GCF_001905005.1 - 51 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_LWKZ01000001.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RRE-containing	258,976	279,248	Low	arginomycin	other:other
Region 1.2	T1PKS	305,402	351,689
Region 1.3	terpene-precursor,lanthipeptide-class-ii,NRPS,PKS-like,NRPS-like	397,806	524,755	High	tyrobetaine	NRPS:Type I
Region 1.4	triceptide	541,231	562,800

NZ_LWKZ01000002.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	ectoine	74,487	84,909	High	ectoine	other:ectoine

NZ_LWKZ01000003.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	NI-siderophore	59,183	93,535
Region 3.2	NRPS,NRPS-like	173,236	267,941
Region 3.3	atropopeptide,NRP-metallophore,NRPS	282,998	332,388	High	griseobactin	NRPS:Type I

NZ_LWKZ01000008.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	butyrolactone	59,540	70,523

NZ_LWKZ01000011.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	CDPS	1	14,355

NZ_LWKZ01000012.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	lassopeptide	406	22,944	Low	SSV-2083	ribosomal:RiPP:Lanthipeptide
Region 12.2	terpene	560,342	581,568
Region 12.3	NRPS	652,370	703,532	Medium	cephamycin C	NRPS:Type I
Region 12.4	lanthipeptide-class-iii	888,675	911,314	High	SAL-2242	ribosomal:RiPP:Lanthipeptide
Region 12.5	terpene	1,034,633	1,056,924	High	geosmin	terpene:Sesquiterpene

NZ_LWKZ01000017.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	terpene-precursor	2,494	23,567

NZ_LWKZ01000023.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	NRPS-like,T1PKS,NRPS	58,908	129,402	Low	deimino-antipain	NRPS:Type I
Region 23.2	terpene	153,782	174,846
Region 23.3	NRPS-like,NRPS	177,891	226,161	High	antipain	NRPS:Type I
Region 23.4	NRPS	274,208	318,371
Region 23.5	NRPS	320,862	366,816	Low	cyclofaulknamycin	PKS
Region 23.6	terpene,NRPS	455,258	501,047	Low	paenibactin	NRPS:Type I
Region 23.7	2dos	505,979	529,552	Low	lividomycin	saccharide
Region 23.8	T1PKS,NRPS-like	544,254	659,113	High	tetramycin B	PKS
Region 23.9	arylpolyene,NRPS,NRPS-like,terpene	684,085	763,671
Region 23.10	RiPP-like	776,960	788,867
Region 23.11	azoxy-crosslink,T1PKS	847,950	910,488
Region 23.12	lassopeptide	915,993	938,591	High	lagmysin	ribosomal:RiPP
Region 23.13	NRPS,terpene,T1PKS	990,675	1,085,650	High	isorenieratene	terpene
Region 23.14	NRPS,NRPS-like,betalactone	1,120,307	1,208,635	Low	thiazostatin/watasemycin A/watasemycin B/2-hydroxyphenylthiazoline enantiopyochelin/isopyochelin	NRPS:Type I

NZ_LWKZ01000024.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	terpene	64,707	91,469	High	hopene	terpene
Region 24.2	NRPS	223,501	299,315	High	rimomycin A/rimomycin B/rimomycin C	NRPS:Type I
Region 24.3	2dos	378,814	403,990
Region 24.4	melanin	448,221	459,495
Region 24.5	other,NRPS-like,NRPS,indole,T1PKS	576,411	687,835	High	malonomycin	NRPS:Type I+PKS
Region 24.6	RiPP-like	895,022	906,371
Region 24.7	butyrolactone	1,009,432	1,020,418
Region 24.8	T1PKS,NRPS-like	1,053,292	1,104,206	Low	sporolide A/sporolide B	NRPS:Type I+PKS:Enediyne type I

NZ_LWKZ01000025.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 25.1	phosphonate,T1PKS,NRPS	164,944	242,151	Medium	pyridomycin	NRPS:Type I+PKS
Region 25.2	terpene	297,972	321,407

NZ_LWKZ01000026.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	PKS-like,NRPS-like	1	68,665
Region 26.2	terpene,NRPS,NRPS-like,T1PKS	118,036	239,487
Region 26.3	nucleoside	258,066	279,031	High	tunicamycin B1	other:nucleoside
Region 26.4	NRPS	293,287	358,492
Region 26.5	NRPS-like,NAPAA	371,860	450,754
Region 26.6	arylpolyene,terpene	565,828	622,128

NZ_LWKZ01000027.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	terpene	58,024	79,208
Region 27.2	RiPP-like	215,083	225,592
Region 27.3	NI-siderophore	597,755	629,626	Low	peucechelin	NRPS:Type I
Region 27.4	NI-siderophore	703,191	721,891	High	legonoxamine A/desferrioxamine B/legonoxamine B	other:other

NZ_LWKZ01000028.1 (Streptomyces sp. CB02923)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	butyrolactone	294,149	305,438

No secondary metabolite regions were found in these records:: NZ_LWKZ01000004.1 (Streptomyces sp. CB02923); NZ_LWKZ01000005.1 (Streptomyces sp. CB02923); NZ_LWKZ01000006.1 (Streptomyces sp. CB02923); NZ_LWKZ01000007.1 (Streptomyces sp. CB02923); NZ_LWKZ01000009.1 (Streptomyces sp. CB02923); NZ_LWKZ01000010.1 (Streptomyces sp. CB02923); NZ_LWKZ01000013.1 (Streptomyces sp. CB02923); NZ_LWKZ01000014.1 (Streptomyces sp. CB02923); NZ_LWKZ01000015.1 (Streptomyces sp. CB02923); NZ_LWKZ01000016.1 (Streptomyces sp. CB02923); NZ_LWKZ01000018.1 (Streptomyces sp. CB02923); NZ_LWKZ01000019.1 (Streptomyces sp. CB02923); NZ_LWKZ01000020.1 (Streptomyces sp. CB02923); NZ_LWKZ01000021.1 (Streptomyces sp. CB02923); NZ_LWKZ01000022.1 (Streptomyces sp. CB02923); NZ_LWKZ01000029.1 (Streptomyces sp. CB02923)

Compact view

NZ_LWKZ01000001.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 258,976 - 279,248 nt. (total: 20,273 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS01105: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Lyases: decarboxylase dehydratase

A6A06_RS01060: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

A6A06_RS01125: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

A6A06_RS01050: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000883.5	0.52	other (other)	arginomycin	Streptomyces arginensis
BGC0001778.5	0.42	other (other)	showdomycin	Streptomyces showdoensis
BGC0000757.3	0.40	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000754.3	0.40	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000755.3	0.40	saccharide	capsular polysaccharide	Avibacterium paragallinarum 221
BGC0000756.3	0.40	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000737.3	0.40	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000739.3	0.37	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000043.5	0.36	PKS	curacin A	Moorea producens 19L
BGC0000868.5	0.34	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000883.5	0.52	other (other)	arginomycin	Streptomyces arginensis
BGC0001778.5	0.42	other (other)	showdomycin	Streptomyces showdoensis
BGC0000757.3	0.40	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000754.3	0.40	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000755.3	0.40	saccharide	capsular polysaccharide	Avibacterium paragallinarum 221
BGC0000756.3	0.40	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000737.3	0.40	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000739.3	0.37	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000043.5	0.36	PKS	curacin A	Moorea producens 19L
BGC0000868.5	0.34	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.21 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (7):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.93 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.41 out of 27.04

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.10 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.36 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.84 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.75 out of 28.19

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 73; Score: 33.2

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000001.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 305,402 - 351,689 nt. (total: 46,288 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS01385: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Lyases: lyase

A6A06_RS01405: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthase

A6A06_RS01380: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.67	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.67	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (15):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.64 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.09 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.36 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.51 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.76 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.50 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.66 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.99 out of 32.74

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.86 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.22 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 36.53

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.76 out of 27.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 35.63

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.35 out of 25.88

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 305401 - 351689:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS01380: mmal

PKS_AT (551..842): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Malonyl-CoA: 70.8%; Propionyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 129.1
Methoxymalonyl-CoA: 106.5
Ethylmalonyl-CoA: 104.4
Malonyl-CoA: 85.4
2-Methylbutyryl-CoA: 76.8
Propionyl-CoA: 70.6
Isobutyryl-CoA: 67.2
trans-1,2-CPDA: 61.6
fatty_acid: 44.2
Acetyl-CoA: 42.5
inactive: 31.6
Benzoyl-CoA: 28.5
CHC-CoA: 22.9
3-Methylbutyryl-CoA: 13.9

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_LWKZ01000001.1 - Region 3 - NRPS,NRPS-like,PKS-like,lanthipeptide-class-ii,terpene-precursor

Download region GenBank file

Download region SVG

Location: 397,806 - 524,755 nt. (total: 126,950 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
PKS-like: (t2pks2 or ksIII)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS01770: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS01945: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS01955: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

A6A06_RS02005: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

A6A06_RS02030: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS02050: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase aminotransferase methyltransferase sulfotransferase

A6A06_RS01765: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

A6A06_RS01855: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

A6A06_RS01920: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

A6A06_RS02025: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: back translocase deaminase phosphatase

A6A06_RS01845: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

A6A06_RS01935: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

A6A06_RS02000: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: cyclase dehydratase

A6A06_RS01865: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

A6A06_RS41375: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase synthetase

A6A06_RS01800: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

A6A06_RS01915: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS01925: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS01940: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

A6A06_RS01960: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS01980: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS01990: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS01995: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A6A06_RS02010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS02020: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001813.4	1.60	NRPS	tyrobetaine	Streptomyces sp. NRRL WC-3703
BGC0002135.2	1.54	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	1.54	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	1.51	NRPS	dimethylcoprogen	Alternaria alternata
BGC0000342.4	1.50	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	1.49	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	1.46	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.45	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	1.45	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	1.42	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001813.4	0.80	NRPS	tyrobetaine	Streptomyces sp. NRRL WC-3703
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000307.4	0.74	NRPS	AbT1	Aureobasidium pullulans
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Lanthipeptide predictions

Lanthipeptide(s) for A6A06_RS01865

A6A06_RS41385

Leader:

MSTEAAAWKTGAQDVTNPAGANFGELSLADLREDQSAHM

Core:

ISSGYFCTITTECFC

Core with dehydrations:

IDhaDhaGYFCysDhbIDhbDhbECysFCys

antiSMASH-DB 4.0 matches for A6A06_RS41385

100.0%

NZ_LWKZ01000001.1:

Lanthipeptides: A6A06_RS41385_lanthipeptide

1

ISSGYFCTITTECFC

15

ISSGYFCTITTECFC

1

ISSGYFCTITTECFC

15

60.0%

NZ_JALMDK010000017.1:

Lanthipeptides: allorf_059288_059443_lanthipeptide

2

SSGYFCTITTECFC

15

S GY CT+T EC C

2

SGGYICTLTWECNC

15

45.5%

NZ_CP034669.1:

Lanthipeptides: EJ065_RS32040_lanthipeptide

2

SSGYFCTITTECFC

15

S GY CT+TTEC C

9

SCGYVCTLTTECGC

22

with 99 more sequence matches

Only the first 10 are displayed here.

42.9%

NZ_AUBN01000022.1:

Lanthipeptides: G448_RS16025_lanthipeptide

2

SSGYFCTITTEC

13

SSG+FCT+T EC

2

SSGWFCTLTIEC

13

42.9%

NZ_CP086242.1and 1 other:

NZ_CP086245.1 Lanthipeptides: LL037_RS25615_lanthipeptide

Lanthipeptides: LL038_RS25355_lanthipeptide

2

SSGYFCTITTEC

13

SSG CT TTEC

2

SSGAICTATTEC

13

40.0%

NZ_CP036455.1and 4 others:

NZ_JAGPXN010000019.1 Lanthipeptides: KBX06_RS22045_lanthipeptideNZ_JAODUN010000003.1 Lanthipeptides: BXY51_RS10560_lanthipeptideNZ_KB895893.1 Lanthipeptides: C569_RS0129325_lanthipeptideNZ_KB900614.1 Lanthipeptides: SALPAC6_RS0114155_lanthipeptide

Lanthipeptides: EKD16_RS25235_lanthipeptide

2

SSGYFCTITTEC

13

SSG+ CT+T EC

1

SSGWVCTLTIEC

12

38.1%

NC_009480.1and 12 others:

NZ_CP033724.1 Lanthipeptides: EFE39_RS10220_lanthipeptideNZ_CP047051.1 Lanthipeptides: GRD74_RS10365_lanthipeptideNZ_CP047054.1 Lanthipeptides: GRD61_RS10460_lanthipeptideNZ_CP053860.1 Lanthipeptides: DQP62_RS10825_lanthipeptideNZ_CP061274.1 Lanthipeptides: H9X71_RS09850_lanthipeptideNZ_CP076352.1 Lanthipeptides: KN218_RS09900_lanthipeptideNZ_CP085137.1 Lanthipeptides: LHJ48_RS10290_lanthipeptideNZ_CP085140.1 Lanthipeptides: LHJ47_RS10305_lanthipeptideNZ_CP095274.1 Lanthipeptides: MU580_RS10460_lanthipeptideNZ_JADKRR010000001.1 Lanthipeptides: ITJ40_RS10085_lanthipeptideNZ_PSTW01000024.1 Lanthipeptides: C5C03_RS09675_lanthipeptideNZ_SISU01000002.1 Lanthipeptides: EOG37_RS09890_lanthipeptide

Lanthipeptides: CMM_RS10575_lanthipeptide

2

SSGYFCTITTEC

13

SSG+ CT+T EC

2

SSGWLCTLTIEC

13

38.1%

NZ_CP015515.1and 2 others:

NZ_CP028130.1 Lanthipeptides: C7V51_RS14690_lanthipeptideNZ_PSUO01000011.1 Lanthipeptides: C5C18_RS08595_lanthipeptide

Lanthipeptides: A6122_RS12855_lanthipeptide

2

SSGYFCTITTEC

13

SSG+ CT+T EC

2

SSGWMCTLTIEC

13

35.0%

NZ_CP022413.2and 1 other:

NZ_JAQEYW010000009.1 Lanthipeptides: PG422_RS09400_lanthipeptide

Lanthipeptides: CGC63_RS01420_lanthipeptide

3

SGYFCTITTEC

13

SG CTI+ EC

1

SGVVCTISVEC

11

31.8%

NC_004070.1and 27 others:

