipeptides: IE314_RS02760_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLSV+TCN

1

TGSRASLLLCGDSSLSVSTCN

21

90.5%

NZ_CP048835.1:

Lanthipeptides: C8250_RS00390_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GSRASLLLCG+SSLSVTTCN

2

GSRASLLLCGNSSLSVTTCN

21

90.5%

NZ_GG657758.1and 1 other:

NZ_JACHEM010000005.1 Lanthipeptides: HNQ79_RS11445_lanthipeptide

Lanthipeptides: SSRG_RS03855_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

+GSRASLLLCGDSSLS+TTCN

1

SGSRASLLLCGDSSLSITTCN

21

90.5%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GS+ASLLLCGDSSLSVTTCN

2

GSQASLLLCGDSSLSVTTCN

21

85.7%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS17975_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GS ASLLLCGDSSLS+TTCN

2

GSEASLLLCGDSSLSLTTCN

21

85.7%

NZ_CP077658.1:

Lanthipeptides: KQY30_RS33045_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

SRASLLLCGDSSLSV TCN

1

ASRASLLLCGDSSLSVVTCN

20

85.7%

NZ_CP092183.1:

Lanthipeptides: COUCH_RS09775_lanthipeptide

4

RASLLLCGDSSLSVTTCN

21

RASLLLCGDSSLSVTTCN

1

RASLLLCGDSSLSVTTCN

18

85.7%

NZ_FOET01000001.1and 2 others:

NZ_FOSG01000005.1 Lanthipeptides: BM237_RS08435_lanthipeptideNZ_PDKQ02000044.1 Lanthipeptides: BFM75_RS16855_lanthipeptide

Lanthipeptides: BMY40_RS02540_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GS ASLLLCGDSSLSVTTC

2

GSEASLLLCGDSSLSVTTCR

21

83.3%

NZ_CP007574.1and 6 others:

NZ_CP007574.1 Lanthipeptides: DC74_RS36920_lanthipeptideNZ_CP026094.1 Lanthipeptides: SE95_RS37250_lanthipeptideNZ_CP104098.1 Lanthipeptides: N1H47_RS36625_lanthipeptideNZ_CP104098.1 Lanthipeptides: N1H47_RS36625_lanthipeptideNZ_CP119144.1 Lanthipeptides: P0D74_RS03260_lanthipeptideNZ_CP119144.1 Lanthipeptides: P0D74_RS03260_lanthipeptide

Lanthipeptides: DC74_RS36920_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLSVTTC

4

TGSRASLLLCGDSSLSVTTCK

24

MIBiG 4.0 matches for AMK27_RS08700

59.1%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

TGSRASLLLCGDSSLSVTTCN

21

TGS+ SLL+C SSLSV C

1

TGSQVSLLVCEYSSLSVVLCT

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.98 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.85 out of 29.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.45 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.62 out of 35.63

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

AMK27_RS08700 - Class III

Cleavage pHMM score: 22.80

RODEO score: 0

Monoisotopic mass: 1940.0 Da

Molecular weight: 1941.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1959.2 Da N = 1; 1977.2 Da N = 2; 1995.2 Da N = 3; 2013.2 Da N = 4; 2031.3 Da N = 5; 2049.3 Da N = 6

AMK27_RS08700 - Class III

Cleavage pHMM score: 22.80

RODEO score: 0

Monoisotopic mass: 1940.0 Da

Molecular weight: 1941.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1959.2 Da N = 1; 1977.2 Da N = 2; 1995.2 Da N = 3; 2013.2 Da N = 4; 2031.3 Da N = 5; 2049.3 Da N = 6

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000002.1 - Region 5 - melanin

Download region SVG

Location: 467,765 - 478,157 nt. (total: 10,393 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.79	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000908.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000662.5	0.40	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.38	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.38	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001485.4	0.36	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.79	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000908.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.63	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000662.5	0.40	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.38	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.38	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001485.4	0.36	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

Additional weak hits (2):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.61 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.64 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_LIVV01000002.1 - Region 6 - NRP-metallophore,NRPS

Download region SVG

Location: 615,298 - 708,270 nt. (total: 92,973 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase phosphate reductase

