GCF_001905345.1 - 37 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_LFBV01000001.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NAPAA,RiPP-like	1	30,809
Region 1.2	terpene	104,030	131,059	High	hopene	terpene
Region 1.3	RiPP-like	393,473	403,760
Region 1.4	melanin	641,561	651,998
Region 1.5	T2PKS,azole-containing-RiPP	1,348,356	1,441,332	High	nenestatin	PKS
Region 1.6	terpene	1,768,943	1,790,037	High	albaflavenone	terpene
Region 1.7	terpene-precursor	1,799,048	1,820,244

NZ_LFBV01000010.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	arylpolyene,butyrolactone	5,425	46,543

NZ_LFBV01000011.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	T3PKS	77,323	118,432	High	flaviolin/1,3,6,8-tetrahydroxynaphthalene	PKS
Region 3.2	T1PKS,PKS-like	198,567	249,388

NZ_LFBV01000012.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	lanthipeptide-class-i	110,675	136,979

NZ_LFBV01000013.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	CDPS	12,496	34,013
Region 5.2	RiPP-like	49,526	60,896	Medium	streptamidine	ribosomal:unmodified

NZ_LFBV01000002.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	T1PKS,NRPS	3,237	131,262	High	bafilomycin B1	PKS:Type I
Region 9.2	melanin,CDPS	137,408	162,702	High	melanin	other:other
Region 9.3	NRPS-like,T1PKS,RiPP-like,NRPS	174,534	280,315
Region 9.4	lanthipeptide-class-iii,NI-siderophore	351,010	390,378	Low	peucechelin	NRPS:Type I
Region 9.5	NRPS-like,T1PKS,NRPS	671,271	740,811
Region 9.6	ectoine	829,443	839,814
Region 9.7	betalactone	879,469	907,413
Region 9.8	NI-siderophore	922,674	957,216	Low	nonactin/monactin/dinactin/trinactin/tetranactin	PKS
Region 9.9	RiPP-like	975,230	986,720

NZ_LFBV01000003.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NRP-metallophore,NRPS	124,837	184,187	High	mirubactin	NRPS:Type I
Region 10.2	T1PKS,NRPS-like,NRPS,melanin	242,994	352,983	High	sibiromycin	NRPS:Type I
Region 10.3	lassopeptide,t3nrps-iterative,T1PKS	428,240	517,508	Low	butyrolactol A	PKS
Region 10.4	NRP-metallophore,NRPS,T1PKS	611,706	665,958
Region 10.5	indole	713,999	737,271	High	caldoniamide A/cladoniamide B/cladoniamide C7/cladoniamide D/cladoniamide E/cladoniamide F/cladoniamide G	other:other

NZ_LFBV01000004.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	NI-siderophore	45,935	78,612
Region 11.2	T1PKS,terpene-precursor	201,185	264,455	High	uncialamycin	PKS
Region 11.3	RiPP-like,terpene	306,509	338,701
Region 11.4	T3PKS	570,090	611,250

NZ_LFBV01000005.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	ectoine	75,910	86,308	High	ectoine	other:other

NZ_LFBV01000006.1 (Streptomyces uncialis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	terpene	73,070	102,497	High	isorenieratene	terpene

NZ_LFBV01000007.1 (Streptomyces uncialis)

Region	Type	From	To
Region 14.1	NRPS,NRPS-like	1	93,417
Region 14.2	butyrolactone	267,421	278,392
Region 14.3	terpene	343,539	365,843
Region 14.4	terpene	411,513	432,829

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NAPAA,RiPP-like	1	30,809
Region 1.2	terpene	104,030	131,059	High	hopene	terpene
Region 1.3	RiPP-like	393,473	403,760
Region 1.4	melanin	641,561	651,998
Region 1.5	T2PKS,azole-containing-RiPP	1,348,356	1,441,332	High	nenestatin	PKS
Region 1.6	terpene	1,768,943	1,790,037	High	albaflavenone	terpene
Region 1.7	terpene-precursor	1,799,048	1,820,244
Region 2.1	arylpolyene,butyrolactone	5,425	46,543
Region 3.1	T3PKS	77,323	118,432	High	flaviolin/1,3,6,8-tetrahydroxynaphthalene	PKS
Region 3.2	T1PKS,PKS-like	198,567	249,388
Region 4.1	lanthipeptide-class-i	110,675	136,979
Region 5.1	CDPS	12,496	34,013
Region 5.2	RiPP-like	49,526	60,896	Medium	streptamidine	ribosomal:unmodified
Region 9.1	T1PKS,NRPS	3,237	131,262	High	bafilomycin B1	PKS:Type I
Region 9.2	melanin,CDPS	137,408	162,702	High	melanin	other:other
Region 9.3	NRPS-like,T1PKS,RiPP-like,NRPS	174,534	280,315
Region 9.4	lanthipeptide-class-iii,NI-siderophore	351,010	390,378	Low	peucechelin	NRPS:Type I
Region 9.5	NRPS-like,T1PKS,NRPS	671,271	740,811
Region 9.6	ectoine	829,443	839,814
Region 9.7	betalactone	879,469	907,413
Region 9.8	NI-siderophore	922,674	957,216	Low	nonactin/monactin/dinactin/trinactin/tetranactin	PKS
Region 9.9	RiPP-like	975,230	986,720
Region 10.1	NRP-metallophore,NRPS	124,837	184,187	High	mirubactin	NRPS:Type I
Region 10.2	T1PKS,NRPS-like,NRPS,melanin	242,994	352,983	High	sibiromycin	NRPS:Type I
Region 10.3	lassopeptide,t3nrps-iterative,T1PKS	428,240	517,508	Low	butyrolactol A	PKS
Region 10.4	NRP-metallophore,NRPS,T1PKS	611,706	665,958
Region 10.5	indole	713,999	737,271	High	caldoniamide A/cladoniamide B/cladoniamide C7/cladoniamide D/cladoniamide E/cladoniamide F/cladoniamide G	other:other
Region 11.1	NI-siderophore	45,935	78,612
Region 11.2	T1PKS,terpene-precursor	201,185	264,455	High	uncialamycin	PKS
Region 11.3	RiPP-like,terpene	306,509	338,701
Region 11.4	T3PKS	570,090	611,250
Region 12.1	ectoine	75,910	86,308	High	ectoine	other:other
Region 13.1	terpene	73,070	102,497	High	isorenieratene	terpene
Region 14.1	NRPS,NRPS-like	1	93,417
Region 14.2	butyrolactone	267,421	278,392
Region 14.3	terpene	343,539	365,843
Region 14.4	terpene	411,513	432,829

No secondary metabolite regions were found in these records:: NZ_LFBV01000014.1 (Streptomyces uncialis); NZ_LFBV01000015.1 (Streptomyces uncialis); NZ_LFBV01000016.1 (Streptomyces uncialis); NZ_LFBV01000008.1 (Streptomyces uncialis); NZ_LFBV01000009.1 (Streptomyces uncialis)

Compact view

NZ_LFBV01000001.1 - Region 1 - NAPAA,RiPP-like

Download region GenBank file

Download region SVG

Location: 1 - 30,809 nt. (total: 30,809 nt) Show pHMM detection rules used

Region on contig edge.

NAPAA: (AMP-binding and TIGR02353)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase synthase

AB852_RS00020: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

AB852_RS00100: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

AB852_RS40325: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: glycosyltransferase

AB852_RS00030: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: deacetylase synthase

AB852_RS00070: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

AB852_RS40325: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Ligases: ligase

AB852_RS00060: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS00095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.47	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001555.4	0.35	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.34	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.33	ribosomal	microcin L	Escherichia coli
BGC0002698.2	0.33	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002699.2	0.30	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000551.5	0.29	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000518.3	0.28	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000587.5	0.28	ribosomal	microcin H47	Escherichia coli
BGC0000589.5	0.28	ribosomal	microcin M	Escherichia coli Nissle 1917

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.00 out of 23.79

Confidence: medium

Additional weak hits (8):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.63 out of 30.22

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.85 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 27.04

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 30809:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS00060: X

AMP-binding (47..514): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

AB852_RS00095: X

AMP-binding (22..479): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SSFVFERIFRQRTGFGGRAYDGYGLTETSGGCAA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_LFBV01000001.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 104,030 - 131,059 nt. (total: 27,030 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AB852_RS00410: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

AB852_RS00445: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase transferase

AB852_RS00405: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

AB852_RS00470: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase

AB852_RS00395: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

AB852_RS00450: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000630.3	0.47	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000641.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000630.3	0.47	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000641.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

AB852_RS00435: PT_phytoene_like

Domain 1 (42 - 303): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

AB852_RS00440: PT_phytoene_like

Domain 1 (17 - 306): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

AB852_RS00450: PT_FPPS_like

Domain 1 (85 - 376): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

AB852_RS00455: T2TS

Domain 1 (31 - 658): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.28 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.40 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.99 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.51 out of 30.98

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.57 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.65 out of 28.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_LFBV01000001.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 393,473 - 403,760 nt. (total: 10,288 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000513.3	0.36	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.36	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.36	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.35	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000504.5	0.35	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.35	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000487.5	0.32	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0001289.5	0.32	ribosomal	penisin	Paenibacillus ehimensis
BGC0000538.3	0.31	ribosomal	nisin Z	Lactococcus lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0000513.3	0.36	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.36	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.36	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.35	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000504.5	0.35	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.5	0.35	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000487.5	0.32	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0001289.5	0.32	ribosomal	penisin	Paenibacillus ehimensis
BGC0000538.3	0.31	ribosomal	nisin Z	Lactococcus lactis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 24.17 out of 30.25

Confidence: medium

Additional weak hits (1):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.56 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator

NZ_LFBV01000001.1 - Region 4 - melanin

Download region GenBank file

Download region SVG

Location: 641,561 - 651,998 nt. (total: 10,438 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.82	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.65	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.52	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.40	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.39	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000513.3	0.37	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.82	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.65	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.52	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.40	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.39	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000513.3	0.37	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000889.5	0.34	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.33	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (13):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.94 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.12 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.65 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.63 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.36 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.30 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.10 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.56 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.29 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.40 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.23 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_LFBV01000001.1 - Region 5 - T2PKS,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 1,348,356 - 1,441,332 nt. (total: 92,977 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AB852_RS05800: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

AB852_RS05995: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AB852_RS06005: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AB852_RS06045: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

AB852_RS06120: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AB852_RS06125: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AB852_RS06130: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AB852_RS06215: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acylase aminotransferase glycosyltransferase methyltransferase sulfhydrylase sulfotransferase transferase

AB852_RS05835: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

AB852_RS05960: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AB852_RS05975: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

AB852_RS06010: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

AB852_RS06025: methyltransferase

smcogs: SMCOG1248: methyltransferase

AB852_RS06030: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

AB852_RS06050: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

AB852_RS06150: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

AB852_RS06200: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

AB852_RS06205: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AB852_RS06210: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: dehalogenase

AB852_RS06090: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase dehydratase

AB852_RS06020: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AB852_RS06100: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

AB852_RS06155: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AB852_RS06220: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