NC_008024.1 Lanthipeptides: MGAS10750_RS08460_lanthipeptideNZ_CAAHHZ010000002.1 Lanthipeptides: E9518_RS02835_lanthipeptideNZ_CAAHIH010000002.1 Lanthipeptides: E9602_RS03585_lanthipeptideNZ_CAAHIO010000002.1 Lanthipeptides: E9584_RS04360_lanthipeptideNZ_CAAHJE010000002.1 Lanthipeptides: E9605_RS03435_lanthipeptideNZ_CAAHJS010000002.1 Lanthipeptides: E9628_RS02300_lanthipeptideNZ_CAAHKC010000012.1 Lanthipeptides: E9636_RS08085_lanthipeptideNZ_CAAHMR010000003.1 Lanthipeptides: E9727_RS05510_lanthipeptideNZ_CAAHQE010000003.1 Lanthipeptides: E9931_RS04945_lanthipeptideNZ_CAAHQG010000004.1 Lanthipeptides: E9903_RS05690_lanthipeptideNZ_CAAIFD010000008.1 Lanthipeptides: FAG63_RS07845_lanthipeptideNZ_CAAIJM010000014.1 Lanthipeptides: FAI23_RS09465_lanthipeptideNZ_CAAJDK010000010.1 Lanthipeptides: FAO79_RS08000_lanthipeptideNZ_CAAJFI010000003.1 Lanthipeptides: FAP60_RS03740_lanthipeptideNZ_CP008926.1 Lanthipeptides: DP15_RS03855_lanthipeptideNZ_CP035434.1 Lanthipeptides: ETT65_RS08240_lanthipeptideNZ_CP035435.1 Lanthipeptides: ETT64_RS07905_lanthipeptideNZ_CP035447.1 Lanthipeptides: ETT52_RS07920_lanthipeptideNZ_CP035449.1 Lanthipeptides: ETT50_RS08255_lanthipeptideNZ_CP035453.1 Lanthipeptides: ETT46_RS08220_lanthipeptideNZ_CP060646.1 Lanthipeptides: H7789_RS07920_lanthipeptideNZ_CP065054.1 Lanthipeptides: I2432_RS09105_lanthipeptideNZ_LRGW01000003.1 Lanthipeptides: AWU01_RS03260_lanthipeptideNZ_LS483298.1 Lanthipeptides: DQM39_RS08650_lanthipeptideNZ_LS483407.1 Lanthipeptides: DQM86_RS08100_lanthipeptideNZ_LS483425.1 Lanthipeptides: DQN36_RS07865_lanthipeptideNZ_LS483430.1 Lanthipeptides: DQN28_RS07600_lanthipeptide

Lanthipeptides: SPYM3_RS08605_lanthipeptide

3

SGYFCTITTEC

13

SG+F TIT +C

4

SGWFATITDDC

14

31.8%

NZ_CP061033.1and 1 other:

NZ_CP061033.1 Lanthipeptides: IAU67_RS09320_lanthipeptide

Lanthipeptides: IAU67_RS09320_lanthipeptide

2

SSGYFCTITTEC

13

+ G FCT T EC

6

NEGNFCTGTIEC

17

30.8%

NZ_JALASB010000016.1and 3 others:

NZ_JALASR010000012.1 Lanthipeptides: MOD87_RS16305_lanthipeptideNZ_JALAUW010000005.1 Lanthipeptides: MOE83_RS03160_lanthipeptideNZ_JALAXQ010000010.1 Lanthipeptides: MOF24_RS12150_lanthipeptide

Lanthipeptides: MOD42_RS18070_lanthipeptide

2

SSGYFCTITTECFC

15

G CTIT+EC C

13

GGGGVCTITSECIC

26

30.4%

NZ_CP050134.2and 3 others:

NZ_EQ973330.1 Lanthipeptides: CORMATOL_RS10565_lanthipeptideNZ_LR134504.1 Lanthipeptides: EL293_RS07240_lanthipeptideNZ_LR134504.1 Lanthipeptides: EL293_RS07240_lanthipeptide

Lanthipeptides: HBA49_RS00770_lanthipeptide

2

SSGYFCTITTECF

14

++G +CTIT EC

7

NNGRWCTITKECM

19

MIBiG 4.0 matches for A6A06_RS41385

21.4%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

2

SSGYFCTITTECF

14

+ G +CT+T EC

12

NKGAYCTLTVECM

24

20.0%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

2

SSGYFCTITTEC

13

++G +CT+T EC

14

NNGGWCTLTKEC

25

10.3%

BGC0001229.4 (SBI_06990):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

7

CTITTEC

13

CT++ EC

28

CTLSKEC

34

A6A06_RS01895

Leader:

MRNVDLEGQMLNGV

Core:

MAERGGTGAVVVPSAEAAPGPAGRPADCPVEVPQGVTVPRTGRTSGLRGEG

Core with dehydrations:

MAERGGDhbGAVVVPDhaAEAAPGPAGRPADCysPVEVPQGVDhbVPRDhbGRDhbDhaGLRGEG

antiSMASH-DB 4.0 matches for A6A06_RS01895

100.0%

NZ_LWKZ01000001.1:

Lanthipeptides: A6A06_RS01895_lanthipeptide

1

MAERGGTGAVVVPSAEAAPGPAGRPADCPVEVPQGVTVPRTGRTSGLRGEG

51

MAERGGTGAVVVPSAEAAPGPAGRPADCPVEVPQGVTVPRTGRTSGLRGEG

1

MAERGGTGAVVVPSAEAAPGPAGRPADCPVEVPQGVTVPRTGRTSGLRGEG

51

17.6%

NZ_BBYJ01000013.1:

Lanthipeptides: allorf_220397_220594_lanthipeptide

1

MAERGGTGAVVVPSAEAAPGPAGRPADC

28

+ +RG T S+ + G GRP C

3

IGQRGATAGSTCASSCNSYGQTGRPCRC

30

15.7%

NZ_CP116936.1:

Lanthipeptides: allorf_2868736_2868942_lanthipeptide

5

GGTGAVVVPSAEAAPGPAGRPADCPV

30

G VP +A+ GR +DC +

15

GADDGTWVPDTDASTRSGGRLSDCSM

40

with 1 more sequence matches

13.7%

NZ_BCEZ01000027.1:

Thiopeptides: GOZ55_RS05270_thiopeptide

30

VEVPQGVTVPRTGRTSG

46

VE+ + +P T TSG

2

VEISEATALPETAATSG

18

MIBiG 4.0 matches for A6A06_RS01895

7.8%

BGC0002150.2 (MBO0654592.1):

Lasso peptide: triculamin

45

SGLRGEG

51

G+RG+G

8

DGIRGKG

14

allorf_0413819_0413920

Leader:

MCVFPRLHNGDGG

Core:

NASSPCVRYIFSRRGVRCEN

Core with dehydrations:

NADhaDhaPCysVRYIFDhaRRGVRCysEN

antiSMASH-DB 4.0 matches for allorf_0413819_0413920

100.0%

NZ_LWKZ01000001.1:

Lanthipeptides: allorf_0413819_0413920_lanthipeptide

1

NASSPCVRYIFSRRGVRCEN

20

NASSPCVRYIFSRRGVRCEN

1

NASSPCVRYIFSRRGVRCEN

20

30.0%

NZ_AP022613.1:

Lanthipeptides: allorf_4654794_4654925_lanthipeptide

6

CVRYIFSRRG

15

CV Y+F RG

11

CVSYVFHLRG

20

24.0%

NZ_QICS01000003.1:

Lanthipeptides: allorf_263557_263733_lanthipeptide

7

VRYIFSRRGV

16

V Y+F+ RGV

5

VPYLFALRGV

14

with 2 more sequence matches

21.1%

NZ_LMGS01000001.1and 1 other:

NZ_LMJF01000001.1 Lanthipeptides: ASE35_RS05580_lanthipeptide

Lanthipeptides: ASD69_RS05595_lanthipeptide

1

NASSPCVRYIFSR

13

NAS P +YIFS+

14

NASGPAQQYIFSQ

26

14.0%

NZ_LMJO01000001.1:

Lanthipeptides: ASE43_RS02635_lanthipeptide

1

NASSPCVRYIFSR

13

NAS P +YIFS

33

NASGPAQQYIFSE

45

allorf_0427142_0427354

Leader:

MKRRGDRWSGSRPVVRGSLCRLRIRAGG

Core:

TRVCGVASPSGPCCVHVPHVIPATYPVTRPYAGRGRGRTAPG

Core with dehydrations:

DhbRVCysGVADhaPDhaGPCysCysVHVPHVIPADhbYPVDhbRPYAGRGRGRDhbAPG

antiSMASH-DB 4.0 matches for allorf_0427142_0427354

100.0%

NZ_LWKZ01000001.1:

Lanthipeptides: allorf_0427142_0427354_lanthipeptide

1

TRVCGVASPSGPCCVHVPHVIPATYPVTRPYAGRGRGRTAPG

42

TRVCGVASPSGPCCVHVPHVIPATYPVTRPYAGRGRGRTAPG

1

TRVCGVASPSGPCCVHVPHVIPATYPVTRPYAGRGRGRTAPG

42

MIBiG 4.0 matches for allorf_0427142_0427354

16.7%

BGC0002130.3 (QKI29070.1):

Lanthipeptide: cacaoidin

9

PSGPCCVH--VPHVIPAT

24

S PC ++ V I AT

1

SSAPCTIYASVSASISAT

18

9.5%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

4

CGVASPSGPCCVHVP

18

C + + + C +HV

19

CNMKTATCHCSIHVS

33

allorf_0427189_0427341

Leader:

MTGGPEAAPSFVVLCAVCASAQAAHVFAG

Core:

WQVPLVHAVFTCLTSYQRRIP

Core with dehydrations:

WQVPLVHAVFDhbCysLDhbDhaYQRRIP

antiSMASH-DB 4.0 matches for allorf_0427189_0427341

100.0%

NZ_LWKZ01000001.1:

Lanthipeptides: allorf_0427189_0427341_lanthipeptide

1

WQVPLVHAVFTCLTSYQRRIP

21

WQVPLVHAVFTCLTSYQRRIP

1

WQVPLVHAVFTCLTSYQRRIP

21

allorf_0428139_0428276

Leader:

MAGRAGDAWYGYAPAAEKALRAAAEGA

Core:

WRGREPGCRPDDYHRCGS

Core with dehydrations:

WRGREPGCysRPDDYHRCysGDha

antiSMASH-DB 4.0 matches for allorf_0428139_0428276

100.0%

NZ_LWKZ01000001.1:

Lanthipeptides: allorf_0428139_0428276_lanthipeptide

1

WRGREPGCRPDDYHRCGS

18

WRGREPGCRPDDYHRCGS

1

WRGREPGCRPDDYHRCGS

18

25.0%

NZ_FMTS01000001.1:

Lassopeptides: BLO49_RS18320_lassopeptide

3

GREPGCRPD

11

G PG RPD

1

GSTPGTRPD

9

16.7%

NZ_SLWS01000002.1and 3 others:

NZ_SLWS01000002.1 Lanthipeptides: allorf_0484574_0484780_lanthipeptideNZ_SLWS01000002.1 Lanthipeptides: allorf_0484574_0484780_lanthipeptideNZ_SLWS01000002.1 Lanthipeptides: allorf_0484574_0484780_lanthipeptide

Lanthipeptides: allorf_0484574_0484780_lanthipeptide

9

RPDDYHRCGS

18

+D H+CGS

15

NSNDSHQCGS

24

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

A6A06_RS01800: PT_FPPS_like

Domain 1 (44 - 329): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.85 out of 20.97

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.60 out of 29.72

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 29.30 out of 30.12

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.91 out of 27.04

Confidence: medium

Additional weak hits (16):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.53 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.81 out of 31.73

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.11 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 25.75

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.59 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.36 out of 26.85

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.17 out of 29.51

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.02 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.09 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.85 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.85 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.82 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.39 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Core peptide predictions

A6A06_RS41385 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 1583.7 Da

Molecular weight: 1584.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 1602.8 Da N = 1; 1620.9 Da N = 2

A6A06_RS01895 - Class II

Cleavage pHMM score: -5.90

RODEO score: 0

Monoisotopic mass: 4815.5 Da

Molecular weight: 4818.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4836.4 Da N = 1; 4854.4 Da N = 2; 4872.4 Da N = 3; 4890.4 Da N = 4; 4908.4 Da N = 5

allorf_0413819_0413920 - Class II

Cleavage pHMM score: -5.20

RODEO score: 0

Monoisotopic mass: 2259.1 Da

Molecular weight: 2260.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2278.6 Da N = 1

allorf_0427142_0427354 - Class II

Cleavage pHMM score: -5.70

RODEO score: 0

Monoisotopic mass: 4191.2 Da

Molecular weight: 4193.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4211.8 Da N = 1; 4229.9 Da N = 2; 4247.9 Da N = 3

allorf_0427189_0427341 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 2459.3 Da

Molecular weight: 2460.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2478.9 Da N = 1; 2496.9 Da N = 2

allorf_0428139_0428276 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 2127.9 Da

Molecular weight: 2129.3 Da

Number of bridges: 1

Predicted core structure(s)

For candidate cluster 3, location 397805 - 524755:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Tyr - Tyr - X) + (X) + (NMe-Phe - NMe-X - NMe-X) + (NMe-Phe - Tyr - Phe - X - NMe-Gly - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 413721 - 464407:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Tyr - Tyr - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 429327 - 470332:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Phe - NMe-X - NMe-X) + (X) + (NMe-Tyr - Tyr - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 445796 - 488319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (NMe-Phe - NMe-X - NMe-X) + (NMe-Phe - Tyr - Phe - X - NMe-Gly - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 448697 - 524755:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (NMe-Phe - NMe-X - NMe-X) + (NMe-Phe - Tyr - Phe - X - NMe-Gly - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS01915: Tyr - Tyr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (14..389): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAHAFDASVAEVTLTVAGEVNAYGPTETTVCASV
Nearest Stachelhaus code(s):: Tyr DAATVAAVCK (88% 8Å match); Phe or Tyr DASTTAAVCK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1478..1853): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVSEVTLVVAGEVNAYGPTEATVCATA
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2525..2928): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDASTFDVLLWTGGEFNVYGPTEVTMSATY
Nearest Stachelhaus code(s):: 3OH-Leu DAFLWGVMAK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

A6A06_RS01925: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (9..429): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: YYNFFDPSVYDVFSCFSAEHNLYGPTELTITCTD
Nearest Stachelhaus code(s):: Ala DPYFCSLITK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS01990: X

AMP-binding (7..405): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: WWAAFDMTVIDVYSLFAGEMNLYGPTETTVCTAH
Nearest Stachelhaus code(s):: Pro DLLYLALVCK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

A6A06_RS02010: X

AMP-binding (244..651): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQGQVSATGEVNAYGLTETSDDTNH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (91% 8Å match); dnmeProp or Dab DIWQSTADDK (79% 8Å match); Asp DIWQSTADDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS02020: Phe - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (580..955): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAAWWEMTLALAGEVNAYGPTESTVCVSM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2003..2405): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NWMTFDSVGLEFQFWSSGESNLYGPTEMTIQVAS
Nearest Stachelhaus code(s):: Ala DILQISLIYK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (3454..3826): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDAAVWEVLIVVGAEVNAYGPTESTVCVSM
Nearest Stachelhaus code(s):: Leu DAMLVGAVCK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