AMK27_RS10245: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK27_RS10320: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

AMK27_RS10385: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

AMK27_RS10405: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK27_RS10410: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

AMK27_RS10415: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: PPTase aminotransferase formyltransferase kinase methyltransferase

AMK27_RS10225: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

AMK27_RS10305: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AMK27_RS10315: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

AMK27_RS10370: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AMK27_RS10375: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Hydrolases: hydrolase

AMK27_RS10230: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase mutase

AMK27_RS10195: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

AMK27_RS10240: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

AMK27_RS10235: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK27_RS10250: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK27_RS10330: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002424.3	0.97	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0001185.5	0.91	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001758.4	0.90	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.88	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002071.2	0.87	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0002135.2	0.86	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.85	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000349.5	0.84	NRPS	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0001128.4	0.83	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.83	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002424.3	0.78	NRPS	saccharochelin A, saccharochelin B, saccharochelin C, saccharochelin D, saccharochelin E, saccharochelin F, saccharochelin G, saccharochelin H	Saccharothrix sp.
BGC0001185.5	0.76	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002071.2	0.74	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000349.5	0.73	NRPS	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.52 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.52 out of 30.11

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.03 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.57 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.45 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.44 out of 36.53

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (12):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.94 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.30 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.84 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.69 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.85 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.53 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.30 out of 18.57

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.25 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.00 out of 18.57

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.88 out of 39.62

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.28 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 615297 - 708270:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Fo-OH-Orn - Ser - OH-Orn - OH-Orn) + (Gly - Orn - Ser - D-Ser) + (Orn - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS10235: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (66..477): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SGSLFPLSSPGGGLLVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK27_RS10250: Orn - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (473..880): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LNHAFDTSWEQWDVLLGGEVNLYGPTEYTVDALA
Nearest Stachelhaus code(s):: Orn DTEDMGLVDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1542..1953): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINALG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK27_RS10255: Gly - Orn - Ser - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (468..870): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FMQTFDIAALETQALVGGETNVYGPTEVTVWATS
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1535..1937): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDSSWEQWDVLLGGEVNYYGPTEFTVDALV
Nearest Stachelhaus code(s):: Orn DSEDLGFVDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2605..3008): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEENLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3672..4075): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEENLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK27_RS10330: Fo-OH-Orn - Ser - OH-Orn - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (469..865): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAAFDVTVWDMILVVGTEVVAYGLTEATVNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWIIGAVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1504..1936): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVTF
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2671..3091): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3782..4182): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAAFDVFAFEMILLVGTEICAYGLTEATVNSTL
Nearest Stachelhaus code(s):: OH-Orn DVFILGAVNK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000002.1 - Region 7 - azole-containing-RiPP,terpene

Download region SVG

Location: 732,531 - 775,399 nt. (total: 42,869 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

AMK27_RS10555: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

AMK27_RS10575: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: cyclase dehydratase

AMK27_RS10550: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

AMK27_RS10610: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Translocases: permease

AMK27_RS10540: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	1.28	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	1.03	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.61	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001146.5	0.31	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0002584.2	0.31	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001860.4	0.29	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000613.5	0.29	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001174.4	0.29	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000603.5	0.28	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000605.5	0.28	ribosomal	GE37468	Streptomyces sp. ATCC 55365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.86	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.79	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001146.5	0.53	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001860.4	0.51	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000613.5	0.51	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0000603.5	0.50	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000628.4	0.49	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0001145.5	0.49	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001640.3	0.47	ribosomal	kocurin	Kocuria rosea

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

AMK27_RS10550: T1TS

Domain 1 (122 - 478): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.16 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.03 out of 30.11

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.37 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

Additional weak hits (10):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.56 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.47 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.55 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.23 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.12 out of 27.04

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

Terpene

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 11 - 89; Score: 56.3; RRE type: Heterocycloanthracin_C_RRE; Location: 11 - 93; Score: 34.7

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_LIVV01000002.1 - Region 8 - NRPS,T2PKS

Download region SVG

Location: 842,134 - 921,120 nt. (total: 78,987 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AMK27_RS10920: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

AMK27_RS10960: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

AMK27_RS10965: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK27_RS11060: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: carboxylase methyltransferase