AB852_RS05855: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AB852_RS05965: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AB852_RS05970: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.49	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000898.5	0.38	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae
BGC0000234.5	0.37	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000221.5	0.36	PKS	erdacin	uncultured soil bacterium V167
BGC0000899.4	0.34	saccharide	desosamine	Streptomyces narbonensis
BGC0001817.5	0.34	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000217.5	0.34	PKS	daunorubicin	Streptomyces sp.
BGC0000193.3	0.34	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000218.5	0.34	PKS	doxorubicin	Streptomyces peucetius
BGC0001366.5	0.34	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001817.5	0.67	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000231.5	0.64	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000278.3	0.64	PKS	urdamycin	Streptomyces fradiae
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001197.5	0.56	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000272.3	0.55	PKS	spore pigment	Streptomyces collinus
BGC0000275.4	0.54	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0000264.5	0.54	PKS	resistomycin, resistoflavine	Streptomyces resistomycificus
BGC0000217.5	0.54	PKS	daunorubicin	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.14 out of 23.43

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.93 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.35 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.77 out of 29.51

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.50 out of 30.12

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.11 out of 25.31

Confidence: medium

Additional weak hits (26):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.43 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.28 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.82 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.23 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.71 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.20 out of 26.85

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.32 out of 25.88

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.78 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.88 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.75 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.99 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.50 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.39 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

RREFinder

Type II PKS

TFBS Finder

Azole RiPPs

NRPS/PKS substrate predictions

AB852_RS05960: mal

PKS_AT (52..330): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 56.5
Methylmalonyl-CoA: 32.8
Propionyl-CoA: 26.7
Methoxymalonyl-CoA: 24.4
Acetyl-CoA: 14.2
inactive: 13.8
Ethylmalonyl-CoA: 11.7
trans-1,2-CPDA: 8.7
2-Methylbutyryl-CoA: 5.4
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 13 - 119; Score: 65.8; RRE type: Cyanobactin_D_RRE; Location: 13 - 88; Score: 53.2; RRE type: NHLP_CD_RRE; Location: 12 - 93; Score: 49.1

Type II PKS gene cluster prediction details

Cluster section:: 1348355 to 1420832
Starter unit(s):: propionyl-CoA (Score: 312.0; E-value: 2.51e-108)
Malonyl elongations:: 8|9 (Score: 673.8; E-value: 1.6e-205)
Product class(es):: angucycline
Product molecular weight(s):: propionyl-CoA_8: 593 Da
propionyl-CoA_9: 635 Da

AB852_RS05955: ACP (Score: 84.5; E-value: 8.8e-27)
AB852_RS05960: AT (Score: 382.8; E-value: 3.1e-117); AT AAF70110.1_Aclacinomycin_propionyl-CoA (Score: 312.0; E-value: 2.51e-108)
AB852_RS05965: CLF 8|9 (Score: 673.8; E-value: 1.6e-205)
AB852_RS05970: KS (Score: 742.0; E-value: 4e-226)
AB852_RS05995: OXY (Score: 312.4; E-value: 1.3e-95)
AB852_RS06000: ACP (Score: 113.1; E-value: 1.1e-35)
AB852_RS06005: KR C9 (Score: 465.0; E-value: 1.5e-142)
AB852_RS06050: GT (Score: 274.4; E-value: 4.9e-84)
AB852_RS06100: CYC C4-C17/C2-C19 (Score: 191.2; E-value: 4.1e-59)
AB852_RS06115: DIMER (Score: 322.4; E-value: 5.9e-99)
AB852_RS06120: KR (Score: 134.6; E-value: 1.1e-41)
AB852_RS06125: OXY (Score: 451.9; E-value: 6.7e-138)
AB852_RS06130: OXY (Score: 495.8; E-value: 3.3e-151)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CatR	H2O2-responsive repressor
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

Core peptide predictions

No core peptides found.

NZ_LFBV01000001.1 - Region 6 - terpene

Download region GenBank file

Download region SVG

Location: 1,768,943 - 1,790,037 nt. (total: 21,095 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AB852_RS07635: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

AB852_RS07625: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

AB852_RS07630: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Translocases: transporter

AB852_RS07660: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.82	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.41	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000996.5	0.33	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.82	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.41	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000996.5	0.33	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AB852_RS07630: T1TS

Domain 1 (10 - 337): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 26.40 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.29 out of 27.04

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.19 out of 23.43

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 27.04

Confidence: medium

Additional weak hits (5):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.48 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.90 out of 26.85

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.07 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.28 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
DasR	N-acetylglucosamine dependent repressor
NrdR	Represses ribonucleotide reductase encoding genes

NZ_LFBV01000001.1 - Region 7 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1,799,048 - 1,820,244 nt. (total: 21,197 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

AB852_RS07750: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.38	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000678.5	0.32	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001605.3	0.32	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000664.5	0.32	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.38	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000665.5	0.34	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000678.5	0.32	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001605.3	0.32	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000664.5	0.32	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AB852_RS07750: PT_FPPS_like

Domain 1 (108 - 395): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (8):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.01 out of 27.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.60 out of 23.43

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.11 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.45 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.89 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis

NZ_LFBV01000010.1 - Region 1 - arylpolyene,butyrolactone

Download region GenBank file

Download region SVG

Location: 5,425 - 46,543 nt. (total: 41,119 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AB852_RS30370: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AB852_RS30415: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: PPTase acylase

AB852_RS30325: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

AB852_RS30410: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

AB852_RS30395: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AB852_RS30400: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

AB852_RS30340: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.34	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000231.5	0.30	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.28	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000234.5	0.27	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000217.5	0.27	PKS	daunorubicin	Streptomyces sp.
BGC0002138.2	0.27	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001723.5	0.27	PKS	oviedomycin	Streptomyces antibioticus
BGC0000218.5	0.26	PKS	doxorubicin	Streptomyces peucetius
BGC0002493.3	0.26	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000235.5	0.26	PKS	kiamycin	Streptomyces sp. W007

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002510.2	0.53	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000056.3	0.49	PKS	esperamicin	Actinomadura verrucosospora
BGC0000231.5	0.48	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001987.2	0.47	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001723.5	0.47	PKS	oviedomycin	Streptomyces antibioticus
BGC0000217.5	0.47	PKS	daunorubicin	Streptomyces sp.
BGC0000234.5	0.47	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.46	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000218.5	0.46	PKS	doxorubicin	Streptomyces peucetius

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (13):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.26 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.57 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.84 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.54 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.49 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.39 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.21 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 26.85

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.95 out of 36.54

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.04 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

AB852_RS30410: mal

PKS_AT (9..297): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 90.2
Methylmalonyl-CoA: 41.7
Methoxymalonyl-CoA: 40.0
inactive: 30.0
Propionyl-CoA: 26.6
trans-1,2-CPDA: 10.8
CHC-CoA: 9.4
Ethylmalonyl-CoA: 8.4
Isobutyryl-CoA: 7.8
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_LFBV01000011.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 77,323 - 118,432 nt. (total: 41,110 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AB852_RS34310: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

AB852_RS34335: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

AB852_RS34350: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AB852_RS34360: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acyltransferase

AB852_RS34405: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: deformylase hydrolase

AB852_RS34305: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

AB852_RS34370: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

AB852_RS34345: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.86	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.64	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000706.3	0.48	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0001078.5	0.46	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.86	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.75	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.64	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001310.5	0.63	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000280.5	0.48	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000706.3	0.48	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000281.3	0.47	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0001224.5	0.46	other (other)	reductasporine	uncultured bacterium
BGC0001078.5	0.46	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

Additional weak hits (13):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.57 out of 26.12

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.41 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.71 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.13 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.41 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.27 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.78 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.72 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.81 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.21 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.89 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_LFBV01000011.1 - Region 2 - PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 198,567 - 249,388 nt. (total: 50,822 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AB852_RS34835: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AB852_RS34840: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AB852_RS34950: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: hydrolase protease

AB852_RS34965: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AB852_RS35015: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: synthase

AB852_RS34940: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS34955: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.54	PKS	FR901512	fungal sp. No.14919
BGC0002154.2	0.52	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.52	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001268.4	0.48	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000660.5	0.38	terpene	albaflavenone	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001268.4	0.58	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.76 out of 23.79

Confidence: medium

Additional weak hits (16):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.17 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.28 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.03 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.51 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.17 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.66 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.22 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.60 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.24 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.65 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.41 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.73 out of 20.01

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.18 out of 27.04

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.23 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.34 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 198566 - 249388:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 198566 - 246165:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 208404 - 249388:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS34940: pk

PKS_AT (567..863): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 98.7
Malonyl-CoA: 93.7
Methoxymalonyl-CoA: 93.1
Isobutyryl-CoA: 60.0
Ethylmalonyl-CoA: 49.0
Propionyl-CoA: 47.6
2-Methylbutyryl-CoA: 41.8
CHC-CoA: 27.2
trans-1,2-CPDA: 24.9
Acetyl-CoA: 23.1
Benzoyl-CoA: 22.0
inactive: 20.3
3-Methylbutyryl-CoA: 17.3
fatty_acid: 17.1

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism

NZ_LFBV01000012.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 110,675 - 136,979 nt. (total: 26,305 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

AB852_RS35730: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

AB852_RS35735: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.42	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000529.5	0.38	ribosomal	microbisporicin A2	Microbispora corallina
BGC0002120.3	0.36	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000796.3	0.25	saccharide	S-layer glycan	Paenibacillus alvei
BGC0002448.2	0.24	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000712.5	0.21	saccharide	paromomycin	Streptomyces rimosus subsp. paromomycinus
BGC0002587.2	0.18	PKS	ossamycin	Streptomyces ossamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.42	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000529.5	0.38	ribosomal	microbisporicin A2	Microbispora corallina
BGC0002120.3	0.36	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000796.3	0.25	saccharide	S-layer glycan	Paenibacillus alvei
BGC0002448.2	0.24	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000712.5	0.21	saccharide	paromomycin	Streptomyces rimosus subsp. paromomycinus
BGC0002587.2	0.18	PKS	ossamycin	Streptomyces ossamyceticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (4):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.53 out of 32.74

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 127 - 219; Score: 54.2

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_LFBV01000013.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 12,496 - 34,013 nt. (total: 21,518 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AB852_RS36415: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

AB852_RS36440: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

AB852_RS41235: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase

AB852_RS36450: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000851.5	0.66	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001986.3	0.55	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001948.3	0.50	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002496.3	0.43	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000231.5	0.41	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002073.3	0.40	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002382.3	0.39	ribosomal	grimoviridin	Grimontia marina
BGC0002425.3	0.39	ribosomal	stlassin	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000851.5	0.66	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001986.3	0.55	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001948.3	0.50	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0002496.3	0.43	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000231.5	0.41	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002073.3	0.40	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002382.3	0.39	ribosomal	grimoviridin	Grimontia marina
BGC0002425.3	0.39	ribosomal	stlassin	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.50 out of 30.12

Confidence: medium

Additional weak hits (3):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator

NZ_LFBV01000013.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 49,526 - 60,896 nt. (total: 11,371 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.76	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000588.5	0.40	ribosomal	microcin L	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.76	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000558.5	0.42	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0002698.2	0.41	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000588.5	0.40	ribosomal	microcin L	Escherichia coli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.93 out of 28.19