A6A06_RS02025: Phe - Tyr - Phe - X - Gly - X

Search NORINE for peptide: strict or relaxed

AMP-binding (470..845): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAAWWEMTLALAGEVNAYGPTESTVCVSM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1898..2276): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAAWAEMTLLVAGEVNAYGPTESTVCVSM
Nearest Stachelhaus code(s):: Tyr DASTLAAVCK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2938..3313): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAAWWEMTLVLAGEVNAYGPTESTVCVSM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3979..4354): X

nrpys: OH-Asp, OMe-Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWATFDLTVTGTKAILGGEVNAYGPTETTVNCTE
Nearest Stachelhaus code(s):: OH-Asp or OMe-Asp DLTKIGAVNK (91% 8Å match); Asp DLTKIGAVNK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5016..5425): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAVTFDIAAVEAQALVGGEVNLYGPTEATVWVTT
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (6487..6872): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHHV-APGAWDAATVLSGE--------TTRAYAV
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000001.1 - Region 4 - triceptide

Download region GenBank file

Download region SVG

Location: 541,231 - 562,800 nt. (total: 21,570 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.39	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000043.5	0.36	PKS	curacin A	Moorea producens 19L
BGC0000515.4	0.33	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.32	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000556.5	0.32	ribosomal	streptin	Streptococcus pyogenes
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000536.3	0.31	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.31	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000559.4	0.31	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000537.3	0.31	ribosomal	nisin U	Streptococcus uberis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002316.2	0.39	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000043.5	0.36	PKS	curacin A	Moorea producens 19L
BGC0000515.4	0.33	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.32	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000556.5	0.32	ribosomal	streptin	Streptococcus pyogenes
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000536.3	0.31	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.31	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000559.4	0.31	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000537.3	0.31	ribosomal	nisin U	Streptococcus uberis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.25 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 20.55 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LWKZ01000002.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 74,487 - 84,909 nt. (total: 10,423 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

A6A06_RS06680: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.88	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.88	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.26 out of 27.18

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.23 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.66 out of 27.78

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
NrdR	Represses ribonucleotide reductase encoding genes

NZ_LWKZ01000003.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 59,183 - 93,535 nt. (total: 34,353 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

A6A06_RS07610: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

A6A06_RS07555: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: amidase

A6A06_RS07605: amidase

smcogs: SMCOG1105: amidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001478.5	0.53	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002683.2	0.53	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002470.2	0.52	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002305.2	0.51	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001478.5	0.53	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002683.2	0.53	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0001572.3	0.52	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002470.2	0.52	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002305.2	0.51	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.29 out of 27.18

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.83 out of 27.18

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000003.1 - Region 2 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 173,236 - 267,941 nt. (total: 94,706 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

A6A06_RS08040: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

A6A06_RS08140: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS08150: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

A6A06_RS08195: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS42600: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: acyltransferase halogenase

A6A06_RS08045: flavin-dependent trp 5 halogenase

halogenases: flavin-dependent trp 5 halogenase
smcogs: SMCOG1119: halogenase

A6A06_RS08120: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: amidase deaminase dehalogenase esterase

A6A06_RS08050: thioesterase

smcogs: SMCOG1004: thioesterase

A6A06_RS08105: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

A6A06_RS08135: amidase

smcogs: SMCOG1105: amidase

A6A06_RS08200: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

A6A06_RS08025: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS08030: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS08100: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A6A06_RS08125: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS08130: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

A6A06_RS08160: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	1.19	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	1.18	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	1.17	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.17	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.17	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.16	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	1.13	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	1.09	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	1.07	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	1.03	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.54 out of 23.79

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.86 out of 18.57

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.05 out of 26.85

Confidence: medium

Additional weak hits (15):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.96 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.04 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.90 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.21 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.92 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.37 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.03 out of 32.74

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.65 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.90 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.42 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.29 out of 27.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.66 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.57 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 173235 - 267941:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln - X - Tyr) + (Gly - D-Val) + (Gly - X - Pro) + (X) + (Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 173235 - 217681:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 194984 - 238233:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln - X - Tyr) + (Gly - D-Val) + (Gly - X - Pro) + (X) + (Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 199515 - 267941:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Gly - X - Pro) + (Gly - D-Val) + (Gln - X - Tyr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS08025: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (473..872): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: VWQAFDVFFQESFLISSGEDNQYGPSETHVVTAE
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

A6A06_RS08030: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (11..403): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LMTAWDAYALEGFLLTGGEINGYGPVESCVFATT
Nearest Stachelhaus code(s):: Val DALFLGGTFK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

A6A06_RS42600: X

AMP-binding (155..558): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQSQLSVTGEANAYGLTETSDDTNH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (94% 8Å match); dnmeProp or Dab DIWQSTADDK (79% 8Å match); Asp DIWQSTADDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS08120: Gly - X - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (46..446): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMAFDIAGLDLQALVGAETNLYGPTETTVWSTL
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1106..1497): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: FDMAFDASVLEMLVLTGGDHNAYGPTEATVWVTA
Nearest Stachelhaus code(s):: Leu DALLLGAVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2811..3222): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVATQESFASQGGEHNHYGPTETHLVTAY
Nearest Stachelhaus code(s):: 4Me-Pro DVQFAGHAVK (88% 8Å match); Piz DVQFSAHVVK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

A6A06_RS08125: Gly - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (470..870): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAGLELQALVGGETNLYGPTETTIWSTL
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1531..1925): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: FDKSFDASVLELVLTVGGDFNGYGPTEATVWVTS
Nearest Stachelhaus code(s):: Val DALFTGGVFK (47% 8Å match)
Stachelhaus code match:: 80% (moderate)

A6A06_RS08130: Gln - X - Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (465..870): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDASVWELQFFVGGEHNLYGPTETTVQVTA
Nearest Stachelhaus code(s):: Gln DAWQFGLIQK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1531..1929): X

nrpys: OH-Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTGGKAVLGGEVNEYGPTETTVGCTE
Nearest Stachelhaus code(s):: OH-Asn DLTKVGEVGK (88% 8Å match); Asn DLTKVGEVGK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2590..2982): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHQVFDVSVAEMHVMVGAEVNAYGPTEATVDSCY
Nearest Stachelhaus code(s):: Dab DVWHVGAVDK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis

NZ_LWKZ01000003.1 - Region 3 - NRP-metallophore,NRPS,atropopeptide

Download region GenBank file

Download region SVG

Location: 282,998 - 332,388 nt. (total: 49,391 nt) Show pHMM detection rules used

Region on contig edge.

atropopeptide: atropopeptide_p450
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS08315: Biaryl bond formation

MITE: MITE0000172Biaryl bond formation (identity: 63.00%)
smcogs: SMCOG1034: cytochrome P450

A6A06_RS08405: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

A6A06_RS08360: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: esterase hydrolase

A6A06_RS08375: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

A6A06_RS08395: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

A6A06_RS08420: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

A6A06_RS08410: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase oxygenase

A6A06_RS08315: Biaryl bond formation

MITE: MITE0000172Biaryl bond formation (identity: 63.00%)
smcogs: SMCOG1034: cytochrome P450

A6A06_RS08350: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

A6A06_RS08415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS40720: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000368.5	1.08	NRPS	griseobactin	Streptomyces sp. ATCC 700974
BGC0000401.5	0.81	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001185.5	0.76	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000309.5	0.72	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000343.5	0.71	NRPS	enterobactin	Pseudomonas sp. J465
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000368.5	0.79	NRPS	griseobactin	Streptomyces sp. ATCC 700974
BGC0000401.5	0.72	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001185.5	0.70	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000309.5	0.69	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000343.5	0.68	NRPS	enterobactin	Pseudomonas sp. J465
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.21 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.19 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.74 out of 36.53

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.38 out of 27.04

Confidence: medium

Additional weak hits (15):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.40 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.70 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.63 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.30 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.23 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.88 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.72 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.57 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.81 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.28 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.24 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 282997 - 332388:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 286653 - 332388:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS40720: Arg - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (526..977): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHAFDASWDPWDVVVGGEVNLYGPTETTVDAYY
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1723..2135): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS08415: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (38..450): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SGSLFPLSSPGGGLLVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000008.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 59,540 - 70,523 nt. (total: 10,984 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

A6A06_RS10770: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001458.4	0.53	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0001151.5	0.34	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0002443.3	0.32	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0002805.2	0.31	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000248.5	0.31	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737
BGC0001495.3	0.30	PKS	actinoallolide A	Actinoallomurus fulvus
BGC0001877.4	0.30	PKS	cyphomycin	Streptomyces sp. ISID311
BGC0002386.2	0.29	NRPS, PKS	cyclo(n-Me-L-Leu-L-Val), cyclo(n-Me-L-Leu-L-Leu), cyclo(n-Me-L-Leu-L-Ile)	Sorangium cellulosum So0157-2
BGC0002499.2	0.29	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus
BGC0001302.5	0.29	other (other)	lomofungin	Streptomyces lomondensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001458.4	0.53	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0001151.5	0.34	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0002443.3	0.32	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0002805.2	0.31	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000248.5	0.31	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737
BGC0001495.3	0.30	PKS	actinoallolide A	Actinoallomurus fulvus
BGC0001877.4	0.30	PKS	cyphomycin	Streptomyces sp. ISID311
BGC0002386.2	0.29	NRPS, PKS	cyclo(n-Me-L-Leu-L-Val), cyclo(n-Me-L-Leu-L-Leu), cyclo(n-Me-L-Leu-L-Ile)	Sorangium cellulosum So0157-2
BGC0002499.2	0.29	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus
BGC0001302.5	0.29	other (other)	lomofungin	Streptomyces lomondensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.79 out of 23.43

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.30 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.07 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LWKZ01000011.1 - Region 1 - CDPS

Download region GenBank file

Download region SVG

Location: 1 - 14,355 nt. (total: 14,355 nt) Show pHMM detection rules used

Region on contig edge.

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

A6A06_RS11480: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.36	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001441.5	0.33	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0001778.5	0.32	other (other)	showdomycin	Streptomyces showdoensis
BGC0001954.2	0.32	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii
BGC0002058.3	0.31	NRPS, PKS	mutanocyclin	Streptococcus mutans B04Sm5
BGC0002287.2	0.30	NRPS	mutanocyclin, leuvalin, tyrvalin	Streptococcus mutans
BGC0001336.5	0.30	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001480.3	0.29	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0002477.3	0.29	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.36	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001441.5	0.33	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0001778.5	0.32	other (other)	showdomycin	Streptomyces showdoensis
BGC0001954.2	0.32	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii
BGC0002058.3	0.31	NRPS, PKS	mutanocyclin	Streptococcus mutans B04Sm5
BGC0002287.2	0.30	NRPS	mutanocyclin, leuvalin, tyrvalin	Streptococcus mutans
BGC0001336.5	0.30	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001480.3	0.29	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0002477.3	0.29	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0001736.3	0.27	NRPS	pepteridine A, pepteridine B	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.41 out of 32.74

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.53 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.80 out of 26.06

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description

NZ_LWKZ01000012.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 406 - 22,944 nt. (total: 22,539 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

A6A06_RS11745: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.73	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.72	ribosomal	ulleungdin	Streptomyces sp.
BGC0001507.3	0.68	ribosomal	anantin C	Streptomyces olindensis
BGC0001549.3	0.67	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001493.5	0.66	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001551.4	0.65	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.65	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002318.2	0.60	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0002064.2	0.60	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002289.2	0.60	ribosomal	Leepeptin	Streptomyces leeuwenhoekii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.73	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.72	ribosomal	ulleungdin	Streptomyces sp.
BGC0001507.3	0.68	ribosomal	anantin C	Streptomyces olindensis
BGC0001549.3	0.67	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001493.5	0.66	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001551.4	0.65	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001889.2	0.65	ribosomal	fusilassin	Thermobifida fusca YX
BGC0002318.2	0.60	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0002064.2	0.60	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0002289.2	0.60	ribosomal	Leepeptin	Streptomyces leeuwenhoekii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for A6A06_RS11750

A6A06_RS11750

Leader:

MPDIQEQPESVEYEAPELAEAGDFAELTL

Full core:

GFHGHHWDTFGGRGHGWW

Putative macrolactam:

GFHGHHWD

antiSMASH-DB 4.0 matches for A6A06_RS11750

100.0%

NZ_LWKZ01000012.1:

Lassopeptides: A6A06_RS11750_lassopeptide

1

GFHGHHWDTFGGRGHGWW

18

GFHGHHWDTFGGRGHGWW

1

GFHGHHWDTFGGRGHGWW

18

42.1%

NZ_CP110636.1:

Lassopeptides: OJ254_RS13580_lassopeptide

1

GFHGHHWDTFGGR

13

GF G+HWD + GR

1

GFSGYHWDGWAGR

13

36.8%

NZ_FQVL01000016.1:

Lassopeptides: BUB71_RS19780_lassopeptide

1

GFHGHHWDTFGGR

13

G GH+ DTF R

2

GKDGHNTDTFSTR

14

with 1 more sequence matches

26.1%

NZ_AULE01000001.1:

Lassopeptides: H509_RS27430_lassopeptide

4

GHHWDTFGGRG

14

G + D FGGR

5

GKYTDVFGGRA

15

MIBiG 4.0 matches for A6A06_RS11750

19.0%

BGC0000581.6 (AAD28494.1):

Lasso peptide: microcin J25

11

GGRGH

15

GG GH

1

GGAGH

5

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.63 out of 24.78

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.96 out of 29.25

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.31 out of 26.85

Confidence: medium

Additional weak hits (8):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.19 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.63 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.76 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.53 out of 35.63

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.63 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

A6A06_RS11750 - Class II: Cleavage pHMM score: 3.30; RODEO score: 20; Monoisotopic mass: 2114.9 Da; Molecular weight: 2116.2 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 84; Score: 70.4

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
RutR	Regulator of the pyrimidine and purine metabolism
SypG	Regulator of biofilm formation and host colonization

NZ_LWKZ01000012.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 560,342 - 581,568 nt. (total: 21,227 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS14020: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

A6A06_RS14045: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

A6A06_RS14040: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Translocases: permease transporter

A6A06_RS14005: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

A6A06_RS14095: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.81	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.63	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.62	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000923.3	0.40	other (other)	paerucumarin	Pseudomonas aeruginosa PAO1
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001197.5	0.40	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000204.5	0.37	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0000218.5	0.36	PKS	doxorubicin	Streptomyces peucetius
BGC0002138.2	0.36	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.81	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.63	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.62	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000923.3	0.40	other (other)	paerucumarin	Pseudomonas aeruginosa PAO1
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001197.5	0.40	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000204.5	0.37	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0000218.5	0.36	PKS	doxorubicin	Streptomyces peucetius
BGC0002138.2	0.36	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

A6A06_RS14040: T1TS

Domain 1 (51 - 402): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.75 out of 23.79

Confidence: medium

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.81 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.59 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.28 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.60 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.61 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.16 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.22 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000012.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 652,370 - 703,532 nt. (total: 51,163 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS14470: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase methyltransferase