AMK27_RS11020: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AMK27_RS11075: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: amidase hydrolase

AMK27_RS11070: amidase

smcogs: SMCOG1105: amidase

AMK27_RS11155: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: cyclase

AMK27_RS11025: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

AMK27_RS11030: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

AMK27_RS10990: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK27_RS10995: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK27_RS11000: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK27_RS11005: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK27_RS11040: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AMK27_RS11045: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK27_RS11165: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

Translocases: permease

AMK27_RS11095: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	1.01	PKS	spore pigment	Streptomyces avermitilis
BGC0002075.3	0.88	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000272.3	0.88	PKS	spore pigment	Streptomyces collinus
BGC0001249.5	0.84	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000215.5	0.83	PKS	curamycin	Streptomyces cyaneus
BGC0001132.4	0.83	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.82	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.81	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.78	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.77	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.79	PKS	spore pigment	Streptomyces avermitilis
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000272.3	0.75	PKS	spore pigment	Streptomyces collinus
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.14 out of 27.04

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.38 out of 26.85

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.99 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.62 out of 30.22

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.81 out of 27.04

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.00 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.02 out of 31.73

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.86 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 842133 - 921120:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly) + (Asp) + (Lys) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 842133 - 898006:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly) + (Asp) + (Lys) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 848607 - 921120:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly) + (Asp) + (Lys) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS10990: X

AMP-binding (12..397): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GAHFTNAGQVMTFLNSSAAVNTYTSAEASPAQIS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AMK27_RS10995: Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (474..970): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMAFDTHAEEPDLILGGSVNTYGPTEAAVIVTA
Nearest Stachelhaus code(s):: Lys DTEDIGSVIK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMK27_RS11000: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (510..949): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQFDFSMTMLKMVLGGEFNHYGPTEATVGITV
Nearest Stachelhaus code(s):: OH-Asp DLTKVGHVGK (68% 8Å match); Asp DLTKVGHVGK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMK27_RS11005: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (490..895): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LSFTFDISALELQALAGGEFNVYGPTETTIWSTC
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Type II PKS gene cluster prediction details

Cluster section:: 848607 to 921120
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

AMK27_RS10965: KR (Score: 177.4; E-value: 9.7e-55)
AMK27_RS11020: MET C6|C8 (Score: 533.3; E-value: 4.4e-163)
AMK27_RS11025: CYC C4-C21/C2-C23|C2-C19 (Score: 157.2; E-value: 2.7e-49)
AMK27_RS11030: CYC C9-C14 (Score: 249.6; E-value: 2e-77)
AMK27_RS11035: ACP (Score: 76.6; E-value: 2.6e-24)
AMK27_RS11040: CLF (Score: 545.8; E-value: 1.3e-166)
AMK27_RS11045: KS (Score: 728.7; E-value: 4.2e-222)
AMK27_RS11050: CYC C5-C18 (Score: 214.9; E-value: 7e-67)
AMK27_RS11060: OXY (Score: 288.1; E-value: 3.1e-88)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DasR	N-acetylglucosamine dependent repressor

NZ_LIVV01000002.1 - Region 9 - NAPAA

Download region SVG

Location: 1,006,973 - 1,042,065 nt. (total: 35,093 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase

AMK27_RS11715: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

AMK27_RS41770: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Hydrolases: deaminase

AMK27_RS11655: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: dehydratase

AMK27_RS11635: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

AMK27_RS11620: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

AMK27_RS11650: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AMK27_RS11665: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0002174.2	0.63	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0002174.2	0.63	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (2):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.81 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 14, location 1006972 - 1042065:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS11665: X

AMP-binding (243..647): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAQVSVTGEVNAYGLTETSDDTHH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (91% 8Å match); dnmeProp or Dab DIWQSTADDK (85% 8Å match); Asp DIWQSTADDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000002.1 - Region 10 - NRPS

Download region SVG

Location: 1,043,761 - 1,097,485 nt. (total: 53,725 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