Confidence: strong

Additional weak hits (17):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.71 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.25 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.40 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.43 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.48 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.43 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.55 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.90 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.31 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 11.50 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.21 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.01 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.77 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.20 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.62 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.30 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_LFBV01000002.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 3,237 - 131,262 nt. (total: 128,026 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AB852_RS08725: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AB852_RS08735: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

AB852_RS08835: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase acylase aminotransferase methyltransferase

AB852_RS08685: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AB852_RS08705: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

AB852_RS08740: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AB852_RS08790: methyltransferase

smcogs: SMCOG1089: methyltransferase

AB852_RS40200: methyltransferase

smcogs: SMCOG1089: methyltransferase

AB852_RS41480: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: deaminase esterase phosphatase

AB852_RS08695: thioesterase

smcogs: SMCOG1004: thioesterase

AB852_RS08720: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

AB852_RS08855: thioesterase

smcogs: SMCOG1004: thioesterase

AB852_RS08880: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: ligase synthase

AB852_RS08745: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS08750: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS08755: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS08760: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AB852_RS08765: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

AB852_RS08770: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS08775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS08820: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AB852_RS08825: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AB852_RS08850: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AB852_RS08865: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS08870: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS08890: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000028.5	0.67	PKS	bafilomycin B1	Streptomyces lohii
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.54	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001050.5	0.51	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002706.2	0.44	NRPS	saframycin Mx1	Myxococcus xanthus
BGC0001273.3	0.43	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.43	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.42	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.42	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.40	PKS	oronofacic acid	Pseudomonas syringae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000028.5	0.82	PKS	bafilomycin B1	Streptomyces lohii
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001348.5	0.72	PKS	JBIR-100	Streptomyces varsoviensis
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.54 out of 18.46

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.98 out of 23.79

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.44 out of 27.18

Confidence: medium

Additional weak hits (10):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.72 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.42 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.57 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.33 out of 24.78

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.28 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.50 out of 32.74

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.18 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 3236 - 131262:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Me-mal - pk - ohmal - Me-mal) + (pk - ohemal - ccmal) + (pk - Me-redmal) + (Me-ohmal - Me-ccmal) + (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 3236 - 101381:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - pk - ohmal - Me-mal) + (pk - ohemal - ccmal) + (pk - Me-redmal) + (Me-ohmal - Me-ccmal) + (Me-ccmal)
Non-colinear ordering:: AB852_RS08760 + AB852_RS08755 + AB852_RS08750 + AB852_RS08745 + AB852_RS08740

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 87851 - 131262:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS08680: X

AMP-binding (96..309): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RFVTLIGGVQEVNTRLSGTT--YG---NTFGNAA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AB852_RS08740: mmal

PKS_AT (569..864): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 219.2
Ethylmalonyl-CoA: 214.1
Methoxymalonyl-CoA: 182.4
2-Methylbutyryl-CoA: 170.8
trans-1,2-CPDA: 151.0
Propionyl-CoA: 125.3
CHC-CoA: 114.7
Malonyl-CoA: 113.4
Isobutyryl-CoA: 82.6
Benzoyl-CoA: 76.0
fatty_acid: 56.4
Acetyl-CoA: 40.4
3-Methylbutyryl-CoA: 37.5
inactive: 32.9

AB852_RS08745: mmal - mmal

PKS_AT (580..879): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 220.9
Ethylmalonyl-CoA: 215.7
Methoxymalonyl-CoA: 184.7
2-Methylbutyryl-CoA: 152.1
trans-1,2-CPDA: 123.9
Propionyl-CoA: 112.3
CHC-CoA: 106.9
Malonyl-CoA: 103.5
Isobutyryl-CoA: 89.9
Benzoyl-CoA: 79.0
Acetyl-CoA: 57.6
3-Methylbutyryl-CoA: 53.4
inactive: 46.7
fatty_acid: 38.6

PKS_AT (2140..2434): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 226.7
Ethylmalonyl-CoA: 226.0
Methoxymalonyl-CoA: 181.5
2-Methylbutyryl-CoA: 166.9
trans-1,2-CPDA: 143.5
Propionyl-CoA: 121.1
CHC-CoA: 116.9
Malonyl-CoA: 107.1
Isobutyryl-CoA: 88.7
Benzoyl-CoA: 75.8
Acetyl-CoA: 60.2
fatty_acid: 49.7
3-Methylbutyryl-CoA: 36.9
inactive: 34.0

AB852_RS08750: pk - mmal

PKS_AT (574..872): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 244.0
Methylmalonyl-CoA: 234.7
Methoxymalonyl-CoA: 193.2
2-Methylbutyryl-CoA: 177.7
trans-1,2-CPDA: 150.9
Malonyl-CoA: 128.7
Propionyl-CoA: 126.6
CHC-CoA: 122.0
Isobutyryl-CoA: 92.1
Benzoyl-CoA: 86.9
Acetyl-CoA: 54.2
3-Methylbutyryl-CoA: 44.0
fatty_acid: 34.2
inactive: 30.1

PKS_AT (2336..2630): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 227.2
Ethylmalonyl-CoA: 223.0
Methoxymalonyl-CoA: 180.7
2-Methylbutyryl-CoA: 172.9
trans-1,2-CPDA: 142.7
Propionyl-CoA: 125.5
CHC-CoA: 112.9
Malonyl-CoA: 107.2
Isobutyryl-CoA: 84.9
Benzoyl-CoA: 73.7
fatty_acid: 52.5
Acetyl-CoA: 52.1
3-Methylbutyryl-CoA: 36.5
inactive: 32.3

AB852_RS08755: pk - emal - mal

PKS_AT (568..868): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 230.8
Methylmalonyl-CoA: 230.3
Methoxymalonyl-CoA: 190.3
2-Methylbutyryl-CoA: 168.6
trans-1,2-CPDA: 149.6
Propionyl-CoA: 128.0
CHC-CoA: 115.6
Malonyl-CoA: 108.1
Isobutyryl-CoA: 88.4
Benzoyl-CoA: 77.0
Acetyl-CoA: 60.1
fatty_acid: 49.5
3-Methylbutyryl-CoA: 43.3
inactive: 33.0

PKS_AT (2149..2447): emal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 95.8%; Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 95.8%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 220.1
Methylmalonyl-CoA: 199.5
Methoxymalonyl-CoA: 180.8
trans-1,2-CPDA: 144.2
2-Methylbutyryl-CoA: 130.2
Propionyl-CoA: 100.9
CHC-CoA: 92.7
Malonyl-CoA: 91.2
Benzoyl-CoA: 57.2
Isobutyryl-CoA: 56.0
Acetyl-CoA: 44.3
3-Methylbutyryl-CoA: 35.3
fatty_acid: 34.3
inactive: 27.7

PKS_AT (3718..4016): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.0
inactive: 97.3
Methoxymalonyl-CoA: 60.6
Methylmalonyl-CoA: 52.8
Acetyl-CoA: 31.7
Propionyl-CoA: 26.5
Ethylmalonyl-CoA: 18.0
CHC-CoA: 16.0
Benzoyl-CoA: 14.7
Isobutyryl-CoA: 13.7
2-Methylbutyryl-CoA: 12.1
fatty_acid: 5.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

AB852_RS08760: mmal - pk - mal - mmal

PKS_AT (99..398): mmal

ATSignature: Isobutyryl-CoA

Top 3 matches:: Isobutyryl-CoA: 83.3%; Methoxymalonyl-CoA: 70.8%; Methylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 155.9
2-Methylbutyryl-CoA: 153.6
Ethylmalonyl-CoA: 150.1
Methoxymalonyl-CoA: 134.5
Propionyl-CoA: 123.5
CHC-CoA: 101.9
Isobutyryl-CoA: 86.3
trans-1,2-CPDA: 82.4
Malonyl-CoA: 77.0
Benzoyl-CoA: 54.0
Acetyl-CoA: 36.4
3-Methylbutyryl-CoA: 30.2
inactive: 20.0
fatty_acid: 17.2

PKS_AT (1104..1398): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 225.6
Methylmalonyl-CoA: 222.2
Methoxymalonyl-CoA: 179.4
2-Methylbutyryl-CoA: 155.6
trans-1,2-CPDA: 141.6
Propionyl-CoA: 114.1
CHC-CoA: 109.4
Malonyl-CoA: 98.9
Isobutyryl-CoA: 78.3
Benzoyl-CoA: 68.2
Acetyl-CoA: 53.0
fatty_acid: 48.4
3-Methylbutyryl-CoA: 34.3
inactive: 30.4

PKS_AT (2695..3006): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.1
inactive: 111.0
Methoxymalonyl-CoA: 63.4
Methylmalonyl-CoA: 53.0
Propionyl-CoA: 38.8
Isobutyryl-CoA: 25.9
Ethylmalonyl-CoA: 21.2
Acetyl-CoA: 19.0
Benzoyl-CoA: 16.6
2-Methylbutyryl-CoA: 11.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4213..4509): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Malonyl-CoA: 87.5%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 203.7
Ethylmalonyl-CoA: 200.3
Methoxymalonyl-CoA: 169.6
2-Methylbutyryl-CoA: 145.5
trans-1,2-CPDA: 121.0
Propionyl-CoA: 118.2
CHC-CoA: 98.3
Malonyl-CoA: 89.9
Isobutyryl-CoA: 80.8
Benzoyl-CoA: 70.4
Acetyl-CoA: 51.3
3-Methylbutyryl-CoA: 49.9
fatty_acid: 41.7
inactive: 28.1

AB852_RS08770: X

AMP-binding (15..420): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGFLHSGATTDDLLTYVGSIQVYATSEAGFVSML
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AB852_RS08775: X

AMP-binding (10..410): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NTTLHTFGICGTMGFSGGSLEGYGLTETSPVVAY
Nearest Stachelhaus code(s):: nLev GFCMYGGCSK (76% 8Å match)
Stachelhaus code match:: 60% (weak)

AB852_RS08865: X

AMP-binding (23..417): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMKLVASPWEGFLTSGADLNLYGMTETASNVAA
Nearest Stachelhaus code(s):: diOH-Bz DAWGCGLINK (44% 8Å match); Leu DAYLTGLMNK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

AB852_RS08870: X

AMP-binding (45..463): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQAEVIATGELNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEMTADDK (91% 8Å match); Dab DIWELTADDK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_LFBV01000002.1 - Region 2 - CDPS,melanin

Download region GenBank file

Download region SVG

Location: 137,408 - 162,702 nt. (total: 25,295 nt) Show pHMM detection rules used

melanin: melC
CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AB852_RS09050: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase

AB852_RS09060: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

AB852_RS09065: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	1.05	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.52	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.52	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0000908.3	0.38	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.25	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.24	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000662.5	0.23	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001592.5	0.23	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000665.5	0.17	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.60	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.44	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000662.5	0.43	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001592.5	0.42	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.42	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

Additional weak hits (11):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.96 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.05 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.67 out of 23.43

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.37 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_LFBV01000002.1 - Region 3 - NRPS,NRPS-like,RiPP-like,T1PKS

Download region GenBank file

Download region SVG

Location: 174,534 - 280,315 nt. (total: 105,782 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

AB852_RS09210: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AB852_RS09225: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AB852_RS09260: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