A6A06_RS14480: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

A6A06_RS14485: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

A6A06_RS14555: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

A6A06_RS14535: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

A6A06_RS14490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

Additional weak hits (12):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.45 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.68 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.76 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.57 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.99 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.23 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.82 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 652369 - 703532:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Aad - Cys - D-Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS14490: Aad - Cys - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (238..653): Aad

nrpys: Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: aad (Aad)
Single AA prediction:: aad (Aad)

Stachelhaus prediction details:

Stachelhaus sequence:: SDLAFEPHLRQINALLVGEINEYAFTEAAFVTAV
Nearest Stachelhaus code(s):: Aad EPRNLVEFVK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1337..1745): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: LSLSFDHFVEQDSGDAIGEINGYGPTEISITSHK
Nearest Stachelhaus code(s):: Cys DHESDIGITK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2428..2833): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: FQVAFDFSVEQLSGLVAGESNAYGTTETAVYNTV
Nearest Stachelhaus code(s):: Val DFESLAAVYK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_LWKZ01000012.1 - Region 4 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 888,675 - 911,314 nt. (total: 22,640 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS15600: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: glycosyltransferase methyltransferase

A6A06_RS15645: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

A6A06_RS15650: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

A6A06_RS15595: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.69	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.56	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.52	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.69	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.56	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.52	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for A6A06_RS15615

A6A06_RS15620

Leader:

MALLDLQAMDAPEHGGGGGGS

Core:

EASLLLCWSDASIVLCL

Core with dehydrations:

EADhaLLLCysWDhaDADhaIVLCysL

antiSMASH-DB 4.0 matches for A6A06_RS15620

100.0%

NZ_LWKZ01000012.1:

Lanthipeptides: A6A06_RS15620_lanthipeptide

1

EASLLLCWSDASIVLCL

17

EASLLLCWSDASIVLCL

1

EASLLLCWSDASIVLCL

17

94.1%

NZ_JAFIQY010000032.1:

Lanthipeptides: JXZ78_RS28825_lanthipeptide

1

EASLLLCWSDASIVLCL

17

EASLLLCWS+ASIVLCL

1

EASLLLCWSEASIVLCL

17

76.2%

NZ_CP022685.1and 3 others:

NZ_CP023699.1 Lanthipeptides: CP970_RS30515_lanthipeptideNZ_CP029191.1 Lanthipeptides: DEJ49_RS10405_lanthipeptideNZ_CP029193.1 Lanthipeptides: DEJ47_RS10815_lanthipeptide

Lanthipeptides: KY5_RS12005_lanthipeptide

2

ASLLLCWSDASIVLCL

17

ASLLLCWSDASIVLCL

6

ASLLLCWSDASIVLCL

21

with 50 more sequence matches

Only the first 10 are displayed here.

76.2%

NZ_CP029192.1and 1 other:

NZ_CP101750.1 Lanthipeptides: NOO62_RS12495_lanthipeptide

Lanthipeptides: DEJ48_RS27490_lanthipeptide

1

EASLLLCWSDASIVLCL

17

+ASLLLCWSDASIVLCL

5

QASLLLCWSDASIVLCL

21

70.6%

NZ_CP023689.1and 2 others:

NZ_CP056041.1 Lanthipeptides: HUT05_RS04385_lanthipeptideNZ_CP116353.1 Lanthipeptides: PGH47_RS39355_lanthipeptide

Lanthipeptides: CP983_RS02925_lanthipeptide

3

SLLLCWSDASIVLCL

17

SLLLC S ASI LCL

3

SLLLCASQASISLCL

17

70.6%

NZ_KQ948929.1:

Lanthipeptides: AQJ67_RS21030_lanthipeptide

3

SLLLCWSDASIVLCL

17

SLLLC S ASI LCL

1

SLLLCASQASITLCL

15

65.0%

NZ_BNBL01000010.1and 1 other:

NZ_CP071595.1 Lanthipeptides: J3S04_RS21315_lanthipeptide

Lanthipeptides: IE295_RS24405_lanthipeptide

1

EASLLLCWSDASIVLCL

17

ASLLLCWS AS+ LCL

4

NASLLLCWSTASVALCL

20

64.7%

NC_020504.1and 2 others:

NZ_CP114413.1 Lanthipeptides: STRCI_RS37065_lanthipeptideNZ_KQ948993.1 Lanthipeptides: AQJ84_RS21420_lanthipeptide

Lanthipeptides: BN159_RS04910_lanthipeptide

3

SLLLCWSDASIVLCL

17

SLL C S ASI LCL

3

SLLSCVSAASITLCL

17

64.7%

NZ_CM002285.1and 2 others:

NZ_CP047020.1 Lanthipeptides: GQF42_RS39440_lanthipeptideNZ_VISR01000012.1 Lanthipeptides: FB157_RS21700_lanthipeptide

Lanthipeptides: M878_RS54195_lanthipeptide

3

SLLLCWSDASIVLCL

17

SLL C S ASI+LCL

3

SLLSCVSAASILLCL

17

64.7%

NZ_CP011497.1and 4 others:

NZ_CP017248.1 Lanthipeptides: BFF78_RS03720_lanthipeptideNZ_CP034687.1 Lanthipeptides: ELQ87_RS02805_lanthipeptideNZ_CP106795.1 Lanthipeptides: N8I86_RS33235_lanthipeptideNZ_LIWA01000002.1 Lanthipeptides: AMK32_RS11185_lanthipeptide

Lanthipeptides: ABB07_RS02975_lanthipeptide

1

EASLLLCWSDASIVLCL

17

ASLL C S AS++LCL

1

TASLLSCVSAASVLLCL

17

64.7%

NZ_CP013743.1and 1 other:

NZ_JAJSBI010000005.1 Lanthipeptides: LJ657_RS12685_lanthipeptide

Lanthipeptides: AS200_RS06110_lanthipeptide

1

EASLLLCWSDASIVLCL

17

ASLL C S AS++LCL

1

TASLLSCISAASVLLCL

17

64.7%

NZ_CP074380.1:

Lanthipeptides: KGS77_RS26180_lanthipeptide

3

SLLLCWSDASIVLCL

17

SLLLC S AS+ LCL

3

SLLLCNSHASVTLCL

17

63.2%

NZ_CP032402.1and 1 other:

NZ_CP032402.1 Lanthipeptides: D3U04_RS17070_lanthipeptide

Lanthipeptides: D3U04_RS17070_lanthipeptide

2

ASLLLC--WSDASIVLCL

17

ASLLLC S S VLCL

2

ASLLLCDKHSSQSTVLCL

19

MIBiG 4.0 matches for A6A06_RS15620

40.9%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

EASLLLC-WSDASIVLC

16

+ SLL+C +S S+VLC

4

QVSLLVCEYSSLSVVLC

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.51 out of 29.72

Confidence: medium

Additional weak hits (3):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.52 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.87 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.98 out of 28.14

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

A6A06_RS15620 - Class III

Cleavage pHMM score: 20.60

RODEO score: 0

Monoisotopic mass: 1780.9 Da

Molecular weight: 1782.1 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1800.1 Da N = 1

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_LWKZ01000012.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 1,034,633 - 1,056,924 nt. (total: 22,292 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

A6A06_RS16220: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Lyases: cyclase

A6A06_RS16255: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

A6A06_RS16230: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000667.3	0.51	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001137.5	0.42	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000842.5	0.41	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002493.3	0.39	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001909.3	0.35	PKS	strobilurin A	Strobilurus tenacellus
BGC0000649.3	0.35	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000667.3	0.51	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001137.5	0.42	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000842.5	0.41	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002493.3	0.39	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001909.3	0.35	PKS	strobilurin A	Strobilurus tenacellus
BGC0000649.3	0.35	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

A6A06_RS16255: T1TS + T1TS

Domain 1 (1 - 309): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (327 - 691): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.31 out of 26.85

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.18 out of 27.18

Confidence: medium

Additional weak hits (3):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.90 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.50 out of 21.55

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
NrdR	Represses ribonucleotide reductase encoding genes
RutR	Regulator of the pyrimidine and purine metabolism

NZ_LWKZ01000017.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 2,494 - 23,567 nt. (total: 21,074 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase synthetase

A6A06_RS18325: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

A6A06_RS18335: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.45	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.45	terpene	sodorifen	Serratia plymuthica
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000666.5	0.35	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001456.3	0.34	terpene	isorenieratene	Streptomyces argillaceus
BGC0000668.5	0.33	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.45	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.45	terpene	sodorifen	Serratia plymuthica
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000666.5	0.35	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001456.3	0.34	terpene	isorenieratene	Streptomyces argillaceus
BGC0000668.5	0.33	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

A6A06_RS18335: PT_FPPS_like

Domain 1 (44 - 348): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.22 out of 23.79

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.29 out of 27.55

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.66 out of 30.12

Confidence: medium

Additional weak hits (4):

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.74 out of 25.31

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 26.85

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.27 out of 25.88

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_LWKZ01000023.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 58,908 - 129,402 nt. (total: 70,495 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS19005: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

A6A06_RS19080: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS19090: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase methyltransferase

A6A06_RS18995: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

A6A06_RS19125: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

A6A06_RS19120: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: ligase synthase

A6A06_RS19010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS19015: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS19025: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS19030: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

A6A06_RS19035: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

A6A06_RS19050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS19085: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS19095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	1.35	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	1.30	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	1.28	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	1.27	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	1.26	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	1.23	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	1.17	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002276.2	1.01	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001023.5	0.98	NRPS, PKS	myxochromide S1	Stigmatella aurantiaca
BGC0002286.3	0.96	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.66	NRPS	peramine	Epichloe festucae
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.01 out of 27.18

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.63 out of 18.46

Confidence: medium

Additional weak hits (19):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.20 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.74 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.87 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.99 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.30 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.36 out of 28.14

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.77 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.05 out of 32.74

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.82 out of 23.43

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.78 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.32 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.19 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.71 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.86 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.27 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 58907 - 129402:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ohmal) + (X) + (Arg) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 58907 - 105625:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ohmal) + (X) + (Arg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 71573 - 125946:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ohmal) + (X) + (Arg) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 87509 - 129402:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Arg) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS19010: X

AMP-binding (30..417): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HVWSWDSAVQDAHSALGGDAGAYGSTECSCALLR
Nearest Stachelhaus code(s):: Phe DAGALGACAK (38% 8Å match); Leu DALHSGAVAK (35% 8Å match)
Stachelhaus code match:: 60% (weak)

A6A06_RS19015: mal

PKS_AT (560..857): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 153.0
inactive: 91.0
Methoxymalonyl-CoA: 76.1
Methylmalonyl-CoA: 62.1
Propionyl-CoA: 57.5
Ethylmalonyl-CoA: 38.7
2-Methylbutyryl-CoA: 36.7
Isobutyryl-CoA: 31.2
CHC-CoA: 30.2
trans-1,2-CPDA: 22.3
Benzoyl-CoA: 18.0
Acetyl-CoA: 14.7
fatty_acid: 14.3
3-Methylbutyryl-CoA: 10.9

A6A06_RS19050: X

AMP-binding (7..426): X

nrpys: Ile, Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LPTAWDAASLEGWLMVGGEVNGYGPAETTVFTTT
Nearest Stachelhaus code(s):: Ile or Val DALWMGGVFK (65% 8Å match); Val DALWMGGVFK (56% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS19085: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (483..897): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YAVAFDVSLEEPNLVLGGELNAYGITEATVTSTV
Nearest Stachelhaus code(s):: Arg DVENVGAVTK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS19095: X

AMP-binding (1..411): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAYIFDAHLGDPIVFAGGDHNAYGPAEATVLCLT
Nearest Stachelhaus code(s):: Trp DAGIVGACAK (50% 8Å match); Val DAWMFAAVLK (47% 8Å match); aIle DALVFGVVLK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000023.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 153,782 - 174,846 nt. (total: 21,065 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

A6A06_RS19360: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: methyltransferase

A6A06_RS19310: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase lyase

A6A06_RS19305: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

A6A06_RS19315: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.69	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002318.2	0.42	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0002645.3	0.40	other (other)	fluopsin C	Pseudomonas aeruginosa PAO1
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001561.4	0.38	NRPS	curacomycin	Streptomyces curacoi
BGC0001458.4	0.37	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0001221.5	0.37	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001387.5	0.36	other (other)	nucleocidin	Streptomyces calvus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.69	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002318.2	0.42	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0002645.3	0.40	other (other)	fluopsin C	Pseudomonas aeruginosa PAO1
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001561.4	0.38	NRPS	curacomycin	Streptomyces curacoi
BGC0001458.4	0.37	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0001221.5	0.37	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001387.5	0.36	other (other)	nucleocidin	Streptomyces calvus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

A6A06_RS19315: T1TS

Domain 1 (3 - 348): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.02 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.94 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.19 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.32 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.41 out of 18.57

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.06 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.70 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_LWKZ01000023.1 - Region 3 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 177,891 - 226,161 nt. (total: 48,271 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS19495: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS19525: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase aminotransferase

A6A06_RS19385: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

A6A06_RS19595: acyltransferase

smcogs: SMCOG1141: acyltransferase

Lyases: dehydratase

A6A06_RS19480: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

A6A06_RS19395: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

A6A06_RS19485: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS19490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS19500: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS19505: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS19600: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	1.38	NRPS	antipain	Streptomyces sp.
BGC0001249.5	1.26	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	1.12	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	1.11	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	1.08	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	1.04	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	1.04	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	1.04	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	1.03	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	1.01	NRPS	peramine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	0.76	NRPS	antipain	Streptomyces sp.
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001239.3	0.67	other (other)	biotin	Aspergillus nidulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.29 out of 23.79

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (24):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.04 out of 25.88

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.13 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.71 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.38 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.56 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.70 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.13 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.75 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.43 out of 20.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.02 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.85 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.34 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.48 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.11 out of 28.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.37 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.25 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 177890 - 226161:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 177890 - 219789:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 179790 - 221695:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 182942 - 226161:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS19485: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (17..410): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LRPSFDASAFEGVLLAGGEVNGYGPTEATTFATA
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

A6A06_RS19490: X

AMP-binding (42..443): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWYVFDPHVKEAVLVVGGDHNAYGPAEATVVTTV
Nearest Stachelhaus code(s):: Phe DPLVVGAVVK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

A6A06_RS19500: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (479..882): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HATAFDVALEEPNLVLGGEFNAYGVTEAAITSTV
Nearest Stachelhaus code(s):: Arg DVENVGAITK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
ToxT	Regulator of MSHA biosynthesis

NZ_LWKZ01000023.1 - Region 4 - NRPS

Download region GenBank file

Download region SVG

Location: 274,208 - 318,371 nt. (total: 44,164 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

A6A06_RS19830: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS19855: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Hydrolases: deformylase

A6A06_RS19820: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: ligase synthase

A6A06_RS19900: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A6A06_RS19905: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.73 out of 23.79