AMK27_RS11865: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: esterase

AMK27_RS11895: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: ligase

AMK27_RS11835: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK27_RS11850: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK27_RS11855: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK27_RS11860: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001251.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001251.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (15):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.56 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.35 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.94 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.45 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.55 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.78 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.67 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.44 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 1043760 - 1097485:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Ser) + (Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS11850: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (463..848): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: VSLTFDISAVELQALTGGEVNVYGPTETTIWSTL
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMK27_RS11855: X

AMP-binding (25..411): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GRDFSNAGQTMNFVGSTAAVNYYTSTEAAPAQVT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AMK27_RS11860: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (527..922): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEANLYGPTEAAVDVSA
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK27_RS11865: X

AMP-binding (480..883): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMAFDTSAEEPDLILGADVNSYGPTETTIIATT
Nearest Stachelhaus code(s):: Lys DTEDIGSVIK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000002.1 - Region 11 - lanthipeptide-class-iv

Download region SVG

Location: 1,316,012 - 1,338,756 nt. (total: 22,745 nt) Show pHMM detection rules used

lanthipeptide-class-iv: (cds(LANC_like and Pkinase) and not micKC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK27_RS12970: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

AMK27_RS12985: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.86	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.84	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001579.4	0.54	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.53	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.48	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002346.3	0.47	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001779.5	0.46	ribosomal	siamycin	Streptomyces nodosus
BGC0001364.3	0.43	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002635.2	0.41	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000563.4	0.86	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001226.4	0.84	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0001579.4	0.54	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.53	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000503.5	0.48	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002346.3	0.47	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001779.5	0.46	ribosomal	siamycin	Streptomyces nodosus
BGC0001364.3	0.43	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002635.2	0.41	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.16 out of 20.01

Confidence: medium

Additional weak hits (6):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.35 out of 35.63

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.89 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.21 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.26 out of 28.19

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes

NZ_LIVV01000020.1 - Region 1 - NRPS,T1PKS

Download region SVG

Location: 1 - 33,779 nt. (total: 33,779 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase

AMK27_RS42560: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Ligases: synthase

AMK27_RS40410: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.70 out of 23.79

Confidence: medium

Additional weak hits (5):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.69 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.29 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.43 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 33779:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS40410: mal

PKS_AT (962..1242): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 74.3
inactive: 22.1
Methoxymalonyl-CoA: 17.1
Propionyl-CoA: 10.3
Methylmalonyl-CoA: 8.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

AMK27_RS42560: X - X

AMP-binding (19..401): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LQAFSDVAGMETVFMVGVEVNGYGPTETTVYSTF
Nearest Stachelhaus code(s):: meLeu DAMLWGGVYK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1060..1441): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGAAFDLATFEAHLMVGGEVHCYGPAEGTVHTTY
Nearest Stachelhaus code(s):: Val DAFWLGCVFK (62% 8Å match); Hty DLGFTGCVTK (53% 8Å match); Asn DLTKMGEVGK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_LIVV01000003.1 - Region 1 - NI-siderophore

Download region SVG

Location: 84,272 - 117,412 nt. (total: 33,141 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AMK27_RS13510: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

AMK27_RS13460: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

AMK27_RS13525: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.53	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002470.2	0.52	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002305.2	0.51	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000939.5	0.51	other (other)	aerobactin	Grimontia hollisae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.53	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002470.2	0.52	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002305.2	0.51	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000939.5	0.51	other (other)	aerobactin	Grimontia hollisae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.93 out of 27.18

Confidence: medium

Additional weak hits (7):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.12 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.11 out of 23.43

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.53 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.40 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000003.1 - Region 2 - NRPS

Download region SVG

Location: 151,734 - 210,467 nt. (total: 58,734 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase carbamoyltransferase

AMK27_RS13720: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

AMK27_RS13790: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase

AMK27_RS13815: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: lyase

AMK27_RS13775: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

AMK27_RS13780: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

AMK27_RS13755: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK27_RS13760: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK27_RS13770: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AMK27_RS13825: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.03 out of 27.04

Confidence: medium

Additional weak hits (11):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.08 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.42 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.32 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.88 out of 26.06

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.72 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.98 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.36 out of 23.43