AB852_RS09270: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AB852_RS09415: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AB852_RS09440: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

AB852_RS09470: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acetyltransferase aminotransferase methyltransferase sulfotransferase

AB852_RS09185: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

AB852_RS09285: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

AB852_RS09295: aminotransferase

smcogs: SMCOG1019: aminotransferase

AB852_RS09475: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AB852_RS09520: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

AB852_RS09525: methyltransferase

smcogs: SMCOG1089: methyltransferase

AB852_RS09535: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: amidase esterase hydrolase phosphatase protease

AB852_RS09205: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AB852_RS09275: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

AB852_RS09280: thioesterase

smcogs: SMCOG1004: thioesterase

AB852_RS09365: amidase

smcogs: SMCOG1105: amidase

AB852_RS37735: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: lyase

AB852_RS09200: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

AB852_RS09230: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS09250: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS09255: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS09425: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

AB852_RS09430: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AB852_RS09435: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS09445: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS09480: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS09495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000307.4	1.21	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	1.21	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	1.18	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	1.11	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001164.3	0.87	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.86	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002276.2	0.80	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002071.2	0.79	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001133.4	0.79	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000979.3	0.78	NRPS, PKS	cylindrospermopsin	Aphanizomenon sp. 10E9

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.29 out of 27.55

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.88 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (11):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.87 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.32 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.89 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.19 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.10 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.10 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 174533 - 232551:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 174533 - 222206:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 229545 - 280315:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Lys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 229545 - 276835:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Lys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 238662 - 280315:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Lys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS09230: X

AMP-binding (13..384): X

nrpys: Phe, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ANWAFTAFNTSPVAVSAAAADYYGIAETGPCTFE
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AB852_RS09250: X

AMP-binding (16..418): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ANTMHAHGLTSITARSASAIEAYGMTEAGSLVTS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AB852_RS09255: mal

PKS_AT (585..893): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.5
inactive: 85.9
Methoxymalonyl-CoA: 62.8
Methylmalonyl-CoA: 44.3
Propionyl-CoA: 36.7
Isobutyryl-CoA: 33.3
Ethylmalonyl-CoA: 22.8
fatty_acid: 16.7
Acetyl-CoA: 16.2
2-Methylbutyryl-CoA: 15.6
Benzoyl-CoA: 12.9
3-Methylbutyryl-CoA: 12.7
CHC-CoA: 11.1
trans-1,2-CPDA: 0.0

AB852_RS09445: X

AMP-binding (15..362): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NLSLHQYGLSLTDGCVGGALDGYGATEVGNIALA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AB852_RS09480: X - Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (444..794): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MRSIFDISVWEAQVVSIGEWNTYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQVGVIWK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1490..1865): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: lys (Lys)

Stachelhaus prediction details:

Stachelhaus sequence:: LAFPFDAAFGDPDTMVGGDHNHYGPTEATVCATS
Nearest Stachelhaus code(s):: CysA DATKMGHVGK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AB852_RS09495: X

AMP-binding (4..375): X

nrpys: Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDVAVADMCMIVAGEINAYGPTETTACATM
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (68% 8Å match); Tyr DAAIIAAVCK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
GnfM	Regulator of nitrogen-fixation genes
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LFBV01000002.1 - Region 4 - NI-siderophore,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 351,010 - 390,378 nt. (total: 39,369 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

AB852_RS09995: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: decarboxylase

AB852_RS09990: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.91	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.61	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000551.5	0.60	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.49	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.45	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000946.5	0.43	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.40	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001226.4	0.40	ribosomal	streptocollin	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.82	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000946.5	0.67	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000553.3	0.66	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002527.2	0.63	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000518.3	0.59	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AB852_RS09925

AB852_RS09920

Leader:

MALLDLQALDTPTEEFGDTAT

Core:

GSQVSLIVCEYSSLSALLCTP

Core with dehydrations:

GDhaQVDhaLIVCysEYDhaDhaLDhaALLCysDhbP

antiSMASH-DB 4.0 matches for AB852_RS09920

100.0%

NZ_AQRJ01000051.1and 1 other:

NZ_LFBV01000002.1 Lanthipeptides: AB852_RS09920_lanthipeptide

Lanthipeptides: YW7_RS14945_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSLIVCEYSSLSALLCTP

1

GSQVSLIVCEYSSLSALLCTP

21

85.7%

NC_010572.1and 60 others:

NC_021177.1 Lanthipeptides: SFUL_RS24355_lanthipeptideNZ_AQRK01000102.1 Lanthipeptides: YUW_RS30025_lanthipeptideNZ_ARPF01000003.1 Lanthipeptides: B083_RS0107255_lanthipeptideNZ_BMRY01000001.1 Lanthipeptides: IE140_RS02070_lanthipeptideNZ_BMSP01000003.1 Lanthipeptides: IE150_RS06495_lanthipeptideNZ_BMSZ01000003.1 Lanthipeptides: IE135_RS07550_lanthipeptideNZ_BMTW01000017.1 Lanthipeptides: IE134_RS28550_lanthipeptideNZ_BMUG01000009.1 Lanthipeptides: IE264_RS25430_lanthipeptideNZ_BMVK01000002.1 Lanthipeptides: IE272_RS07115_lanthipeptideNZ_BNBJ01000002.1 Lanthipeptides: IE304_RS05195_lanthipeptideNZ_CM003601.1 Lanthipeptides: JI76_RS25200_lanthipeptideNZ_CP010833.1 Lanthipeptides: TK78_RS10875_lanthipeptideNZ_CP011522.1 Lanthipeptides: ABE83_RS11805_lanthipeptideNZ_CP013738.1 Lanthipeptides: WQO_RS23525_lanthipeptideNZ_CP015362.1 Lanthipeptides: A6E92_RS09975_lanthipeptideNZ_CP020563.1 Lanthipeptides: B7C62_RS24450_lanthipeptideNZ_CP020570.1 Lanthipeptides: B1H20_RS34690_lanthipeptideNZ_CP024957.1 Lanthipeptides: CVT27_RS22730_lanthipeptideNZ_CP029361.1 Lanthipeptides: DIJ69_RS10225_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS22865_lanthipeptideNZ_CP061072.1 Lanthipeptides: HYC88_RS10560_lanthipeptideNZ_CP079114.1 Lanthipeptides: KV381_RS24895_lanthipeptideNZ_CP084357.1 Lanthipeptides: LEL86_RS29435_lanthipeptideNZ_CP086102.1 Lanthipeptides: LK895_RS11660_lanthipeptideNZ_CP090837.1 Lanthipeptides: LZ559_RS24025_lanthipeptideNZ_CP096281.1 Lanthipeptides: MWG59_RS25685_lanthipeptideNZ_CP101397.1 Lanthipeptides: NLU04_RS06465_lanthipeptideNZ_CP110539.1 Lanthipeptides: OH133_RS12690_lanthipeptideNZ_CP112880.1 Lanthipeptides: N7925_RS11185_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS22935_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS24530_lanthipeptideNZ_DS999644.1 Lanthipeptides: SSGG_RS09925_lanthipeptideNZ_GL877172.1 Lanthipeptides: SACT1_RS12960_lanthipeptideNZ_JAAWWP010000002.1 Lanthipeptides: HFV08_RS04115_lanthipeptideNZ_JAGGOV010000004.1 Lanthipeptides: J7E92_RS02930_lanthipeptideNZ_JAHHWT010000009.1 Lanthipeptides: KM153_RS24430_lanthipeptideNZ_JALDPQ010000064.1 Lanthipeptides: MQC87_RS23965_lanthipeptideNZ_JAMFLF010000002.1 Lanthipeptides: M1212_RS07295_lanthipeptideNZ_JANRMN010000004.1 Lanthipeptides: NW249_RS08610_lanthipeptideNZ_JNLT01000003.1 Lanthipeptides: CD02_RS0108685_lanthipeptideNZ_KB890925.1 Lanthipeptides: B053_RS0113845_lanthipeptideNZ_KL573549.1 Lanthipeptides: BG84_RS0119125_lanthipeptideNZ_KQ257779.1 Lanthipeptides: IQ60_RS22540_lanthipeptideNZ_KZ195572.1 Lanthipeptides: B9W61_RS11940_lanthipeptideNZ_KZ679082.1 Lanthipeptides: C6W96_RS24050_lanthipeptideNZ_KZ819154.1 Lanthipeptides: DBP12_RS10285_lanthipeptideNZ_KZ819178.1 Lanthipeptides: DBP20_RS23960_lanthipeptideNZ_KZ819182.1 Lanthipeptides: DBP21_RS24660_lanthipeptideNZ_LACR01000009.1 Lanthipeptides: YW5_RS12280_lanthipeptideNZ_LIPB01000001.1 Lanthipeptides: AMK17_RS03280_lanthipeptideNZ_LIPE01000001.1 Lanthipeptides: AMK12_RS03355_lanthipeptideNZ_LIVT01000001.1 Lanthipeptides: AMK24_RS01700_lanthipeptideNZ_LIVW01000001.1 Lanthipeptides: AMK28_RS03165_lanthipeptideNZ_LIXK01000001.1 Lanthipeptides: AMK23_RS04085_lanthipeptideNZ_LMEL01000012.1 Lanthipeptides: ASD29_RS10010_lanthipeptideNZ_LZRD01000054.1 Lanthipeptides: A3Q37_RS33745_lanthipeptideNZ_ML123117.1 Lanthipeptides: EES46_RS10300_lanthipeptideNZ_NNBN01000004.1 Lanthipeptides: CG717_RS12310_lanthipeptideNZ_VEHK01000004.1 Lanthipeptides: FS984_RS13530_lanthipeptideNZ_WWGD01000029.1 Lanthipeptides: GTY72_RS23245_lanthipeptide

Lanthipeptides: SGR_RS11800_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL+VCEYSSLS +LCTP

1

GSQVSLLVCEYSSLSVVLCTP

21

85.7%

NZ_BDHJ01000008.1and 4 others:

NZ_CP032543.1 Lanthipeptides: D6270_RS22715_lanthipeptideNZ_CP076457.1 Lanthipeptides: KME66_RS09945_lanthipeptideNZ_CP077652.1 Lanthipeptides: KRR37_RS22855_lanthipeptideNZ_WUEJ01000001.1 Lanthipeptides: GRQ63_RS04560_lanthipeptide

Lanthipeptides: BHQ08_RS03045_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL+VCEYSSLS LCTP

1

GSQVSLLVCEYSSLSVTLCTP

21

with 49 more sequence matches

Only the first 10 are displayed here.