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.61 out of 29.51

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.29 out of 29.51

Confidence: medium

Additional weak hits (7):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.17 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.04 out of 39.62

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.97 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.49 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.35 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 274207 - 318371:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS19905: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (476..906): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHAFDTAWEGFDLMVGGEYNYYGPTECTVDAVY
Nearest Stachelhaus code(s):: Orn DTEDMGYVDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000023.1 - Region 5 - NRPS

Download region GenBank file

Download region SVG

Location: 320,862 - 366,816 nt. (total: 45,955 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS20015: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

A6A06_RS20050: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

A6A06_RS20110: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

A6A06_RS20080: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS20085: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS20090: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transporter

A6A06_RS20005: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

A6A06_RS20030: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.91 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.29 out of 36.53

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.24 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.19 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.45 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.85 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 320861 - 366816:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg - X) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS20080: Hpg - X

Search NORINE for peptide: strict or relaxed

AMP-binding (454..831): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASFLEVHLLTGGDRHLYGPTETTLCATV
Nearest Stachelhaus code(s):: Hpg DALHLGLLCK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1491..1872): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LALASGTALLEAFLVVGGEWNTHGTTECTMISTV
Nearest Stachelhaus code(s):: Dhpg DALSVGTVIK (50% 8Å match); bLys DTEDVGTMVK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_LWKZ01000023.1 - Region 6 - NRPS,terpene

Download region GenBank file

Download region SVG

Location: 455,258 - 501,047 nt. (total: 45,790 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS20615: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

A6A06_RS20620: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS20680: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase

A6A06_RS20600: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: amidase esterase hydrolase

A6A06_RS20555: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

A6A06_RS20580: amidase

smcogs: SMCOG1105: amidase

A6A06_RS20670: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

A6A06_RS20725: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: hydratase

A6A06_RS20695: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

A6A06_RS20660: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000343.5	0.39	NRPS	enterobactin	Pseudomonas sp. J465
BGC0002173.2	0.39	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0001928.2	0.38	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000675.5	0.35	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0001758.4	0.35	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0000677.5	0.35	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001833.4	0.35	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.34	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.34	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

A6A06_RS20610: T2TS

Domain 1 (252 - 506): Type 2 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.56 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.73 out of 36.53

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (18):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.95 out of 30.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 26.85

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.49 out of 39.62

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.57 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.96 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.57 out of 36.53

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.13 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.96 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 455257 - 501047:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 14, location 457105 - 501047:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS20660: X

AMP-binding (476..871): X

nrpys: Ala, Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVTH
Nearest Stachelhaus code(s):: Ala or Ser DVWHFSLVDK (100% 8Å match); Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000023.1 - Region 7 - 2dos

Download region GenBank file

Download region SVG

Location: 505,979 - 529,552 nt. (total: 23,574 nt) Show pHMM detection rules used

2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS20780: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: aminotransferase glycosyltransferase

A6A06_RS20785: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

A6A06_RS20795: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Isomerases: mutase

A6A06_RS20820: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

A6A06_RS20790: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000708.5	0.66	saccharide	lividomycin	Streptomyces lividus
BGC0000711.5	0.65	saccharide	neomycin	Streptomyces fradiae
BGC0000709.5	0.65	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000713.5	0.61	saccharide	ribostamycin	Streptomyces ribosidificus
BGC0000712.5	0.51	saccharide	paromomycin	Streptomyces rimosus subsp. paromomycinus
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000719.5	0.50	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.3	0.49	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000519.4	0.48	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000721.4	0.45	saccharide	tobramycin	Streptoalloteichus tenebrarius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000708.5	0.66	saccharide	lividomycin	Streptomyces lividus
BGC0000711.5	0.65	saccharide	neomycin	Streptomyces fradiae
BGC0000709.5	0.65	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0000713.5	0.61	saccharide	ribostamycin	Streptomyces ribosidificus
BGC0000712.5	0.51	saccharide	paromomycin	Streptomyces rimosus subsp. paromomycinus
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000719.5	0.50	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.3	0.49	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000519.4	0.48	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000721.4	0.45	saccharide	tobramycin	Streptoalloteichus tenebrarius

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.64 out of 26.85

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.93 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.54 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.08 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.75 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.96 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_LWKZ01000023.1 - Region 8 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 544,254 - 659,113 nt. (total: 114,860 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxygenase

A6A06_RS20885: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS20950: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS20980: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS21015: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: aminotransferase glycosyltransferase

A6A06_RS20970: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

A6A06_RS20975: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Hydrolases: esterase hydrolase

A6A06_RS20910: thioesterase

smcogs: SMCOG1004: thioesterase

A6A06_RS21005: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

A6A06_RS20905: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

A6A06_RS20935: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS20940: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS20945: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS20955: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS20990: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000138.5	0.81	PKS	rimocidin	Streptomyces diastaticus
BGC0001273.3	0.69	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.69	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002106.3	0.66	PKS	rimocidin	Streptomyces rimosus subsp. rimosus NRRL WC-3558
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002540.3	0.57	PKS	tetramycin B	Streptomyces hygrospinosus subsp. beijingensis
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001257.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.56	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002106.3	0.77	PKS	rimocidin	Streptomyces rimosus subsp. rimosus NRRL WC-3558
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000138.5	0.74	PKS	rimocidin	Streptomyces diastaticus
BGC0002540.3	0.74	PKS	tetramycin B	Streptomyces hygrospinosus subsp. beijingensis
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000016.4	0.71	other (other)	amphotericin B	Streptomyces nodosus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.21 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 29.30 out of 30.12

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (14):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.47 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.42 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.07 out of 30.22

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.28 out of 29.51

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.20 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.04 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.37 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.30 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.30 out of 20.01

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.99 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.62 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.99 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 544253 - 659113:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - Me-ohmal - ohmal - ohmal - ohmal) + (ccmal) + (ccmal) + (ohmal - ccmal - ccmal - ccmal) + (X - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS20935: mal - mal - mmal - mal - mal - mal

PKS_AT (561..865): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.7
inactive: 84.1
Methoxymalonyl-CoA: 52.0
Methylmalonyl-CoA: 46.7
Propionyl-CoA: 27.7
Acetyl-CoA: 26.8
Isobutyryl-CoA: 14.5
Ethylmalonyl-CoA: 13.6
Benzoyl-CoA: 13.6
CHC-CoA: 12.8
2-Methylbutyryl-CoA: 8.7
trans-1,2-CPDA: 8.4
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2321..2620): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 199.1
inactive: 82.7
Methoxymalonyl-CoA: 69.6
Methylmalonyl-CoA: 63.6
Isobutyryl-CoA: 44.3
Benzoyl-CoA: 33.6
Propionyl-CoA: 31.8
Acetyl-CoA: 31.1
Ethylmalonyl-CoA: 25.6
2-Methylbutyryl-CoA: 23.0
CHC-CoA: 22.1
fatty_acid: 20.0
trans-1,2-CPDA: 14.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3859..4156): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.0
Ethylmalonyl-CoA: 195.1
Methoxymalonyl-CoA: 175.3
2-Methylbutyryl-CoA: 130.3
trans-1,2-CPDA: 124.4
Propionyl-CoA: 104.5
CHC-CoA: 98.4
Malonyl-CoA: 87.0
Isobutyryl-CoA: 80.4
Benzoyl-CoA: 60.4
Acetyl-CoA: 39.9
fatty_acid: 31.6
3-Methylbutyryl-CoA: 29.0
inactive: 18.3

PKS_AT (5393..5693): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.5
inactive: 102.3
Methoxymalonyl-CoA: 73.5
Methylmalonyl-CoA: 61.4
Isobutyryl-CoA: 44.9
Propionyl-CoA: 25.5
Ethylmalonyl-CoA: 21.1
Benzoyl-CoA: 18.7
fatty_acid: 18.1
Acetyl-CoA: 17.9
3-Methylbutyryl-CoA: 12.4
2-Methylbutyryl-CoA: 10.6
CHC-CoA: 10.5
trans-1,2-CPDA: 8.2

PKS_AT (6913..7198): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.6
inactive: 107.8
Methoxymalonyl-CoA: 67.1
Methylmalonyl-CoA: 63.0
Propionyl-CoA: 33.3
Isobutyryl-CoA: 24.3
Acetyl-CoA: 22.4
Ethylmalonyl-CoA: 21.1
Benzoyl-CoA: 18.8
2-Methylbutyryl-CoA: 16.5
CHC-CoA: 7.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8424..8717): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.9
inactive: 109.1
Methoxymalonyl-CoA: 74.4
Methylmalonyl-CoA: 71.2
Propionyl-CoA: 43.2
Isobutyryl-CoA: 34.7
Ethylmalonyl-CoA: 32.2
Benzoyl-CoA: 25.6
2-Methylbutyryl-CoA: 25.6
CHC-CoA: 22.9
Acetyl-CoA: 19.9
fatty_acid: 16.8
trans-1,2-CPDA: 13.5
3-Methylbutyryl-CoA: 0.0

A6A06_RS20940: mal

PKS_AT (551..836): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 237.6
inactive: 109.2
Methoxymalonyl-CoA: 69.4
Methylmalonyl-CoA: 65.0
Propionyl-CoA: 35.5
Acetyl-CoA: 25.6
Isobutyryl-CoA: 24.2
Benzoyl-CoA: 18.5
Ethylmalonyl-CoA: 18.4
2-Methylbutyryl-CoA: 16.6
CHC-CoA: 4.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

A6A06_RS20945: mal

PKS_AT (547..834): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 236.7
inactive: 108.6
Methoxymalonyl-CoA: 70.4
Methylmalonyl-CoA: 64.9
Propionyl-CoA: 40.4
Acetyl-CoA: 28.9
Isobutyryl-CoA: 23.6
2-Methylbutyryl-CoA: 19.4
Benzoyl-CoA: 19.1
Ethylmalonyl-CoA: 18.8
fatty_acid: 7.7
CHC-CoA: 7.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

A6A06_RS20955: mal - mal - mal - mal

PKS_AT (566..865): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.2
inactive: 111.5
Methoxymalonyl-CoA: 69.3
Methylmalonyl-CoA: 61.2
Isobutyryl-CoA: 47.8
Propionyl-CoA: 37.5
Benzoyl-CoA: 23.3
Ethylmalonyl-CoA: 22.8
Acetyl-CoA: 22.3
2-Methylbutyryl-CoA: 15.8
trans-1,2-CPDA: 15.6
fatty_acid: 10.2
3-Methylbutyryl-CoA: 7.1
CHC-CoA: 3.3

PKS_AT (2108..2407): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 91.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.3
inactive: 109.4
Methoxymalonyl-CoA: 50.1
Methylmalonyl-CoA: 40.2
Propionyl-CoA: 19.4
Acetyl-CoA: 18.6
Ethylmalonyl-CoA: 16.9
Benzoyl-CoA: 15.1
2-Methylbutyryl-CoA: 11.9
fatty_acid: 11.5
Isobutyryl-CoA: 9.4
CHC-CoA: 3.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3845..4135): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 226.5
inactive: 105.7
Methoxymalonyl-CoA: 47.1
Methylmalonyl-CoA: 37.0
Acetyl-CoA: 23.9
Propionyl-CoA: 22.8
Benzoyl-CoA: 17.1
fatty_acid: 13.2
Ethylmalonyl-CoA: 12.0
Isobutyryl-CoA: 11.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -2.3

PKS_AT (5547..5836): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 95.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.8
inactive: 120.7
Methoxymalonyl-CoA: 53.6
Methylmalonyl-CoA: 44.5
Acetyl-CoA: 24.6
Propionyl-CoA: 22.8
Ethylmalonyl-CoA: 20.3
Benzoyl-CoA: 18.0
2-Methylbutyryl-CoA: 13.9
Isobutyryl-CoA: 13.5
fatty_acid: 9.3
CHC-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

A6A06_RS20990: X - mal

AMP-binding (29..442): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TVTCHLFGLQAAFARTAGAVVVWGMSEIGTGTRT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

PKS_AT (1190..1492): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.6
inactive: 70.6
Methoxymalonyl-CoA: 69.5
Methylmalonyl-CoA: 63.7
Propionyl-CoA: 36.4
Isobutyryl-CoA: 35.2
Ethylmalonyl-CoA: 30.3
2-Methylbutyryl-CoA: 23.9
Benzoyl-CoA: 23.1
CHC-CoA: 22.8
Acetyl-CoA: 19.8
fatty_acid: 14.1
3-Methylbutyryl-CoA: 8.6
trans-1,2-CPDA: 6.1

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NZ_LWKZ01000023.1 - Region 9 - NRPS,NRPS-like,arylpolyene,terpene

Download region GenBank file

Download region SVG

Location: 684,085 - 763,671 nt. (total: 79,587 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

A6A06_RS21160: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS21175: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

A6A06_RS21180: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

A6A06_RS21210: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

A6A06_RS21260: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

A6A06_RS21290: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS21370: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

A6A06_RS21390: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS21425: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS21435: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: acylase aminotransferase methyltransferase

A6A06_RS21230: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

A6A06_RS21300: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

A6A06_RS21350: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

A6A06_RS21295: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase hydratase

A6A06_RS21255: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A6A06_RS21280: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A6A06_RS21430: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase synthetase

A6A06_RS21235: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

A6A06_RS21240: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS21250: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS21270: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

A6A06_RS21305: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS21315: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS21330: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS21365: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

A6A06_RS21405: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

A6A06_RS21470: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.22	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	1.21	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	1.18	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	1.17	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.17	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.13	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	1.13	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	1.12	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	1.09	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	1.05	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

A6A06_RS21365: PT_FPPS_like

Domain 1 (58 - 369): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

A6A06_RS21380: TS_Pyr4

Domain 1 (12 - 215): Pyr4 type terpene synthase

Subtype: unknown

A6A06_RS21405: PT_FPPS_like

Domain 1 (61 - 347): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

A6A06_RS21430: T1TS

Domain 1 (11 - 322): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.49 out of 24.78

Confidence: medium

Additional weak hits (8):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.61 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.10 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.54 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.28 out of 31.73

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.03 out of 30.12

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.30 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.72 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 17, location 684084 - 763671:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Asn - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 18, location 684084 - 725395:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 19, location 697651 - 744002:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Asn - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 20, location 706134 - 748573:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Asn - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS21230: mal

PKS_AT (5..282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 99.3
inactive: 36.9
Methoxymalonyl-CoA: 28.4
Methylmalonyl-CoA: 28.3
Propionyl-CoA: 15.9
2-Methylbutyryl-CoA: 15.8
CHC-CoA: 11.9
trans-1,2-CPDA: 11.0
Ethylmalonyl-CoA: 10.5
fatty_acid: 8.9
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

A6A06_RS21315: Asn - X

Search NORINE for peptide: strict or relaxed

AMP-binding (468..870): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YRASFDITLTAGKAIVAGEINHYGPSEATCGCVD
Nearest Stachelhaus code(s):: Asp DLTKIGHIGK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1533..1932): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQGFDAFLLEMTMVVAGEVNLYGPTEGSVITSW
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