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 151733 - 210467:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - X - Val) + (Val - X - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS13755: Val - X - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (32..448): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPSFDSSTYEVYFWTGGDVHAYGPTESTVFCSY
Nearest Stachelhaus code(s):: Cyc-D-Gly DAYLWGGVFK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1106..1509): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWWSFDSSTYEVYFWTGGDVHAYGPTESTVFCSY
Nearest Stachelhaus code(s):: Cyc-D-Gly DAYLWGGVFK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2167..2562): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDATTYEAWLWTGGDVNAYGPTETTTFATS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMK27_RS13760: Val - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (503..906): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHSFDATTYEAWLWTGGDVNGYGPTETTTFATS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1594..1991): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGPSWDAFALEGQMMTAGELNGYGPAESMGFTTV
Nearest Stachelhaus code(s):: Val DALWMGGTFK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2644..3041): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGPSWDAFALEGQMMTAGELNGYGPAESMGFTTV
Nearest Stachelhaus code(s):: Val DALWMGGTFK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000003.1 - Region 3 - NRPS

Download region SVG

Location: 268,736 - 340,811 nt. (total: 72,076 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

AMK27_RS14090: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AMK27_RS14125: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK27_RS14160: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AMK27_RS14185: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

AMK27_RS14195: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AMK27_RS14225: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: methyltransferase

AMK27_RS14120: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AMK27_RS14255: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase

AMK27_RS14200: thioesterase

smcogs: SMCOG1004: thioesterase

AMK27_RS14260: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

AMK27_RS14135: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AMK27_RS14150: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

AMK27_RS14210: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002147.2	1.27	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0002340.3	0.69	NRPS, other (other)	pyrroloformamide A, pyrroloformamide B, pyrroloformamide D, pyrroloformamide C	Streptomyces sp. CB02980
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002147.2	0.99	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0002340.3	0.80	NRPS, other (other)	pyrroloformamide A, pyrroloformamide B, pyrroloformamide D, pyrroloformamide C	Streptomyces sp. CB02980
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001534.3	0.72	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001873.3	0.71	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.87 out of 27.04

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (17):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.91 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.37 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.60 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.16 out of 32.74

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.09 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.66 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.10 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.03 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.72 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.07 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.72 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.25 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 268735 - 340811:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (Ser - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 268735 - 315977:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 297466 - 340811:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS14135: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (459..868): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEVNLYGPTEGTVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1529..1931): X

nrpys: 5Me-Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: YWQAFDVAFQESFMISSGEENQYGPTETHLLTHH
Nearest Stachelhaus code(s):: 5Me-Pro DVQFISQLLK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK27_RS14210: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (504..904): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLLSGDISLGGATEGSIWSIH
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_LIVV01000003.1 - Region 4 - RiPP-like

Download region SVG

Location: 431,536 - 442,948 nt. (total: 11,413 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK27_RS14640: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase

AMK27_RS14690: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.36	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.36	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.36	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000351.5	0.32	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0001311.5	0.32	ribosomal	flavecins	Ruminococcus flavefaciens FD-1
BGC0000498.5	0.32	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.32	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000496.5	0.32	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.36	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.36	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.36	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000351.5	0.32	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0001311.5	0.32	ribosomal	flavecins	Ruminococcus flavefaciens FD-1
BGC0000498.5	0.32	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.32	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000496.5	0.32	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.70 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.56 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LIVV01000003.1 - Region 5 - butyrolactone

Download region SVG

Location: 554,273 - 565,220 nt. (total: 10,948 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AMK27_RS15205: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AMK27_RS15225: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: dehydratase

AMK27_RS15220: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.79	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000244.4	0.52	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002578.2	0.48	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000706.3	0.43	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000003.3	0.40	PKS	AF-toxin	Alternaria alternata
BGC0000207.5	0.40	PKS	chartreusin	Streptomyces chartreusis
BGC0000783.3	0.40	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.79	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000244.4	0.52	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0002578.2	0.48	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000706.3	0.43	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000003.3	0.40	PKS	AF-toxin	Alternaria alternata
BGC0000207.5	0.40	PKS	chartreusin	Streptomyces chartreusis
BGC0000783.3	0.40	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.30 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.86 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LIVV01000003.1 - Region 6 - NRPS,T1PKS

Download region SVG

Location: 687,523 - 750,617 nt. (total: 63,095 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