81.0%

NZ_CM001165.1and 4 others:

NZ_CP021118.1 Lanthipeptides: CAC01_RS28155_lanthipeptideNZ_CP049945.1 Lanthipeptides: G9U55_RS17850_lanthipeptideNZ_CP119149.1 Lanthipeptides: P0D76_RS02270_lanthipeptideNZ_RWGV01000033.1 Lanthipeptides: EJA11_RS20985_lanthipeptide

Lanthipeptides: STTU_RS29395_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL++CEYSSLS LCTP

1

GSQVSLLICEYSSLSVTLCTP

21

81.0%

NZ_CP010519.1and 1 other:

NZ_CP092644.1 Lanthipeptides: MID12_RS21330_lanthipeptide

Lanthipeptides: SLNWT_RS22370_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL+VCEYSSLS +LC+P

1

GSQVSLLVCEYSSLSVVLCSP

21

81.0%

NZ_CP045178.1:

Lanthipeptides: GBW32_RS28450_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL++CEYSSLS +LCTP

1

GSQVSLLICEYSSLSVVLCTP

21

81.0%

NZ_CP045702.1:

Lanthipeptides: F0344_RS33200_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL+VCE+SSLS LCTP

1

GSQVSLLVCEHSSLSLTLCTP

21

81.0%

NZ_CP054926.1and 11 others:

NZ_CP068598.1 Lanthipeptides: IFE09_RS23820_lanthipeptideNZ_CP071044.1 Lanthipeptides: JHY03_RS23495_lanthipeptideNZ_CP080029.1 Lanthipeptides: KZO11_RS24935_lanthipeptideNZ_JAJUKK010000008.1 Lanthipeptides: LXH09_RS27635_lanthipeptideNZ_JOJC01000009.1 Lanthipeptides: IO23_RS0108435_lanthipeptideNZ_KB891296.1 Lanthipeptides: B061_RS0103425_lanthipeptideNZ_KZ268499.1 Lanthipeptides: CE422_RS23450_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS22830_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS10975_lanthipeptideNZ_LZQS01000001.1 Lanthipeptides: STIB_RS05225_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS24840_lanthipeptide

Lanthipeptides: HUT09_RS23550_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL+VCE+SSLS +LCTP

1

GSQVSLLVCEFSSLSVVLCTP

21

81.0%

NZ_CP058556.1and 5 others:

NZ_CP059898.1 Lanthipeptides: H3V39_RS22935_lanthipeptideNZ_CP070242.1 Lanthipeptides: I6J39_RS23755_lanthipeptideNZ_CP070260.1 Lanthipeptides: I6J40_RS10935_lanthipeptideNZ_JAJDST010000047.1 Lanthipeptides: LJC81_RS16960_lanthipeptideNZ_WWGL01000003.1 Lanthipeptides: GTY38_RS03410_lanthipeptide

Lanthipeptides: HXS80_RS11105_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVS++VCEYSSLS +LCTP

1

GSQVSVLVCEYSSLSVVLCTP

21

76.2%

NC_020990.1and 26 others:

NZ_AMPN02000002.1 Lanthipeptides: SM8_RS12785_lanthipeptideNZ_AP025692.1 Lanthipeptides: MTP06_RS18190_lanthipeptideNZ_CM002273.1 Lanthipeptides: B590_RS12280_lanthipeptideNZ_CP009802.1 Lanthipeptides: SFR_RS12925_lanthipeptideNZ_CP014485.1 Lanthipeptides: Salbus254_RS12710_lanthipeptideNZ_CP016824.1 Lanthipeptides: BEN82_RS18165_lanthipeptideNZ_CP026490.1 Lanthipeptides: C3K23_RS19520_lanthipeptideNZ_CP031742.1 Lanthipeptides: D0C37_RS13445_lanthipeptideNZ_CP047147.1 Lanthipeptides: GR131_RS18520_lanthipeptideNZ_CP053539.1 Lanthipeptides: HN026_RS11800_lanthipeptideNZ_CP056773.1 Lanthipeptides: HWN34_RS12245_lanthipeptideNZ_CP063844.1 Lanthipeptides: IPZ55_RS12410_lanthipeptideNZ_CP064783.1 Lanthipeptides: IT782_RS12060_lanthipeptideNZ_CP076385.1 Lanthipeptides: KNZ81_RS12450_lanthipeptideNZ_CP079112.1 Lanthipeptides: STALF2_RS18135_lanthipeptideNZ_CP091820.1 Lanthipeptides: L2I08_RS02835_lanthipeptideNZ_CP106650.1 Lanthipeptides: B591_RS12385_lanthipeptideNZ_CP113103.1 Lanthipeptides: OSU72_RS17905_lanthipeptideNZ_JAHUVY010000001.1 Lanthipeptides: STALF3_RS17905_lanthipeptideNZ_JALLPQ010000001.1 Lanthipeptides: MWG58_RS12385_lanthipeptideNZ_KB890715.1 Lanthipeptides: B048_RS0115750_lanthipeptideNZ_KN549183.1 Lanthipeptides: D076_RS30740_lanthipeptideNZ_KZ195583.1 Lanthipeptides: B9W68_RS12440_lanthipeptideNZ_MNPQ01000004.1 Lanthipeptides: BGV78_RS11170_lanthipeptideNZ_OX371412.1 Lanthipeptides: OZE77_RS18215_lanthipeptideNZ_VOGX01000092.1 Lanthipeptides: FRZ02_RS31600_lanthipeptide

Lanthipeptides: XNR_RS11575_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQ+SL++CEYSSLS LCTP

1

GSQISLLICEYSSLSVTLCTP

21

76.2%

NZ_LWLE01000019.1:

Lanthipeptides: A6A29_RS44250_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL++CE+SSLS LCTP

1

GSQVSLLICEHSSLSLTLCTP

21

76.2%

NZ_ML123034.1:

Lanthipeptides: EES43_RS19795_lanthipeptide

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL++CE+SSLS LCTP

1

GSQVSLLICEFSSLSVTLCTP

21

57.1%

NZ_BMVR01000001.1:

Lanthipeptides: IE274_RS00225_lanthipeptide

1

GSQVSLIVCEYSSLSALLC

19

GSQVSL++C S S LLC

3

GSQVSLLLCA-SQASFLLC

20

MIBiG 4.0 matches for AB852_RS09920

81.8%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

GSQVSLIVCEYSSLSALLCTP

21

GSQVSL+VCEYSSLS +LCTP

2

GSQVSLLVCEYSSLSVVLCTP

22

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.66 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.66 out of 30.11

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.88 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.90 out of 36.53

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.81 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 27.04

Confidence: medium

Additional weak hits (11):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.13 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.55 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.72 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.59 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.16 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 27.04

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.36 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.68 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.68 out of 23.43

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

AB852_RS09920 - Class III

Cleavage pHMM score: 18.00

RODEO score: 0

Monoisotopic mass: 2061.1 Da

Molecular weight: 2062.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2080.4 Da N = 1; 2098.4 Da N = 2; 2116.4 Da N = 3; 2134.5 Da N = 4

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor

NZ_LFBV01000002.1 - Region 5 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 671,271 - 740,811 nt. (total: 69,541 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AB852_RS11290: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

AB852_RS11320: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

AB852_RS11400: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AB852_RS11410: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

AB852_RS11420: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: deacetylase peptidase

AB852_RS11255: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

AB852_RS11365: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: ligase synthase

AB852_RS11275: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS11355: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AB852_RS11360: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AB852_RS40645: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	1.28	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001250.4	1.08	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	1.08	NRPS	epichloenin A	Epichloe festucae
BGC0001132.4	1.07	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.06	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.04	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	1.02	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.02	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	1.02	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001249.5	1.00	NRPS	dimethylcoprogen	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.85 out of 23.79

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.76 out of 27.55

Confidence: medium

Additional weak hits (16):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.87 out of 35.63

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 30.11

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.24 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.54 out of 27.78

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.22 out of 29.51

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.63 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.14 out of 32.93

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.23 out of 27.04

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.87 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.88 out of 33.14

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.86 out of 27.04

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.56 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 671270 - 740811:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Gly) + (Asp) + (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 17, location 671270 - 720204:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Gly) + (Asp) + (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 18, location 687359 - 740811:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Gly) + (Asp) + (AHBA - ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS11275: AHBA - mal

CAL_domain (36..461): AHBA

minowa: AHBA

Prediction, score:

AHBA: 218.0
shikimic_acid: 161.6
fatty_acid: 0.0
Acetyl-CoA: 0.0
NH2: -1.2

PKS_AT (1268..1571): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 165.1
inactive: 83.4
Methoxymalonyl-CoA: 58.8
Methylmalonyl-CoA: 58.3
Isobutyryl-CoA: 29.6
Ethylmalonyl-CoA: 29.3
Propionyl-CoA: 21.3
fatty_acid: 18.7
Benzoyl-CoA: 18.0
Acetyl-CoA: 12.7
2-Methylbutyryl-CoA: 7.8
trans-1,2-CPDA: 3.2
CHC-CoA: 2.0
3-Methylbutyryl-CoA: 0.0

AB852_RS40645: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (632..1099): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQFDFGLTTLKLVLGGEINHYGPTEATVGATT
Nearest Stachelhaus code(s):: Asp DLTKVGHVGK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

AB852_RS11355: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (451..837): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LAFTFDISALELQALSGGEWNVYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AB852_RS11360: X

AMP-binding (39..452): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GLHFTNAGQVMSFLSSSAAVNVYTSSEAAPAQLS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism

NZ_LFBV01000002.1 - Region 6 - ectoine

Download region GenBank file

Download region SVG

Location: 829,443 - 839,814 nt. (total: 10,372 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: transferase

AB852_RS11890: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: amidase

AB852_RS11905: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase

AB852_RS11885: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS11900: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0000393.5	0.41	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0001627.4	0.39	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0002594.2	0.37	PKS	orcinol, orsellinic acid	Fusarium graminearum PH-1
BGC0002591.2	0.35	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0002056.3	0.35	NRPS, PKS	peloruside A	sponge metagenome
BGC0001582.4	0.34	NRPS	ecumicin	Nonomuraea sp. MJM5123
BGC0001235.4	0.34	NRPS, PKS	antalid	Polyangium spumosum
BGC0002352.2	0.34	other (other)	terpenibactin A, terpenibactin B, terpenibactin C	Nocardia terpenica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii
BGC0001778.5	0.41	other (other)	showdomycin	Streptomyces showdoensis
BGC0000393.5	0.41	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0001627.4	0.39	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0002594.2	0.37	PKS	orcinol, orsellinic acid	Fusarium graminearum PH-1
BGC0002591.2	0.35	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0002056.3	0.35	NRPS, PKS	peloruside A	sponge metagenome
BGC0001582.4	0.34	NRPS	ecumicin	Nonomuraea sp. MJM5123
BGC0001235.4	0.34	NRPS, PKS	antalid	Polyangium spumosum
BGC0002352.2	0.34	other (other)	terpenibactin A, terpenibactin B, terpenibactin C	Nocardia terpenica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.75 out of 30.25

Confidence: medium

Additional weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.84 out of 30.25

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.71 out of 27.18

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ColR	Phenol-responsive regulator

NZ_LFBV01000002.1 - Region 7 - betalactone

Download region GenBank file

Download region SVG

Location: 879,469 - 907,413 nt. (total: 27,945 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase phosphate reductase

AB852_RS12140: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

AB852_RS12175: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase kinase

AB852_RS12115: aminotransferase

smcogs: SMCOG1019: aminotransferase

AB852_RS12135: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Ligases: ligase synthase