A6A06_RS21330: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (209..606): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LGPSFDASTIEALLLTGGETNGYGPTENTSFTTC
Nearest Stachelhaus code(s):: Leu DAILLGGIAK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis

NZ_LWKZ01000023.1 - Region 10 - RiPP-like

Download region GenBank file

Download region SVG

Location: 776,960 - 788,867 nt. (total: 11,908 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

A6A06_RS21565: methyltransferase

smcogs: SMCOG1248: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.38	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000528.5	0.36	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.35	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002346.3	0.32	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000468.5	0.31	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.31	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.31	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001753.3	0.30	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.38	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000528.5	0.36	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.35	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002346.3	0.32	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000468.5	0.31	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.31	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.31	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001753.3	0.30	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.52 out of 23.79

Confidence: medium

Additional weak hits (1):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.52 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000023.1 - Region 11 - T1PKS,azoxy-crosslink

Download region GenBank file

Download region SVG

Location: 847,950 - 910,488 nt. (total: 62,539 nt) Show pHMM detection rules used

azoxy-crosslink: (azdH and LPG_synthase_C and azdO and vlmB)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer

A6A06_RS21845: flavodoxin

smcogs: SMCOG1134: flavodoxin

A6A06_RS21870: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

A6A06_RS21875: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS21965: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

A6A06_RS21985: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

A6A06_RS22050: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS22080: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS22105: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase methyltransferase

A6A06_RS21880: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

A6A06_RS22100: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

A6A06_RS21990: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: dehydratase

A6A06_RS22055: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

A6A06_RS21900: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

A6A06_RS21910: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS43545: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.49	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.49	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.38	PKS	oronofacic acid	Pseudomonas syringae
BGC0002711.2	0.34	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000882.5	0.33	other (other)	mildiomycin	Streptomyces rimofaciens
BGC0002227.3	0.31	NRPS	AKML B, AKML D, AKML A, AKML C	Aspergillus luchuensis IFO 4308
BGC0000272.3	0.30	PKS	spore pigment	Streptomyces collinus
BGC0000234.5	0.29	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001161.5	0.29	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001162.3	0.29	PKS	1-heptadecene	Moorea producens JHB

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0000041.3	0.59	PKS	oronofacic acid	Pseudomonas syringae
BGC0002227.3	0.52	NRPS	AKML B, AKML D, AKML A, AKML C	Aspergillus luchuensis IFO 4308
BGC0002711.2	0.51	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000919.5	0.51	other (other)	phaseolotoxin	Pseudomonas syringae

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.92 out of 32.93

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.82 out of 30.11

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (12):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.44 out of 32.93

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.83 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.86 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.75 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.01 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.57 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 23, location 847949 - 910488:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 25, location 863654 - 910488:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS43545: mmal

PKS_AT (532..825): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 146.0
Ethylmalonyl-CoA: 128.2
Methoxymalonyl-CoA: 119.2
Malonyl-CoA: 88.7
2-Methylbutyryl-CoA: 81.4
Propionyl-CoA: 73.8
trans-1,2-CPDA: 69.5
CHC-CoA: 62.6
Isobutyryl-CoA: 60.1
Benzoyl-CoA: 39.0
inactive: 33.6
Acetyl-CoA: 30.4
3-Methylbutyryl-CoA: 16.4
fatty_acid: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor
LexA variant 3	Repressor of DNA damage response
OsdR	Development and stress management regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_LWKZ01000023.1 - Region 12 - lassopeptide

Download region GenBank file

Download region SVG

Location: 915,993 - 938,591 nt. (total: 22,599 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

A6A06_RS22205: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: synthase

A6A06_RS22245: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.73	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.4	0.71	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001552.3	0.65	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.63	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001550.3	0.62	ribosomal	citrulassin D	Streptomyces katrae
BGC0000575.5	0.61	ribosomal	lariatin	Rhodococcus jostii
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.3	0.73	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.4	0.71	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001552.3	0.65	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.3	0.63	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001550.3	0.62	ribosomal	citrulassin D	Streptomyces katrae
BGC0000575.5	0.61	ribosomal	lariatin	Rhodococcus jostii
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001548.4	0.60	ribosomal	citrulassin A	Streptomyces albulus
BGC0001539.4	0.60	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.58 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (5):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.43 out of 39.62

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.40 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.22 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.06 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.43 out of 26.85

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 84; Score: 75.5

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000023.1 - Region 13 - NRPS,T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 990,675 - 1,085,650 nt. (total: 94,976 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

A6A06_RS22520: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

A6A06_RS22700: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

A6A06_RS22750: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

A6A06_RS22810: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS22815: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: acyltransferase aminotransferase

A6A06_RS22530: aminotransferase

smcogs: SMCOG1019: aminotransferase

A6A06_RS22600: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

A6A06_RS22760: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

A6A06_RS22560: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase hydratase

A6A06_RS22825: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A6A06_RS22830: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: synthase synthetase

A6A06_RS22705: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

A6A06_RS22720: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	1.64	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	1.39	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	1.29	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	1.23	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	1.22	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0002135.2	1.03	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.01	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.99	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.99	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.98	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000664.5	0.73	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

A6A06_RS22675: Lycopene_cycl

Domain 1 (6 - 383): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

A6A06_RS41965: PT_phytoene_like

Domain 1 (16 - 307): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

A6A06_RS22705: PT_FPPS_like

Domain 1 (54 - 373): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 25.31

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

Additional weak hits (15):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.04 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.03 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.32 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.71 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.14 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.82 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.19 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.59 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.30 out of 36.54

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 27, location 990674 - 1085650:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal) + (NMe-Ser - D-Ala - Tyr - Phe - Leu - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 28, location 990674 - 1052535:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Ser - D-Ala - Tyr - Phe - Leu - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 30, location 1034368 - 1077656:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 31, location 1037700 - 1085650:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS22600: Ser - Ala - Tyr - Phe - Leu - X

Search NORINE for peptide: strict or relaxed

AMP-binding (29..449): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDVSVWEGCQVLAGEVNMYGTTETTVHATY
Nearest Stachelhaus code(s):: Ser DVWNVAMVHK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1539..1947): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LDAHFDLSVWEGHQELGAEVHAYGPTETTVFVVA
Nearest Stachelhaus code(s):: His DYWHFGAVDK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (3172..3576): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVSDTKLAVAGEVNVYGPTEATVCVLM
Nearest Stachelhaus code(s):: Tyr DASTAAAVCK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (4251..4656): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LSQAFDASFWEMTLVVAGEVNAYGPTEATVCVLM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5335..5732): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVMEMLVVIGGEINAYGPTETTVCATL
Nearest Stachelhaus code(s):: Leu DAMLVGAVCK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (6395..6802): X

nrpys: me-bAla

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWCTFIDGTTEGTVVTSGEVNLYGASEASGDSLH
Nearest Stachelhaus code(s):: me-bAla LDTTVSLGDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

A6A06_RS22720: mal

PKS_AT (547..840): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 145.5
inactive: 88.5
Methylmalonyl-CoA: 73.1
Isobutyryl-CoA: 66.8
Methoxymalonyl-CoA: 64.7
Propionyl-CoA: 59.3
Ethylmalonyl-CoA: 46.4
2-Methylbutyryl-CoA: 34.3
Benzoyl-CoA: 30.6
fatty_acid: 22.0
Acetyl-CoA: 20.8
CHC-CoA: 19.0
trans-1,2-CPDA: 16.5
3-Methylbutyryl-CoA: 10.0

A6A06_RS22725: X

AMP-binding (1487..1943): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWHCFDASVLEPILLLGGDVNVYGPTETTVLCTT
Nearest Stachelhaus code(s):: aIle DALVFGVVLK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_LWKZ01000023.1 - Region 14 - NRPS,NRPS-like,betalactone

Download region GenBank file

Download region SVG

Location: 1,120,307 - 1,208,635 nt. (total: 88,329 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

A6A06_RS23085: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

A6A06_RS23110: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

A6A06_RS23165: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS23240: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS43560: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase carbamoyltransferase methyltransferase

A6A06_RS23080: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

A6A06_RS23210: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

A6A06_RS23330: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deaminase esterase hydrolase peptidase

A6A06_RS23145: thioesterase

smcogs: SMCOG1004: thioesterase

A6A06_RS23150: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

A6A06_RS23230: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

A6A06_RS23295: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

A6A06_RS23310: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: dehydratase hydratase lyase

A6A06_RS23100: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

A6A06_RS23200: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

A6A06_RS23315: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase synthase

A6A06_RS23095: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS23115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS23215: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS23220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS23225: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A6A06_RS23245: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS23275: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

A6A06_RS23285: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002582.3	1.98	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0002075.3	1.56	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	1.30	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.29	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.29	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.29	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.27	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	1.23	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	1.20	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	1.19	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002582.3	0.79	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.65	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 19.26

Confidence: medium

Additional weak hits (16):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.46 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.79 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.44 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.89 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.82 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.44 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 32, location 1120306 - 1208635:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-Cys) + (Cys) + (X) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 33, location 1120306 - 1198219:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-Cys) + (Cys) + (X) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 34, location 1158298 - 1200173:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 35, location 1165308 - 1208635:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS23115: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (532..928): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLLSGDISLGGATEAAIWSIH
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS23140: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (575..964): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TAVSFDLSVWDGNSLLSGDVALGGATEASVWSNV
Nearest Stachelhaus code(s):: Cys DLWNLSLIWK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

A6A06_RS23215: X

AMP-binding (446..865): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAMAFDASWQGLDGVIGGEFNVYGPTEFTVNATG
Nearest Stachelhaus code(s):: Dpr DAQDLAVVNK (65% 8Å match); Gln DAQDLGVVDK (62% 8Å match); Ile DAQDLGVVDK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

A6A06_RS23220: X

AMP-binding (28..432): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSMTFDPVLVDLQALCGGEWNIYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (76% 8Å match)
Stachelhaus code match:: 70% (weak)

A6A06_RS23245: X

AMP-binding (35..433): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSDYSDASTIEGYLSAGGEVNFYGPTENAVVSTA
Nearest Stachelhaus code(s):: Leu DAWYLGNVVK (59% 8Å match); Leu or Ile DAIYLGVVLK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_LWKZ01000024.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 64,707 - 91,469 nt. (total: 26,763 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS23790: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

A6A06_RS23825: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

A6A06_RS23755: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

A6A06_RS23830: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: deformylase

A6A06_RS23745: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase synthetase

A6A06_RS23760: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

A6A06_RS23785: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.75	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.75	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

A6A06_RS23780: T2TS

Domain 1 (31 - 665): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

A6A06_RS23785: PT_FPPS_like

Domain 1 (57 - 346): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

A6A06_RS23795: PT_phytoene_like

Domain 1 (17 - 300): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

A6A06_RS23800: PT_phytoene_like

Domain 1 (30 - 295): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.28 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.27 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.86 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.80 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_LWKZ01000024.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 223,501 - 299,315 nt. (total: 75,815 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase reductase

A6A06_RS24485: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS24490: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS24560: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

A6A06_RS24580: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: aminotransferase halogenase methyltransferase

A6A06_RS24465: aminotransferase

smcogs: SMCOG1019: aminotransferase

A6A06_RS24495: flavin-dependent tyrosine-like hpg halogenase

halogenases: flavin-dependent tyrosine-like hpg halogenase
MITE: MITE0000028Halogenation (identity: 73.90%)
smcogs: SMCOG1119: halogenase

A6A06_RS24585: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

A6A06_RS24565: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase

A6A06_RS24510: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS24520: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS41070: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

A6A06_RS24445: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002637.3	0.79	NRPS	rimomycin A, rimomycin B, rimomycin C	Streptomyces sp. WAC 06783
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0000326.5	0.75	NRPS	isocomplestatin	Streptomyces lavendulae
BGC0001133.4	0.65	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000351.5	0.65	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002637.3	0.79	NRPS	rimomycin A, rimomycin B, rimomycin C	Streptomyces sp. WAC 06783
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0000326.5	0.75	NRPS	isocomplestatin	Streptomyces lavendulae
BGC0001133.4	0.65	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000351.5	0.65	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (28):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.39 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.38 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.11 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.49 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.35 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.40 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.34 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.44 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.28 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.08 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.02 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.47 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.88 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.28 out of 36.54

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.23 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.68 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.56 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.91 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.09 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.94 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.51 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 223500 - 299315:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Hpg - D-Trp) + (D-Hpg) + (D-Hpg - D-Hpg - D-NMe-Tyr) + (Hpg)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS24510: Hpg - X

Search NORINE for peptide: strict or relaxed

AMP-binding (466..862): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDLAFDASLFEVHLLTGGDRHLYGPTETTLCATW
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1526..1903): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QYRV------PALVVSAGP---------TVVTGH
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

A6A06_RS24515: Hpg - Hpg - Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (462..865): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LERAFDVSLFEAHVLTGGDRHLYGPTEVTLCATW
Nearest Stachelhaus code(s):: Hpg DVFHLGLLCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2000..2407): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LERAFDASLYEAHLLTGGDRHLYGPTETTLCATW
Nearest Stachelhaus code(s):: Hpg DAYHLGLLCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3545..3943): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAAVSEMTVTVAGEVNAYGPTETTVCAAM
Nearest Stachelhaus code(s):: Tyr DASTTAAVCK (100% 8Å match); Phe or Tyr DASTTAAVCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS24520: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (474..872): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LERAFDASLFEVHLLTGGDRHLYGPTEATLSATW
Nearest Stachelhaus code(s):: Hpg DAFHLGLLSK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS41070: Hpg - Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (464..861): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LQRAFDASLFEVHLLTGGDRHLYGPTEAALCATW
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2074..2481): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: trp (Trp)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRVFDVSMGDPALVTGGEFNEYGVTEATVTSTV
Nearest Stachelhaus code(s):: Trp DVGVVGEVTK (97% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_LWKZ01000024.1 - Region 3 - 2dos

Download region GenBank file

Download region SVG

Location: 378,814 - 403,990 nt. (total: 25,177 nt) Show pHMM detection rules used

2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS25000: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acyltransferase aminotransferase methyltransferase

A6A06_RS24980: methyltransferase

smcogs: SMCOG1089: methyltransferase

A6A06_RS25015: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

A6A06_RS25025: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

A6A06_RS25030: methyltransferase

smcogs: SMCOG1089: methyltransferase

Isomerases: racemase

A6A06_RS24950: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase

A6A06_RS25010: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001616.3	0.51	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0000701.5	0.47	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000719.5	0.45	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.3	0.45	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000041.3	0.42	PKS	oronofacic acid	Pseudomonas syringae
BGC0000772.5	0.41	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000709.5	0.40	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0001774.5	0.40	other (other)	spicamycin	Streptomyces fimbriatus
BGC0000711.5	0.40	saccharide	neomycin	Streptomyces fradiae
BGC0000353.5	0.39	NRPS	tacrolimus	Streptomyces sp. MA6548