AMK27_RS15945: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

AMK27_RS15855: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AMK27_RS15870: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AMK27_RS15910: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

AMK27_RS43680: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.86	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.85	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.85	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.79	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.94 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (17):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.32 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.33 out of 30.97

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.94 out of 19.26

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.99 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.49 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.82 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.92 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.99 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.01 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.11 out of 21.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.73 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 687522 - 750617:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - redmal) + (Me-ccmal - Me-mal - Cys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS15855: X

AMP-binding (3..382): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HGVVFHANAWGSAAGCGGAVQGWGLTETSPLATF
Nearest Stachelhaus code(s):: Abu DAWFYGAPLK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

AMK27_RS15870: mmal - mmal - Cys

Search NORINE for peptide: strict or relaxed

PKS_AT (568..861): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 203.2
Ethylmalonyl-CoA: 191.6
Methoxymalonyl-CoA: 154.2
2-Methylbutyryl-CoA: 141.6
trans-1,2-CPDA: 98.6
Propionyl-CoA: 96.6
CHC-CoA: 94.5
Malonyl-CoA: 84.3
Isobutyryl-CoA: 74.6
Benzoyl-CoA: 70.7
fatty_acid: 37.1
Acetyl-CoA: 32.2
inactive: 31.4
3-Methylbutyryl-CoA: 11.1

PKS_AT (2286..2579): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 205.6
Ethylmalonyl-CoA: 197.6
Methoxymalonyl-CoA: 155.6
2-Methylbutyryl-CoA: 138.3
trans-1,2-CPDA: 97.5
Propionyl-CoA: 97.4
CHC-CoA: 89.1
Malonyl-CoA: 84.2
Isobutyryl-CoA: 72.4
Benzoyl-CoA: 72.0
fatty_acid: 36.1
inactive: 34.1
Acetyl-CoA: 33.6
3-Methylbutyryl-CoA: 11.1

AMP-binding (3568..3997): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSMMSGDWSLGGATEASIWSIL
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMK27_RS43680: mmal - mal

PKS_AT (583..879): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 198.8
Ethylmalonyl-CoA: 191.6
Methoxymalonyl-CoA: 170.8
2-Methylbutyryl-CoA: 133.3
Malonyl-CoA: 112.3
trans-1,2-CPDA: 109.5
Propionyl-CoA: 100.4
CHC-CoA: 92.9
Isobutyryl-CoA: 82.6
Benzoyl-CoA: 62.5
Acetyl-CoA: 44.2
fatty_acid: 43.5
3-Methylbutyryl-CoA: 32.5
inactive: 27.4

PKS_AT (1601..1896): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.1
inactive: 101.2
Methoxymalonyl-CoA: 86.4
Methylmalonyl-CoA: 76.9
Propionyl-CoA: 47.5
Isobutyryl-CoA: 44.5
Acetyl-CoA: 34.5
Ethylmalonyl-CoA: 32.0
2-Methylbutyryl-CoA: 21.0
fatty_acid: 20.6
3-Methylbutyryl-CoA: 19.0
CHC-CoA: 16.4
Benzoyl-CoA: 13.2
trans-1,2-CPDA: 5.7

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism

NZ_LIVV01000005.1 - Region 1 - melanin

Download region SVG

Location: 118,539 - 128,952 nt. (total: 10,414 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.79	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.47	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.31	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.31	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.31	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.30	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.24	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.79	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.47	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.31	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.31	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.31	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.30	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.24	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.17 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.60 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.82 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.77 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.27 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LIVV01000005.1 - Region 2 - linaridin

Download region SVG

Location: 143,750 - 166,351 nt. (total: 22,602 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

AMK27_RS20155: methyltransferase

smcogs: SMCOG1248: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000582.4	0.90	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0002319.3	0.85	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0000583.5	0.79	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001188.3	0.44	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0001521.3	0.38	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002509.3	0.37	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0002294.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002805.2	0.35	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0001647.3	0.34	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0000700.5	0.31	saccharide	istamycin	Streptomyces tenjimariensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000582.4	0.90	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0002319.3	0.85	ribosomal	salinipeptin A, salinipeptin B, salinipeptin C, salinipeptin D	Streptomyces sp.
BGC0000583.5	0.79	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001188.3	0.44	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0001521.3	0.38	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0002509.3	0.37	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0002294.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002805.2	0.35	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0001647.3	0.34	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0000700.5	0.31	saccharide	istamycin	Streptomyces tenjimariensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