AB852_RS12120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS12155: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.55	NRPS	AM-toxin	Alternaria alternata
BGC0000895.5	0.46	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002000.4	0.41	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000131.5	0.41	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002514.3	0.40	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0001521.3	0.40	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001050.5	0.40	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001895.4	0.40	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000188.5	0.39	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0002047.2	0.39	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.55	NRPS	AM-toxin	Alternaria alternata
BGC0000895.5	0.46	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002000.4	0.41	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000131.5	0.41	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002514.3	0.40	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0001521.3	0.40	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001050.5	0.40	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001895.4	0.40	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000188.5	0.39	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0002047.2	0.39	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (9):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.37 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.81 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.19 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.82 out of 30.98

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
MexT	Global virulence regulator

NZ_LFBV01000002.1 - Region 8 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 922,674 - 957,216 nt. (total: 34,543 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AB852_RS12305: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: aminotransferase

AB852_RS12320: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: dehalogenase

AB852_RS12270: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase

AB852_RS12315: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

AB852_RS12325: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Translocases: transport

AB852_RS12340: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.67	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.62	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.62	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000941.3	0.60	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.60	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.60	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.59	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002305.2	0.59	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001531.5	0.58	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000295.5	0.57	NRPS	acinetoferrin	Acinetobacter haemolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.67	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001478.5	0.62	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0001572.3	0.62	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000941.3	0.60	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002692.2	0.60	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.60	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.59	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002305.2	0.59	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001531.5	0.58	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000295.5	0.57	NRPS	acinetoferrin	Acinetobacter haemolyticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.47 out of 27.04

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.49 out of 27.04

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.29 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.36 out of 36.53

Confidence: medium

Additional weak hits (7):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.65 out of 19.26

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.79 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.17 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.25 out of 36.53

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor

NZ_LFBV01000002.1 - Region 9 - RiPP-like

Download region GenBank file

Download region SVG

Location: 975,230 - 986,720 nt. (total: 11,491 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

AB852_RS12470: methyltransferase

smcogs: SMCOG1248: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000846.5	0.40	other (other)	tabtoxin	Pseudomonas syringae
BGC0002216.3	0.37	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001775.3	0.36	terpene	sespendole	Cordana terrestris
BGC0002229.2	0.35	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0000894.4	0.35	other (other)	citrinin	Monascus aurantiacus
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001722.3	0.34	PKS	aspernidine A	Aspergillus nidulans FGSC A4
BGC0001264.3	0.34	PKS	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0002670.2	0.32	other (other)	fosfonochlorin	Fusarium oxysporum f. sp. lycopersici 4287
BGC0000160.3	0.32	PKS	terreic acid	Aspergillus terreus NIH2624

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000846.5	0.40	other (other)	tabtoxin	Pseudomonas syringae
BGC0002216.3	0.37	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001775.3	0.36	terpene	sespendole	Cordana terrestris
BGC0002229.2	0.35	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0000894.4	0.35	other (other)	citrinin	Monascus aurantiacus
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001722.3	0.34	PKS	aspernidine A	Aspergillus nidulans FGSC A4
BGC0001264.3	0.34	PKS	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0002670.2	0.32	other (other)	fosfonochlorin	Fusarium oxysporum f. sp. lycopersici 4287
BGC0000160.3	0.32	PKS	terreic acid	Aspergillus terreus NIH2624

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (1):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.89 out of 27.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LFBV01000003.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 124,837 - 184,187 nt. (total: 59,351 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AB852_RS14840: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase methyltransferase

AB852_RS14725: methyltransferase

smcogs: SMCOG1089: methyltransferase

AB852_RS14905: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

AB852_RS14825: isochorismatase

smcogs: SMCOG1027: isochorismatase

AB852_RS14870: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AB852_RS14885: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Isomerases: isomerase

AB852_RS14835: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

AB852_RS14790: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AB852_RS14830: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

AB852_RS14770: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000392.5	0.84	NRPS	mirubactin	Actinosynnema mirum DSM 43827
BGC0002474.2	0.64	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001185.5	0.60	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000343.5	0.58	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001166.5	0.58	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.57	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000392.5	0.74	NRPS	mirubactin	Actinosynnema mirum DSM 43827
BGC0002474.2	0.65	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001185.5	0.64	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000343.5	0.63	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.24 out of 30.22

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 29.15 out of 32.38

Confidence: strong

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.70 out of 32.38

Confidence: medium

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 28.06 out of 32.93

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.44 out of 36.53

Confidence: medium

Additional weak hits (17):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.04 out of 19.26

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.37 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.11 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 25.37 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.30 out of 32.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.62 out of 20.01

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.14 out of 36.53

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.91 out of 36.54

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.65 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.78 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.22 out of 27.18

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.58 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 124836 - 184187:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-Arg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS14790: X - Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (466..881): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHQYFDSALEHWDTVLGGERNMYGPTEASVTSTT
Nearest Stachelhaus code(s):: Arg DSDDVGAVDK (74% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1957..2351): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LLQAFDVAFWQVNLMVGAEFNAYGPTEVTINSVT
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWNVGAVNK (94% 8Å match); Arg DVENVGAINK (47% 8Å match)
Stachelhaus code match:: 80% (moderate)

AB852_RS14830: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (34..433): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SESLFPLSSPGGGVLVGGAQQVFGMAEGLVCYTR
Nearest Stachelhaus code(s):: diOH-Bz PMPGLGVVCK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
CsoR	Copper-responsive repressor
DmdR1	Iron(II)-dependent repressor
RicR	Copper-responsive regulator

NZ_LFBV01000003.1 - Region 2 - NRPS,NRPS-like,T1PKS,melanin

Download region GenBank file

Download region SVG

Location: 242,994 - 352,983 nt. (total: 109,990 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

AB852_RS15190: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AB852_RS15200: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

AB852_RS15205: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

AB852_RS15260: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

AB852_RS15360: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

AB852_RS15480: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: aminotransferase glycosyltransferase kinase methyltransferase transferase

AB852_RS15215: methyltransferase

smcogs: SMCOG1089: methyltransferase

AB852_RS15225: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AB852_RS15240: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AB852_RS15375: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

AB852_RS15390: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

AB852_RS15400: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AB852_RS15415: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

AB852_RS15420: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

AB852_RS15495: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: peptidase

AB852_RS15475: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Lyases: dehydratase

AB852_RS15460: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

AB852_RS15230: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS15250: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS15255: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AB852_RS15435: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS15440: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

AB852_RS15515: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	1.81	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.79	other (other)	melanin	Streptomyces avermitilis
BGC0000911.3	0.78	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.77	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0002071.2	0.69	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0000428.5	0.68	NRPS	sibiromycin	Streptosporangium sibiricum
BGC0000909.3	0.62	other (other)	melanin	Streptomyces avermitilis
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.84	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002276.2	0.66	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.66	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000342.4	0.66	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.83 out of 30.22

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.60 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 26.86 out of 30.98

Confidence: medium

Additional weak hits (19):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.70 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.11 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.55 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.56 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.38 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.68 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.21 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.11 out of 39.62

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.37 out of 18.57

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.43 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.38 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.63 out of 26.06

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.98 out of 27.18

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.86 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 242993 - 352983:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal - ohmal) + (Me-ccmal) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 242993 - 308183:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal - ohmal) + (Me-ccmal)
Non-colinear ordering:: AB852_RS15250 + AB852_RS15255

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 306377 - 348210:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 308216 - 352983:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS15230: fatty_acid

CAL_domain (42..502): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 16.2
NH2: 13.3
shikimic_acid: 0.0
AHBA: -0.0
Acetyl-CoA: -2.6

AB852_RS15250: mal - mal - mal - mal

PKS_AT (518..802): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.6
inactive: 90.7
Methoxymalonyl-CoA: 71.7
Methylmalonyl-CoA: 55.9
Isobutyryl-CoA: 31.9
Propionyl-CoA: 29.9
Acetyl-CoA: 21.6
Ethylmalonyl-CoA: 18.6
2-Methylbutyryl-CoA: 13.1
Benzoyl-CoA: 11.9
fatty_acid: 11.3
CHC-CoA: 10.4
3-Methylbutyryl-CoA: -1.9
trans-1,2-CPDA: -2.3

PKS_AT (1574..1868): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 188.7
inactive: 77.7
Methylmalonyl-CoA: 56.5
Methoxymalonyl-CoA: 53.9
Propionyl-CoA: 43.2
Isobutyryl-CoA: 33.1
fatty_acid: 23.4
Benzoyl-CoA: 22.2
CHC-CoA: 19.1
Acetyl-CoA: 17.6
Ethylmalonyl-CoA: 16.7
trans-1,2-CPDA: 6.3
2-Methylbutyryl-CoA: 2.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (3304..3601): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 192.8
inactive: 93.5
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 58.5
Ethylmalonyl-CoA: 33.0
Isobutyryl-CoA: 30.7
Propionyl-CoA: 27.1
CHC-CoA: 19.4
Benzoyl-CoA: 13.2
2-Methylbutyryl-CoA: 12.7
Acetyl-CoA: 10.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5029..5320): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.2
inactive: 108.1
Methoxymalonyl-CoA: 64.6
Methylmalonyl-CoA: 47.4
Propionyl-CoA: 27.3
Acetyl-CoA: 19.5
Ethylmalonyl-CoA: 18.3
Benzoyl-CoA: 17.0
Isobutyryl-CoA: 14.5
CHC-CoA: 14.2
2-Methylbutyryl-CoA: 9.1
trans-1,2-CPDA: 7.5
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

AB852_RS15255: mmal

PKS_AT (579..874): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 205.4
Ethylmalonyl-CoA: 199.4
Methoxymalonyl-CoA: 175.5
2-Methylbutyryl-CoA: 142.2
trans-1,2-CPDA: 112.9
Malonyl-CoA: 103.7
Isobutyryl-CoA: 94.6
CHC-CoA: 92.6
Propionyl-CoA: 92.0
Benzoyl-CoA: 67.5
3-Methylbutyryl-CoA: 46.8
Acetyl-CoA: 32.8
inactive: 31.6
fatty_acid: 30.9

AB852_RS15435: X

AMP-binding (16..406): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VHNAFAASTTELNLIVSGDYNAYGCTENSALTAV
Nearest Stachelhaus code(s):: mxAnt AATHLSATLK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

AB852_RS15440: X

AMP-binding (591..996): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VRQMFDVSFEEGFLYTTGEINAYGPSEAHLCTAL
Nearest Stachelhaus code(s):: Trp or Tyr DVMFYTALVK (82% 8Å match); proPro DVLYYTALCK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
IolR	Regulator of the inositol catabolism
NuR	Nickel-responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LFBV01000003.1 - Region 3 - T1PKS,lassopeptide,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 428,240 - 517,508 nt. (total: 89,269 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AB852_RS15970: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AB852_RS15990: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AB852_RS16005: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AB852_RS16015: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

AB852_RS16090: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: PPTase acylase formyltransferase

AB852_RS15935: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

AB852_RS16095: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

AB852_RS40795: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase phosphatase

AB852_RS15870: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

AB852_RS15925: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

AB852_RS15995: thioesterase

smcogs: SMCOG1004: thioesterase

AB852_RS16000: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Lyases: decarboxylase