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001616.3	0.51	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0000701.5	0.47	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000719.5	0.45	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.3	0.45	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000041.3	0.42	PKS	oronofacic acid	Pseudomonas syringae
BGC0000772.5	0.41	saccharide	lipopolysaccharide	Brucella melitensis
BGC0000709.5	0.40	saccharide	neomycin	Streptomyces fradiae ATCC 10745 = DSM 40063
BGC0001774.5	0.40	other (other)	spicamycin	Streptomyces fimbriatus
BGC0000711.5	0.40	saccharide	neomycin	Streptomyces fradiae
BGC0000353.5	0.39	NRPS	tacrolimus	Streptomyces sp. MA6548

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (17):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.88 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.85 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.66 out of 20.01

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.24 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.66 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.00 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.84 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.06 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.10 out of 25.88

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.55 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.30 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.58 out of 26.85

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.74 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000024.1 - Region 4 - melanin

Download region GenBank file

Download region SVG

Location: 448,221 - 459,495 nt. (total: 11,275 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

A6A06_RS25285: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.59	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.39	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.39	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.38	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.37	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.36	other (other)	iso-A82775C	Pestalotiopsis fici

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.59	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.39	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.39	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.38	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.37	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001624.3	0.36	other (other)	iso-A82775C	Pestalotiopsis fici

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

NZ_LWKZ01000024.1 - Region 5 - NRPS,NRPS-like,T1PKS,indole,other

Download region GenBank file

Download region SVG

Location: 576,411 - 687,835 nt. (total: 111,425 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
indole: (indsynth or dmat or indole_PTase)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS25880: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

A6A06_RS25980: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS26060: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

A6A06_RS26115: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

A6A06_RS42075: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase methyltransferase

A6A06_RS25945: methyltransferase

smcogs: SMCOG1089: methyltransferase

A6A06_RS25975: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: amidase deaminase esterase hydrolase

A6A06_RS25820: amidase

smcogs: SMCOG1105: amidase

A6A06_RS26015: thioesterase

smcogs: SMCOG1004: thioesterase

A6A06_RS26035: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

A6A06_RS26065: thioesterase

smcogs: SMCOG1004: thioesterase

A6A06_RS26190: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: lyase

A6A06_RS25940: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

A6A06_RS25920: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

A6A06_RS26005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS26010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS26030: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A6A06_RS26045: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS26050: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS26090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS26110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	1.52	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	1.50	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.48	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.47	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.47	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	1.45	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.40	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	1.36	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	1.34	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001166.5	1.33	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001942.3	0.77	NRPS, PKS	malonomycin	Streptomyces rimosus subsp. paromomycinus
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.35 out of 24.78

Confidence: medium

Additional weak hits (25):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.63 out of 29.51

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.76 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.47 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.56 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.89 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.36 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.33 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.16 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.74 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.33 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.28 out of 27.55

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.88 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.47 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.94 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.05 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.60 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 576410 - 687835:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu) + (Val) + (Ser - Asp) + (mal - X) + (Val - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 603073 - 644834:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu) + (Val) + (Ser - Asp) + (mal - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 604937 - 687835:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu) + (Val) + (Ser - Asp) + (mal - X) + (Val - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS26005: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (13..409): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: FNPSFDAFHFESVVGAGGDYNCYGPAEITTGCTA
Nearest Stachelhaus code(s):: Val DAFWLGCTFK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

A6A06_RS26010: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (24..417): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: TDCAWDGLSLEAWLLVGGEVNGYGPAEATIFATH
Nearest Stachelhaus code(s):: Val DALWLGGTFK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

A6A06_RS26045: Ser - Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (497..893): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFVCSGEFNYYGPTEAAVDVTT
Nearest Stachelhaus code(s):: Ser DVWHVSYVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1554..1958): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWQTFDVMLRDLHAFLAGEVNLYGPTETTMAKFA
Nearest Stachelhaus code(s):: Asp DVRHFALMAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS26050: X

AMP-binding (1318..1726): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAEVMVTGEVNAYGPTEASDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEMTADDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS26090: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (10..412): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHATF
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS26110: Val - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (1..394): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWCTFDAAILDAFLVTGGELQIYGPTECTVCVAT
Nearest Stachelhaus code(s):: Val DALFVGIVLK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

PKS_AT (1674..1969): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 90.7
Methoxymalonyl-CoA: 58.6
inactive: 57.1
Methylmalonyl-CoA: 38.8
Ethylmalonyl-CoA: 30.0
fatty_acid: 27.0
Isobutyryl-CoA: 21.5
Propionyl-CoA: 17.1
Acetyl-CoA: 15.4
2-Methylbutyryl-CoA: 14.4
CHC-CoA: 13.5
Benzoyl-CoA: 13.5
trans-1,2-CPDA: 12.7
3-Methylbutyryl-CoA: 9.2

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000024.1 - Region 6 - RiPP-like

Download region GenBank file

Download region SVG

Location: 895,022 - 906,371 nt. (total: 11,350 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000843.5	0.26	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001650.4	0.25	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0000847.4	0.23	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0000700.5	0.20	saccharide	istamycin	Streptomyces tenjimariensis
BGC0001690.5	0.19	PKS	natamycin	Streptomyces gilvosporeus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000843.5	0.26	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001650.4	0.25	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0000847.4	0.23	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0000700.5	0.20	saccharide	istamycin	Streptomyces tenjimariensis
BGC0001690.5	0.19	PKS	natamycin	Streptomyces gilvosporeus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.17 out of 23.43

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.67 out of 23.43

Confidence: medium

Additional weak hits (1):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.70 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator

NZ_LWKZ01000024.1 - Region 7 - butyrolactone

Download region GenBank file

Download region SVG

Location: 1,009,432 - 1,020,418 nt. (total: 10,987 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS27640: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

A6A06_RS27655: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: hydrolase

A6A06_RS27620: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: hydratase

A6A06_RS27645: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.68	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.62	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.46	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001386.5	0.36	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000847.4	0.36	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0001304.3	0.36	PKS	aflavarin	Aspergillus flavus NRRL3357
BGC0001625.5	0.35	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883
BGC0000194.5	0.35	PKS	actinorhodin	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.68	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.62	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.46	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.40	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001386.5	0.36	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0000847.4	0.36	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0001304.3	0.36	PKS	aflavarin	Aspergillus flavus NRRL3357
BGC0001625.5	0.35	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883
BGC0000194.5	0.35	PKS	actinorhodin	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

Additional weak hits (5):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.13 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.59 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.56 out of 23.43

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.88 out of 33.73

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_LWKZ01000024.1 - Region 8 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1,053,292 - 1,104,206 nt. (total: 50,915 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

A6A06_RS27865: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

A6A06_RS27915: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

A6A06_RS27920: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS27935: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

A6A06_RS27940: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS27945: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

A6A06_RS27955: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: methyltransferase

A6A06_RS27910: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase synthase

A6A06_RS27875: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS27890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

A6A06_RS27970: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.75	PKS	esperamicin	Actinomadura verrucosospora
BGC0001261.3	0.61	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.57	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.56	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.54	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.31 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (12):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.20 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.71 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.36 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.60 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.74 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.71 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.04 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.49 out of 20.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.65 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.44 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 1053291 - 1104206:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 1053291 - 1099195:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 14, location 1062394 - 1104206:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS27875: mal

PKS_AT (622..849): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 99.7
Methylmalonyl-CoA: 55.6
Methoxymalonyl-CoA: 54.3
inactive: 45.5
Propionyl-CoA: 33.1
Ethylmalonyl-CoA: 30.1
Isobutyryl-CoA: 27.7
fatty_acid: 22.9
trans-1,2-CPDA: 15.0
2-Methylbutyryl-CoA: 5.3
Acetyl-CoA: 3.1
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
CHC-CoA: -1.4

A6A06_RS27890: X

AMP-binding (30..424): X

nrpys: ohMan

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSAFNVSTYEVHVLTGGDRAMYGATEATVFSTH
Nearest Stachelhaus code(s):: ohMan NVYHLGMVFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000025.1 - Region 1 - NRPS,T1PKS,phosphonate

Download region GenBank file

Download region SVG

Location: 164,944 - 242,151 nt. (total: 77,208 nt) Show pHMM detection rules used

phosphonate: (phosphonates and minimum(1, [2-Hacid_dh_C, Aldedh, Aminotran_1_2, Aminotran_5, AurF, CTP_transf_like, DUF4992, Fe-ADH, HMGL-like, Metallophos_2, NTP_transf_3, NTP_transf_5, PALP, PEP_mutase, TPP_enzyme_C, TPP_enzyme_N, phosphonates]) and not (phosphonatesHydrolase or phosphonatesMeIsocitrateLyase))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase synthase

A6A06_RS28920: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

A6A06_RS28940: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

A6A06_RS28960: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS29020: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

A6A06_RS29030: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS29040: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS29080: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

A6A06_RS29105: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS29115: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

A6A06_RS29165: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: PPTase acyltransferase aminotransferase

A6A06_RS28935: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

A6A06_RS28955: acyltransferase

smcogs: SMCOG1141: acyltransferase

A6A06_RS29060: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

A6A06_RS29095: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

A6A06_RS29110: aminotransferase

smcogs: SMCOG1019: aminotransferase

A6A06_RS43100: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase phosphatase synthase

A6A06_RS28920: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

A6A06_RS28975: thioesterase

smcogs: SMCOG1004: thioesterase

A6A06_RS29035: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: ligase synthase

A6A06_RS28990: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS29015: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS29065: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS29085: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS29090: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001039.5	0.85	NRPS, PKS	pyridomycin	Streptomyces pyridomyceticus
BGC0002135.2	0.81	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001039.5	0.70	NRPS, PKS	pyridomycin	Streptomyces pyridomyceticus
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.16 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.19 out of 23.79

Confidence: medium

Additional weak hits (11):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.23 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.57 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.27 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.46 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.21 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.09 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.52 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 164943 - 242151:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Thr - X) + (Me-mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 166453 - 242151:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Thr - X) + (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS28990: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (34..463): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: VSALFVFGHPGGALQVGGAQQVYGMSEGLLNFTR
Nearest Stachelhaus code(s):: Sal PLPAQGVLNK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

A6A06_RS29015: mal

PKS_AT (542..850): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 140.3
inactive: 95.4
Methoxymalonyl-CoA: 65.2
Methylmalonyl-CoA: 48.0
Ethylmalonyl-CoA: 29.4
Isobutyryl-CoA: 28.2
Propionyl-CoA: 27.7
fatty_acid: 19.4
Acetyl-CoA: 14.4
Benzoyl-CoA: 14.1
2-Methylbutyryl-CoA: 11.2
CHC-CoA: 11.0
3-Methylbutyryl-CoA: 8.4
trans-1,2-CPDA: 0.0

A6A06_RS29065: X

AMP-binding (33..441): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: QAALFTWGCPGGSCQIGSAQQVFGMAEGLLTFTR
Nearest Stachelhaus code(s):: Hpa TWPSQGVLCK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

A6A06_RS29085: Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (452..866): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LQTHFDFSVWEGNQVFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1526..1924): X

nrpys: pyrAla

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNQAFDAAFWDMTLVVAGEVNSYGPTEITVSCAI
Nearest Stachelhaus code(s):: pyrAla DAWTVASVSK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS29090: mal

PKS_AT (534..810): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.8
Methoxymalonyl-CoA: 50.3
inactive: 39.6
Methylmalonyl-CoA: 35.8
Propionyl-CoA: 25.6
Ethylmalonyl-CoA: 11.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

A6A06_RS29095: X - fatty_acid

AMP-binding (509..858): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RRLAQERAVWELIALCLAP--------VLRWVYA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CAL_domain (1065..1480): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 17.5
Acetyl-CoA: 13.2
NH2: 12.3
shikimic_acid: 0.0
AHBA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000025.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 297,972 - 321,407 nt. (total: 23,436 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

A6A06_RS29530: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

A6A06_RS29545: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000502.5	0.37	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0001173.5	0.36	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000569.5	0.36	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001391.3	0.36	ribosomal	thusin	Bacillus thuringiensis serovar rongseni
BGC0000594.5	0.35	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8
BGC0001227.3	0.35	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001170.5	0.34	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.5	0.34	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000502.5	0.37	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0001173.5	0.36	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000569.5	0.36	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001391.3	0.36	ribosomal	thusin	Bacillus thuringiensis serovar rongseni
BGC0000594.5	0.35	ribosomal	microviridin K	Planktothrix agardhii NIVA-CYA 126/8
BGC0001227.3	0.35	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001170.5	0.34	ribosomal	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.5	0.34	ribosomal	clostridiolysin S	Clostridium botulinum A str. ATCC 3502

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

A6A06_RS29545: PT_FPPS_like

Domain 1 (87 - 376): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

A6A06_RS29550: T2TS

Domain 1 (31 - 657): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (7):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.17 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
MexT	Global virulence regulator
OsdR	Development and stress management regulator
ToxT	Regulator of MSHA biosynthesis

NZ_LWKZ01000026.1 - Region 1 - NRPS-like,PKS-like

Download region GenBank file

Download region SVG

Location: 1 - 68,665 nt. (total: 68,665 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS31870: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

A6A06_RS31965: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

A6A06_RS32105: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: amidase dehalogenase hydrolase

A6A06_RS31935: amidase

smcogs: SMCOG1105: amidase

A6A06_RS32075: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

A6A06_RS32095: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

A6A06_RS32040: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.28	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.27	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002174.2	0.27	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001641.4	0.27	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.27	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.27	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.27	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001128.4	0.27	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.27	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.26	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002174.2	0.61	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.11 out of 25.31

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (13):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.97 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.68 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.50 out of 20.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.11 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.14 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.89 out of 30.22

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.92 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.49 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.68 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 30.98

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.37 out of 32.38

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 68665:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 25566 - 68665:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS32040: X

AMP-binding (31..431): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNTTFDISCLEAWLIAGGDINGYGPTEASSLVTA
Nearest Stachelhaus code(s):: Val DALWIGGTFK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CatR	H2O2-responsive repressor
MexT	Global virulence regulator

NZ_LWKZ01000026.1 - Region 2 - NRPS,NRPS-like,T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 118,036 - 239,487 nt. (total: 121,452 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS32420: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS32635: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS32645: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS32650: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

A6A06_RS32680: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS32730: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase

A6A06_RS32415: methyltransferase

smcogs: SMCOG1089: methyltransferase

A6A06_RS32595: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: glucosidase hydrolase

A6A06_RS32530: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

A6A06_RS32555: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

A6A06_RS32585: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase

A6A06_RS32410: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase synthetase

A6A06_RS32425: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

A6A06_RS32430: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

A6A06_RS32475: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS32480: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A6A06_RS32485: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS32570: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS32625: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS32630: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS32640: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.93	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001273.3	0.87	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.87	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.87	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.78	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002099.3	0.71	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002084.4	0.70	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0001050.5	0.68	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.76	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001050.5	0.71	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