Additional weak hits (12):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.55 out of 26.85

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.05 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.50 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.67 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.07 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.32 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.64 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.03 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.19 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.81 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NZ_LIVV01000005.1 - Region 3 - NRPS-like

Download region SVG

Location: 711,180 - 754,881 nt. (total: 43,702 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AMK27_RS22880: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AMK27_RS22935: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: acetyltransferase glycosyltransferase kinase methyltransferase sulfhydrylase

AMK27_RS22870: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

AMK27_RS22945: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

AMK27_RS22980: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

AMK27_RS23010: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AMK27_RS23025: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: esterase hydrolase

AMK27_RS22890: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

AMK27_RS22930: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AMK27_RS22955: thioesterase

smcogs: SMCOG1004: thioesterase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.62	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 31.91 out of 32.38

Confidence: strong

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 29.76 out of 32.93

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 29.15 out of 32.38

Confidence: strong

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.96 out of 32.93

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

Additional weak hits (10):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.93 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.94 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.37 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.22 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.66 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.12 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.80 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.48 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.30 out of 32.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 711179 - 754881:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AMK27_RS22955: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (14..401): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWMTFDAAQWEAQGYSGGEINLYGPTECTINASS
Nearest Stachelhaus code(s):: Gln DAWQFGLINK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CsoR	Copper-responsive repressor
RicR	Copper-responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LIVV01000006.1 - Region 1 - terpene-precursor

Download region SVG

Location: 153,569 - 174,618 nt. (total: 21,050 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

AMK27_RS24640: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

AMK27_RS24570: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002398.2	0.37	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.35	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002398.2	0.37	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001910.4	0.35	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AMK27_RS24570: PT_FPPS_like

Domain 1 (59 - 342): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

Additional weak hits (7):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.75 out of 32.93

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.69 out of 27.04

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.50 out of 33.14

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.07 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.52 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis

NZ_LIVV01000006.1 - Region 2 - butyrolactone,other

Download region SVG

Location: 341,558 - 382,667 nt. (total: 41,110 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucanase glucosidase

AMK27_RS25405: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

AMK27_RS25415: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

AMK27_RS25420: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

AMK27_RS25495: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	1.00	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.51	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.43	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.25	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001534.3	0.24	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001458.4	0.20	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0000519.4	0.18	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002285.2	0.17	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001285.5	0.15	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001298.4	0.15	PKS	4-Z-annimycin, 4-E-annimycin	Streptomyces calvus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.79	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.59	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.55	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002285.2	0.49	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001285.5	0.46	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001374.5	0.45	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002064.2	0.43	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002578.2	0.43	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.27 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.65 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.53 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.50 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.31 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_LIVV01000006.1 - Region 3 - azole-containing-RiPP

Download region SVG

Location: 386,812 - 420,073 nt. (total: 33,262 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

AMK27_RS25570: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001146.5	0.54	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000606.5	0.53	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0002311.3	0.52	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000662.5	0.52	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001640.3	0.51	ribosomal	kocurin	Kocuria rosea
BGC0001145.5	0.51	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.50	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002826.2	0.50	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000565.5	0.49	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000605.5	0.49	ribosomal	GE37468	Streptomyces sp. ATCC 55365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001146.5	0.54	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000606.5	0.53	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0002311.3	0.52	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000662.5	0.52	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001640.3	0.51	ribosomal	kocurin	Kocuria rosea
BGC0001145.5	0.51	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.50	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002826.2	0.50	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000565.5	0.49	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000605.5	0.49	ribosomal	GE37468	Streptomyces sp. ATCC 55365

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.63 out of 27.04

Confidence: medium

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.62 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.38 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.17 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.31 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.57 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.49 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.15 out of 33.14

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 5 - 87; Score: 40.9

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

Core peptide predictions

No core peptides found.

NZ_LIVV01000007.1 - Region 1 - NI-siderophore