AB852_RS15955: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

AB852_RS15910: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AB852_RS15930: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AB852_RS15950: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS15980: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AB852_RS15985: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS16060: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS37875: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.86	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.86	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.83	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.83	PKS	asperlactone	Aspergillus ochraceus
BGC0001539.4	0.82	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.81	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.81	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001779.5	0.77	ribosomal	siamycin	Streptomyces nodosus
BGC0001507.3	0.75	ribosomal	anantin C	Streptomyces olindensis
BGC0001552.3	0.74	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001539.4	0.73	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.72	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.72	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001779.5	0.71	ribosomal	siamycin	Streptomyces nodosus
BGC0001507.3	0.70	ribosomal	anantin C	Streptomyces olindensis
BGC0001493.5	0.68	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes

Similar known clusters from MIBiG 4.0

Similar subclusters

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.73 out of 23.79

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.44 out of 36.53

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.65 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.76 out of 23.79

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.20 out of 29.51

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.86 out of 36.53

Confidence: medium

Additional weak hits (16):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.97 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.43 out of 19.26

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.53 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.27 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.59 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.70 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.36 out of 32.74

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 39.62

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.70 out of 30.12

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.40 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.12 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.05 out of 28.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.09 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 7, location 428239 - 517508:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ccmal) + (ccmal) + (ccmal)
Non-colinear ordering:: AB852_RS40795 + AB852_RS16060 + AB852_RS37875

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 428907 - 517508:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ccmal) + (ccmal) + (ccmal)
Non-colinear ordering:: AB852_RS40795 + AB852_RS16060 + AB852_RS37875

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS15950: X

AMP-binding (18..429): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSVLFDAGFSQTTGTNTGGYLMYGLTEAFRATYL
Nearest Stachelhaus code(s):: Asp DASTATMFRK (74% 8Å match); Asp DYYPTTMRAK (53% 8Å match); Kyn DAWTTTGVAK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

AB852_RS37875: mal

PKS_AT (2017..2316): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; 2-Rhyd-Malonyl-CoA: 66.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 121.1
inactive: 67.6
Methoxymalonyl-CoA: 62.5
Methylmalonyl-CoA: 47.5
Propionyl-CoA: 41.2
Isobutyryl-CoA: 27.0
fatty_acid: 22.9
Ethylmalonyl-CoA: 18.7
Benzoyl-CoA: 18.7
3-Methylbutyryl-CoA: 17.4
2-Methylbutyryl-CoA: 14.3
Acetyl-CoA: 10.1
trans-1,2-CPDA: 8.2
CHC-CoA: 0.0

AB852_RS16060: mal

PKS_AT (568..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.0
inactive: 89.3
Methoxymalonyl-CoA: 65.3
Methylmalonyl-CoA: 57.7
Ethylmalonyl-CoA: 32.3
Propionyl-CoA: 28.9
Acetyl-CoA: 23.2
Isobutyryl-CoA: 18.9
CHC-CoA: 16.5
fatty_acid: 11.8
Benzoyl-CoA: 11.0
trans-1,2-CPDA: 4.7
2-Methylbutyryl-CoA: 3.7
3-Methylbutyryl-CoA: 0.0

AB852_RS40795: mmal - mmal

PKS_AT (534..830): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 181.7
Ethylmalonyl-CoA: 168.2
Methoxymalonyl-CoA: 140.2
trans-1,2-CPDA: 120.3
CHC-CoA: 117.3
2-Methylbutyryl-CoA: 116.5
Propionyl-CoA: 108.8
Malonyl-CoA: 89.3
Isobutyryl-CoA: 52.0
Benzoyl-CoA: 47.9
Acetyl-CoA: 38.0
inactive: 33.3
3-Methylbutyryl-CoA: 26.3
fatty_acid: 25.8

PKS_AT (1560..1856): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 170.8
Ethylmalonyl-CoA: 148.1
Methoxymalonyl-CoA: 138.4
2-Methylbutyryl-CoA: 96.1
Malonyl-CoA: 92.5
trans-1,2-CPDA: 81.9
CHC-CoA: 79.7
Propionyl-CoA: 72.7
Isobutyryl-CoA: 59.9
Benzoyl-CoA: 48.4
3-Methylbutyryl-CoA: 38.9
inactive: 25.3
Acetyl-CoA: 20.3
fatty_acid: 16.8

Link to PARAS substrate predictor

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 84; Score: 87.2; RRE type: Lasso_Fused_RRE; Location: 0 - 55; Score: 33.5

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_LFBV01000003.1 - Region 4 - NRP-metallophore,NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 611,706 - 665,958 nt. (total: 54,253 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AB852_RS16745: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: methyltransferase

AB852_RS16675: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: esterase

AB852_RS16705: thioesterase

smcogs: SMCOG1004: thioesterase

Isomerases: isomerase

AB852_RS16685: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

AB852_RS16595: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

AB852_RS16660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS16670: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS16680: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	1.07	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	1.04	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.03	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	1.03	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	1.02	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.01	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	1.00	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	1.00	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.99	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.98	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 28.19

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.54 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.73 out of 36.53

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.46 out of 20.01

Confidence: strong

Additional weak hits (14):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.74 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.39 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.85 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.65 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.18 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.25 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.16 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.56 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.08 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.05 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 611705 - 665958:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (Fo-OH-Orn) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS16660: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (469..867): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AETTHDMSAFDGNSFTGGDVGVGGPSETTLWNIW
Nearest Stachelhaus code(s):: Cys DMFNFGVLWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AB852_RS16665: Fo-OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (499..893): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISVNELYVWCGGEYHGYGPAETTIGVSC
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AB852_RS16670: mal

PKS_AT (536..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 118.9
inactive: 67.4
Methoxymalonyl-CoA: 55.2
Methylmalonyl-CoA: 36.4
Ethylmalonyl-CoA: 29.4
Propionyl-CoA: 28.0
Isobutyryl-CoA: 16.7
fatty_acid: 10.4
2-Methylbutyryl-CoA: 9.9
Benzoyl-CoA: 6.0
CHC-CoA: 1.9
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AB852_RS16680: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (36..442): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NTMLFPLACPGGALQVGGAQQVFGMAEGLLCATR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVLCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
ArgR	Regulator of arginine biosynthesis genes
DmdR1	Iron(II)-dependent repressor
ZuR variant 1	Zinc-responsive repressor

NZ_LFBV01000003.1 - Region 5 - indole

Download region GenBank file

Download region SVG

Location: 713,999 - 737,271 nt. (total: 23,273 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AB852_RS16980: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AB852_RS16995: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AB852_RS17000: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AB852_RS17005: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AB852_RS17020: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: methyltransferase

AB852_RS16975: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

AB852_RS16990: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001334.5	0.90	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis
BGC0001333.5	0.63	other (other)	BE-54017	uncultured bacterium AB1650
BGC0000817.4	0.59	other (other)	methylarcyriarubin	uncultured bacterium
BGC0001223.5	0.59	other (other)	hydroxysporine	uncultured bacterium
BGC0001224.5	0.57	other (other)	reductasporine	uncultured bacterium
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001336.5	0.51	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000813.3	0.50	other (other)	K-252a	Nonomuraea longicatena
BGC0000821.5	0.48	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0000829.5	0.47	other (other)	violacein	Chromobacterium violaceum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001334.5	0.90	other (other)	caldoniamide A, cladoniamide B, cladoniamide C7, cladoniamide D, cladoniamide E, cladoniamide F, cladoniamide G	Streptomyces uncialis
BGC0001333.5	0.63	other (other)	BE-54017	uncultured bacterium AB1650
BGC0000817.4	0.59	other (other)	methylarcyriarubin	uncultured bacterium
BGC0001223.5	0.59	other (other)	hydroxysporine	uncultured bacterium
BGC0001224.5	0.57	other (other)	reductasporine	uncultured bacterium
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001336.5	0.51	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000813.3	0.50	other (other)	K-252a	Nonomuraea longicatena
BGC0000821.5	0.48	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0000829.5	0.47	other (other)	violacein	Chromobacterium violaceum

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (9):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.92 out of 30.25

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.86 out of 32.93

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.21 out of 29.51

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.44 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.26 out of 24.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.33 out of 27.18

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_LFBV01000004.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 45,935 - 78,612 nt. (total: 32,678 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AB852_RS17550: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

AB852_RS17505: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

AB852_RS17555: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002682.2	0.50	other (other)	aerobactin	Vibrio mimicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002682.2	0.50	other (other)	aerobactin	Vibrio mimicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.96 out of 29.72

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.48 out of 20.97

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.78 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.62 out of 27.18

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (9):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.95 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.38 out of 29.51

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.74 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.25 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.19 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
NtrC	Nitrogen regulatory protein C

NZ_LFBV01000004.1 - Region 2 - T1PKS,terpene-precursor

Download region GenBank file

Download region SVG

Location: 201,185 - 264,455 nt. (total: 63,271 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: Cyclization Dioxygenation dehydrogenase methyltransferase

AB852_RS18220: Dioxygenation

MITE: MITE0000094Dioxygenation (identity: 81.90%)

AB852_RS18225: Cyclization

MITE: MITE0000095Cyclization (identity: 75.80%)

AB852_RS18230: Dioxygenation

MITE: MITE0000096Dioxygenation (identity: 70.10%)
smcogs: SMCOG1042: O-methyltransferase

AB852_RS18240: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: carbamoyltransferase methyltransferase

AB852_RS18080: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

AB852_RS18230: Dioxygenation

MITE: MITE0000096Dioxygenation (identity: 70.10%)
smcogs: SMCOG1042: O-methyltransferase

AB852_RS18245: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: hydrolase

AB852_RS18085: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AB852_RS18100: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AB852_RS18285: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase synthetase

AB852_RS18150: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AB852_RS18275: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001377.5	1.08	PKS	uncialamycin	Streptomyces uncialis
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002276.2	0.47	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000056.3	0.38	PKS	esperamicin	Actinomadura verrucosospora
BGC0002387.2	0.31	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000252.5	0.26	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0000902.4	0.26	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001164.3	0.26	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.26	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.26	PKS	(-)-Mellein	Parastagonospora nodorum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001377.5	0.99	PKS	uncialamycin	Streptomyces uncialis
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.59	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000207.5	0.47	PKS	chartreusin	Streptomyces chartreusis

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AB852_RS18275: PT_FPPS_like

Domain 1 (73 - 329): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.14 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

Additional weak hits (19):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.38 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.71 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.88 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.68 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.43 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.80 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.53 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.73 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.67 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.20 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.22 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.39 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.10 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.69 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.12 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

AB852_RS18150: mal

PKS_AT (611..842): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 70.5
Methoxymalonyl-CoA: 41.0
Methylmalonyl-CoA: 34.4
inactive: 20.5
Isobutyryl-CoA: 18.5
Propionyl-CoA: 16.2
fatty_acid: 15.2
Ethylmalonyl-CoA: 9.4
Acetyl-CoA: 7.4
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

NZ_LFBV01000004.1 - Region 3 - RiPP-like,terpene

Download region GenBank file

Download region SVG

Location: 306,509 - 338,701 nt. (total: 32,193 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase synthase

AB852_RS18500: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

AB852_RS18540: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: deacetylase glucanase peptidase synthase

AB852_RS18475: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

AB852_RS18500: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

AB852_RS18530: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

AB852_RS18545: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Lyases: cyclase

AB852_RS40860: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.56	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001659.3	0.14	terpene	mangicol A	Fusarium equiseti
BGC0001285.5	0.12	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0000843.5	0.12	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001617.3	0.10	terpene	hirsutene	Stereum hirsutum FP-91666 SS1
BGC0000723.5	0.10	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0001578.3	0.10	PKS	duclauxin	Talaromyces stipitatus ATCC 10500
BGC0001480.3	0.10	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0000937.5	0.09	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0000232.5	0.09	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001659.3	0.43	terpene	mangicol A	Fusarium equiseti
BGC0001285.5	0.41	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0000843.5	0.41	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001617.3	0.37	terpene	hirsutene	Stereum hirsutum FP-91666 SS1
BGC0002387.2	0.37	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001377.5	0.37	PKS	uncialamycin	Streptomyces uncialis
BGC0000937.5	0.37	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0000723.5	0.37	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0000874.5	0.37	other (other)	blasticidin S	Streptomyces griseochromogenes

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH

Genes with terpene domains:

AB852_RS40860: T1TS + T1TS

Domain 1 (2 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (358 - 738): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.78 out of 29.72

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.66 out of 30.12

Confidence: medium

Additional weak hits (17):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.09 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.95 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.58 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.14 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.01 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.65 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.22 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.76 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.77 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.68 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.29 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.43 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LFBV01000004.1 - Region 4 - T3PKS

Download region GenBank file

Download region SVG

Location: 570,090 - 611,250 nt. (total: 41,161 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AB852_RS19670: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AB852_RS19675: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

AB852_RS19765: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AB852_RS19775: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Hydrolases: hydrolase

AB852_RS19795: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

AB852_RS19730: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.59	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.56	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000902.4	0.54	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.51	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000844.5	0.51	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002496.3	0.49	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.59	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.56	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000902.4	0.54	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.51	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000844.5	0.51	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001928.2	0.50	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002496.3	0.49	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

Additional weak hits (9):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.58 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.48 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.65 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.62 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.84 out of 36.53

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.63 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
OsdR	Development and stress management regulator

NZ_LFBV01000005.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 75,910 - 86,308 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AB852_RS20680: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase

AB852_RS20655: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

AB852_RS20665: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AB852_RS20690: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

Additional weak hits (7):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.74 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.97 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.38 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 20.13 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_LFBV01000006.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 73,070 - 102,497 nt. (total: 29,428 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AB852_RS22900: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AB852_RS22935: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

AB852_RS22955: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

AB852_RS22965: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: methyltransferase

AB852_RS22930: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

AB852_RS22960: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.83	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.77	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.76	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.72	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.71	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000646.5	0.60	terpene	β-carotein	uncultured bacterium
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000645.3	0.55	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.83	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.77	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.76	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.72	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.71	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000646.5	0.60	terpene	β-carotein	uncultured bacterium
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000645.3	0.55	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

AB852_RS22925: Lycopene_cycl

Domain 1 (5 - 402): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

AB852_RS22950: PT_phytoene_like

Domain 1 (16 - 308): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

AB852_RS22960: PT_FPPS_like

Domain 1 (78 - 396): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.32 out of 27.04

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_LFBV01000007.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 93,417 nt. (total: 93,417 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AB852_RS24895: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AB852_RS24915: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

AB852_RS24925: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acyltransferase glycosyltransferase methyltransferase

AB852_RS24860: methyltransferase

smcogs: SMCOG1089: methyltransferase

AB852_RS24905: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

AB852_RS41395: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: deaminase esterase

AB852_RS24885: thioesterase

smcogs: SMCOG1004: thioesterase

AB852_RS24910: thioesterase

smcogs: SMCOG1004: thioesterase

AB852_RS24945: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: dehydratase

AB852_RS24920: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

AB852_RS24890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS24900: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS24940: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AB852_RS24950: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AB852_RS24955: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AB852_RS24960: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002286.3	0.88	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.88	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.87	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.87	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.86	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.86	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.85	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.85	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.78	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	0.78	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.09 out of 29.51

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

Additional weak hits (11):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.71 out of 23.43

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.41 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.07 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.57 out of 26.85

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.84 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.59 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.58 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.02 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 93417:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Phe - X - Asn - D-X) + (Ser - NMe-Gly - D-X - Val) + (Orn - X - Phe) + (mal - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 37431:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Phe - X - Asn - D-X) + (Ser - NMe-Gly - D-X - Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AB852_RS24890: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (8..388): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASTFEPWMVVGGDVNGYGPTENTTFTCC
Nearest Stachelhaus code(s):: Val DAFWVGGTFK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AB852_RS24900: Phe - X - Asn - X

Search NORINE for peptide: strict or relaxed

AMP-binding (470..870): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAAFWEMTLAVAGEINAYGPTETTVCCTT
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1548..1952): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAEVVVTGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2598..2981): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDMPVTTAKMVVGGEHNEYGPTEVTVGCVR
Nearest Stachelhaus code(s):: Asn DMTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3626..4021): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDRTFDPATFEVALWTGGETNSYGPTETTFAVVQ
Nearest Stachelhaus code(s):: Ph-Gly DPFLWGILCK (59% 8Å match); Leu DIFALGGVAK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

AB852_RS24905: Ser - Gly - X - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (468..844): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEANFYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1498..1903): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: NGFAFDIVAVDLQALVGGEVNLYGPTETTVWSTL
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3603..3992): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSLAFDVATGDFTLALGSELNVYGPTECTVASTI
Nearest Stachelhaus code(s):: dmeaTrp or 1Me-Trp DVWTHGGVAK (56% 8Å match); Ahp DVENAGVVTK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (5116..5502): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IEESFDASTAEGCFLLGGDANGYGPAETTVFVTA
Nearest Stachelhaus code(s):: Val DALWLGGVFK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

AB852_RS24950: Orn - X - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (4..416): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LAWTVDLFFADRELSVGSEVNAYGTTETAVDSCV
Nearest Stachelhaus code(s):: ohEnd DLSVMGAVDK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1076..1476): X

nrpys: Phe, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDSLFDGGIWQMMLYSAADANLYGPTETTMCSTA
Nearest Stachelhaus code(s):: Trp DGWAVASVCK (59% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (2123..2518): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: MAVAFDAAFWEATLVAAGEFNAYGPTESTVCATV
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AB852_RS24955: X

AMP-binding (1310..1733): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWFFFDGSVLEACLATGGDLNMYGPTECAVVGTC
Nearest Stachelhaus code(s):: Leu DGLLCGLVVK (59% 8Å match); Tyr DGLTTGEVVK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_LFBV01000007.1 - Region 2 - butyrolactone

Download region GenBank file

Download region SVG

Location: 267,421 - 278,392 nt. (total: 10,972 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

AB852_RS25755: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001137.5	0.38	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0001050.5	0.33	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000353.5	0.31	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0001302.5	0.30	other (other)	lomofungin	Streptomyces lomondensis
BGC0002339.3	0.30	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0001399.4	0.29	NRPS	fellutamide B	Aspergillus nidulans FGSC A4
BGC0001290.4	0.29	NRPS	emericellamide A, emericellamide B	Aspergillus nidulans FGSC A4
BGC0001940.3	0.29	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0001748.4	0.28	NRPS, PKS	pseudospumigin A, pseudospumigin B, pseudospumigin C, pseudospumigin D, pseudospumigin E, pseudospumigin F	Nostoc sp. CENA543
BGC0002386.2	0.28	NRPS, PKS	cyclo(n-Me-L-Leu-L-Val), cyclo(n-Me-L-Leu-L-Leu), cyclo(n-Me-L-Leu-L-Ile)	Sorangium cellulosum So0157-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001137.5	0.38	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0001050.5	0.33	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0000353.5	0.31	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0001302.5	0.30	other (other)	lomofungin	Streptomyces lomondensis
BGC0002339.3	0.30	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0001399.4	0.29	NRPS	fellutamide B	Aspergillus nidulans FGSC A4
BGC0001290.4	0.29	NRPS	emericellamide A, emericellamide B	Aspergillus nidulans FGSC A4
BGC0001940.3	0.29	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0001748.4	0.28	NRPS, PKS	pseudospumigin A, pseudospumigin B, pseudospumigin C, pseudospumigin D, pseudospumigin E, pseudospumigin F	Nostoc sp. CENA543
BGC0002386.2	0.28	NRPS, PKS	cyclo(n-Me-L-Leu-L-Val), cyclo(n-Me-L-Leu-L-Leu), cyclo(n-Me-L-Leu-L-Ile)	Sorangium cellulosum So0157-2

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.64 out of 25.31

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.47 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.62 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_LFBV01000007.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 343,539 - 365,843 nt. (total: 22,305 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AB852_RS26080: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

AB852_RS26085: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

AB852_RS26105: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: acetyltransferase

AB852_RS26110: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

AB852_RS26070: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AB852_RS26120: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: cyclase

AB852_RS26090: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthetase

AB852_RS26095: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002391.2	0.57	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000677.5	0.55	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000675.5	0.53	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000798.3	0.50	saccharide	dhurrin	Sorghum bicolor
BGC0000678.5	0.49	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001529.5	0.47	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001910.4	0.46	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.46	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.44	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002391.2	0.57	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000677.5	0.55	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000675.5	0.53	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000798.3	0.50	saccharide	dhurrin	Sorghum bicolor
BGC0000678.5	0.49	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001529.5	0.47	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001910.4	0.46	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.46	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.44	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AB852_RS26090: T1TS

Domain 1 (2 - 312): Type 1 terpene synthase

Subtype: unknown

AB852_RS26095: PT_FPPS_like

Domain 1 (58 - 336): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.23 out of 26.85

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.09 out of 26.33

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.66 out of 30.12

Confidence: medium

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.46 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.67 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
OsdR	Development and stress management regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_LFBV01000007.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 411,513 - 432,829 nt. (total: 21,317 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AB852_RS26410: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase dehydratase

AB852_RS26355: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AB852_RS39935: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.75	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001868.4	0.39	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0002394.2	0.37	terpene	taxa-4(5),11(12)-diene, taxa-4(20),11(12)-diene	Taxus chinensis
BGC0002525.3	0.36	PKS	fusarubin, 1233A, 1233B, NG-391, lucilactaene	Fusarium sp.
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001221.5	0.33	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000012.3	0.31	PKS	alternapyrone	Alternaria solani
BGC0000170.3	0.31	PKS	yanuthone D	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.75	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001868.4	0.39	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0002394.2	0.37	terpene	taxa-4(5),11(12)-diene, taxa-4(20),11(12)-diene	Taxus chinensis
BGC0002525.3	0.36	PKS	fusarubin, 1233A, 1233B, NG-391, lucilactaene	Fusarium sp.
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001221.5	0.33	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0000012.3	0.31	PKS	alternapyrone	Alternaria solani
BGC0000170.3	0.31	PKS	yanuthone D	Aspergillus niger ATCC 1015

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AB852_RS39935: T1TS

Domain 1 (6 - 325): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.61 out of 24.78

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

Additional weak hits (9):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.43 out of 29.51

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.25 out of 26.85

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.25 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.89 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.35 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.76 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.19 out of 23.43

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.09 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
LexA variant 2	Repressor of DNA damage response