A6A06_RS32410: T1TS + T1TS

Domain 1 (98 - 401): Type 1 terpene synthase

Subtype: unknown

Domain 2 (447 - 787): Type 1 terpene synthase

Subtype: unknown

A6A06_RS32425: PT_FPPS_like

Domain 1 (63 - 376): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.98 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.14 out of 23.79

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (33):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.79 out of 30.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.06 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.50 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.09 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.05 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.24 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.00 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.74 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.82 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.93 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.62 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.00 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.13 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.16 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.43 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.59 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.96 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.22 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.31 out of 36.54

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.34 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.18 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.32 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.64 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.85 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.70 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.26 out of 26.06

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.82 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 118035 - 239487:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - ohmal) + (ccmal) + (X) + (Hpg - Hpg - D-Hpg) + (Hpg - D-Hpg) + (Hpg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 122765 - 185695:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpg) + (Hpg - D-Hpg) + (Hpg - Hpg - D-Hpg) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 165657 - 209230:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (X) + (Hpg - Hpg - D-Hpg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 179149 - 239487:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - ohmal) + (ccmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS32475: Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (463..841): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDTAFDASTLEVHLLTGGDGHLYGPTETTLCATT
Nearest Stachelhaus code(s):: Hpg DALHLGLLCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS32480: Hpg - Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (464..842): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSAFDASTFEVHVLTGGDRHLYGPTETTLCATT
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1491..1868): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDAAFDASAFEVHVLTGGDHHLYGPTETTLCATT
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS32485: Hpg - Hpg - Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (472..852): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDTAFDASTFEVHVLTGGDHHLYGPTEITLCATT
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1507..1880): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSAFDASTFEVHLLTGGDRHLYGPTETTLCATT
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2535..2913): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LAPAFDASTLEVHVLTGGDHHLYGPTETTLCATT
Nearest Stachelhaus code(s):: Hpg DALHLGLLCK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

A6A06_RS32570: X

AMP-binding (88..526): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGFMHMMGRGVGIMWTVSALDGYGSTEAGIVSLD
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

A6A06_RS32630: mal

PKS_AT (569..860): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 195.4
inactive: 87.8
Methoxymalonyl-CoA: 52.5
Methylmalonyl-CoA: 51.6
Propionyl-CoA: 28.8
Isobutyryl-CoA: 23.6
Ethylmalonyl-CoA: 22.1
Benzoyl-CoA: 17.9
Acetyl-CoA: 17.1
2-Methylbutyryl-CoA: 15.1
CHC-CoA: 14.1
fatty_acid: 11.3
trans-1,2-CPDA: 6.7
3-Methylbutyryl-CoA: 0.0

A6A06_RS32640: pk - mal

PKS_AT (567..864): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 208.0
Methylmalonyl-CoA: 205.9
2-Methylbutyryl-CoA: 171.9
Methoxymalonyl-CoA: 169.8
Propionyl-CoA: 128.6
trans-1,2-CPDA: 124.5
Malonyl-CoA: 110.9
CHC-CoA: 110.1
Isobutyryl-CoA: 65.5
Benzoyl-CoA: 55.4
Acetyl-CoA: 43.4
fatty_acid: 39.5
3-Methylbutyryl-CoA: 27.0
inactive: 25.4

PKS_AT (2228..2511): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 170.9
Methoxymalonyl-CoA: 87.7
Methylmalonyl-CoA: 80.4
inactive: 52.9
Propionyl-CoA: 49.3
Ethylmalonyl-CoA: 43.7
Isobutyryl-CoA: 33.8
fatty_acid: 30.1
2-Methylbutyryl-CoA: 25.3
CHC-CoA: 16.0
Acetyl-CoA: 12.4
trans-1,2-CPDA: 11.1
Benzoyl-CoA: 7.5
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000026.1 - Region 3 - nucleoside

Download region GenBank file

Download region SVG

Location: 258,066 - 279,031 nt. (total: 20,966 nt) Show pHMM detection rules used

nucleoside: (LipM or LipV or LipU or TunD or pur6 or pur10 or nikJ or nikO or truD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

A6A06_RS32815: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS32840: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

A6A06_RS32845: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: glycosyltransferase

A6A06_RS32830: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

A6A06_RS32865: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Lyases: dehydratase

A6A06_RS32835: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

A6A06_RS32850: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

A6A06_RS32875: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: mutase

A6A06_RS32880: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000880.4	0.81	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0000786.3	0.48	saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000888.5	0.46	other (other)	bacilysin	Bacillus sp. CS93
BGC0001927.4	0.45	other (other)	A-94964	Streptomyces sp.
BGC0000231.5	0.45	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000707.5	0.45	saccharide	kasugamycin	Streptomyces kasugaensis
BGC0000777.3	0.45	saccharide	lipopolysaccharide	Escherichia coli
BGC0000790.3	0.45	saccharide	O-antigen	Escherichia coli
BGC0000916.5	0.45	other (other)	molybdenum cofactor	Staphylococcus carnosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000880.4	0.81	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0000786.3	0.48	saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000888.5	0.46	other (other)	bacilysin	Bacillus sp. CS93
BGC0001927.4	0.45	other (other)	A-94964	Streptomyces sp.
BGC0000231.5	0.45	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000707.5	0.45	saccharide	kasugamycin	Streptomyces kasugaensis
BGC0000777.3	0.45	saccharide	lipopolysaccharide	Escherichia coli
BGC0000790.3	0.45	saccharide	O-antigen	Escherichia coli
BGC0000916.5	0.45	other (other)	molybdenum cofactor	Staphylococcus carnosus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.46 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.70 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000026.1 - Region 4 - NRPS

Download region GenBank file

Download region SVG

Location: 293,287 - 358,492 nt. (total: 65,206 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS33035: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS33075: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS33135: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

A6A06_RS33140: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: dehalogenase

A6A06_RS32990: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase

A6A06_RS33085: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001240.4	0.67	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001240.4	0.67	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.71 out of 26.33

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (15):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.75 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.44 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.61 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.68 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.79 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.11 out of 32.93

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.18 out of 29.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.76 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.36 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.15 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.57 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.45 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 10, location 293286 - 358492:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Thr - Ser - Tyr - D-NMe-Trp - Gly - NMe-Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS33085: Thr - Ser - Tyr - Trp - Gly - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (463..878): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGSQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2034..2436): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVTSGEYNLYGPTETTIDVTA
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3099..3495): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVSETTLVVAGEINAYGPTEFTVCATM
Nearest Stachelhaus code(s):: Tyr DASTVAAVCK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4155..4526): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHVFDVSFSETMLVVGGDINAYGPTEFTVCATM
Nearest Stachelhaus code(s):: Trp DVAMVGAVCK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (6096..6497): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAALELQALVGGETNLYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (7157..7529): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASFWEMTLVVAGEFNAYGPTETTVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000026.1 - Region 5 - NAPAA,NRPS-like

Download region GenBank file

Download region SVG

Location: 371,860 - 450,754 nt. (total: 78,895 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

A6A06_RS33225: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

A6A06_RS33290: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS33430: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

A6A06_RS33470: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

A6A06_RS33480: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

A6A06_RS33490: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: acetyltransferase methyltransferase

A6A06_RS33270: methyltransferase

smcogs: SMCOG1089: methyltransferase

A6A06_RS33280: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: deaminase glucosidase hydrolase

A6A06_RS33265: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

A6A06_RS33340: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

A6A06_RS33365: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

A6A06_RS33425: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: dehydratase

A6A06_RS43280: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

A6A06_RS33260: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A6A06_RS33275: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

A6A06_RS33415: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

A6A06_RS33420: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A6A06_RS33435: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

A6A06_RS33350: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.59	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.57	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.57	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002174.2	0.57	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001261.3	0.56	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.56	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.55	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002174.2	0.64	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002285.2	0.63	ribosomal	aborycin	Streptomyces sp. ZS0098

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.06 out of 23.43

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.31 out of 18.57

Confidence: medium

Additional weak hits (24):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.59 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.14 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.02 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.34 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.45 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.67 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.49 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.56 out of 30.22

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.70 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.66 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.20 out of 26.12

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.99 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.93 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.42 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.61 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.06 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.96 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.82 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.55 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.15 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.64 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 371859 - 450754:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 12, location 371859 - 415147:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 414903 - 450754:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A6A06_RS33260: X

AMP-binding (28..423): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -DMTHVAGIADAWLTYGGCFGGYGQSEAGHITVI
Nearest Stachelhaus code(s):: Val DAAWWGGTFK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

A6A06_RS43280: X

AMP-binding (33..436): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSAYSDASTIETFLSAGGEVNFYGPTENSVVSSA
Nearest Stachelhaus code(s):: Leu DAWFLGHVVK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

A6A06_RS33435: X

AMP-binding (255..661): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAQVSATGEVNAYGLTETSDDTNH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (91% 8Å match); dnmeProp or Dab DIWQSTADDK (82% 8Å match); Asp DIWQSTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
BldD	Development and antibiotic global regulator
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

NZ_LWKZ01000026.1 - Region 6 - arylpolyene,terpene

Download region GenBank file

Download region SVG

Location: 565,828 - 622,128 nt. (total: 56,301 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A6A06_RS34040: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

A6A06_RS34085: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A6A06_RS34145: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS34150: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A6A06_RS34160: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

A6A06_RS34175: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A6A06_RS34185: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: kinase methyltransferase

A6A06_RS34050: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

A6A06_RS34055: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

A6A06_RS34195: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: dehalogenase

A6A06_RS34200: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase

A6A06_RS34190: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: mutase

A6A06_RS34045: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

A6A06_RS34080: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A6A06_RS34090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.45	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.45	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001364.3	0.27	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001778.5	0.26	other (other)	showdomycin	Streptomyces showdoensis
BGC0001610.5	0.24	other (other)	gougerotin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0002194.3	0.24	PKS	epipyrone A	Epicoccum nigrum
BGC0000194.5	0.24	PKS	actinorhodin	Streptomyces coelicolor A3(2)
BGC0001137.5	0.24	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0001858.2	0.23	PKS	alternapyrone B, alternapyrone C, alternapyrone D, alternapyrone E, alternapyrone F	Parastagonospora nodorum SN15
BGC0001166.5	0.23	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.55	NRPS	AM-toxin	Alternaria alternata
BGC0002260.3	0.50	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001336.5	0.47	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001965.4	0.46	other (other)	nybomycin	Streptomyces albus subsp. chlorinus
BGC0002493.3	0.46	NRPS	parabactin	Paracoccus denitrificans PD1222

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

A6A06_RS34190: T1TS

Domain 1 (5 - 311): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

Additional weak hits (17):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.25 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.68 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.61 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.91 out of 29.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.67 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.11 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.91 out of 18.57

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.09 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.41 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.45 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.84 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.25 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.53 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.55 out of 30.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.66 out of 30.98

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.96 out of 27.18

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

A6A06_RS34090: X

AMP-binding (11..434): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AVLAHAAALMQPFGVCGGARQGYGMTEAAPGVLL
Nearest Stachelhaus code(s):: Val DAMFVGGVFK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor

NZ_LWKZ01000027.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 58,024 - 79,208 nt. (total: 21,185 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

A6A06_RS35105: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase

A6A06_RS35100: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001475.4	0.49	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001679.3	0.39	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4
BGC0002651.2	0.38	terpene	sordaricin B	Rosellinia necatrix
BGC0001375.4	0.38	terpene	penitrem A, penitrem B, penitrem C, penitrem D, penitrem E, penitrem F	Penicillium simplicissimum
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001475.4	0.49	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.40	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001679.3	0.39	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4
BGC0002651.2	0.38	terpene	sordaricin B	Rosellinia necatrix
BGC0001375.4	0.38	terpene	penitrem A, penitrem B, penitrem C, penitrem D, penitrem E, penitrem F	Penicillium simplicissimum
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

A6A06_RS35100: T1TS

Domain 1 (17 - 349): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.96 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.18 out of 23.79

Confidence: medium

Additional weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.67 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.13 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000027.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 215,083 - 225,592 nt. (total: 10,510 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

A6A06_RS35820: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002657.2	0.32	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0001782.3	0.28	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001927.4	0.25	other (other)	A-94964	Streptomyces sp.
BGC0002129.4	0.20	PKS	metathramycin, premetathramycin	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002657.2	0.32	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0001782.3	0.28	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001927.4	0.25	other (other)	A-94964	Streptomyces sp.
BGC0002129.4	0.20	PKS	metathramycin, premetathramycin	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (7):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.26 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.01 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.07 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.70 out of 29.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.72 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_LWKZ01000027.1 - Region 3 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 597,755 - 629,626 nt. (total: 31,872 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A6A06_RS37665: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

A6A06_RS37610: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: decarboxylase lyase

A6A06_RS37620: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

A6A06_RS37635: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.61	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000947.5	0.49	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000885.3	0.48	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001880.3	0.45	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0000671.3	0.41	terpene	momilactone B	Oryza sativa Japonica Group

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.61	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000946.5	0.59	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000947.5	0.49	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000885.3	0.48	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001880.3	0.45	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0000671.3	0.41	terpene	momilactone B	Oryza sativa Japonica Group

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.11 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.55 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.70 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 36.53

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.23 out of 26.06

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.02 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.13 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.91 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000027.1 - Region 4 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 703,191 - 721,891 nt. (total: 18,701 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

A6A06_RS38060: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Lyases: decarboxylase

A6A06_RS38055: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.85	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.80	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000941.3	0.79	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.5	0.72	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.66	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.54	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002690.2	0.54	other (other)	FW0622	Verrucosispora sp. FIM060022

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.85	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.80	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000941.3	0.79	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.5	0.72	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.66	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0001531.5	0.54	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002690.2	0.54	other (other)	FW0622	Verrucosispora sp. FIM060022

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.62 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.03 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.17 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.21 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.34 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.88 out of 30.97

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_LWKZ01000028.1 - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 294,149 - 305,438 nt. (total: 11,290 nt) Show pHMM detection rules used

Region on contig edge.

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

A6A06_RS39405: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000849.4	0.59	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.29	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0000019.5	0.28	PKS	angolamycin	Streptomyces eurythermus
BGC0000112.5	0.27	PKS	neocarzinostatin	Streptomyces carzinostaticus subsp. neocarzinostaticus
BGC0002642.2	0.26	other (other)	clipibycyclene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000262.5	0.26	PKS, saccharide	prejadomycin, rabelomycin, gaudimycin C, gaudimycin D, UWM6, gaudimycin A	Streptomyces sp. PGA64
BGC0001083.5	0.25	PKS, terpene	merochlorin A, merochlorin B, deschloro-merochlorin A, deschloro-merochlorin B, isochloro-merochlorin B, dichloro-merochlorin B, merochlorin D, merochlorin C	Streptomyces sp. CNH189
BGC0002078.2	0.25	NRPS	omnipeptin	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000849.4	0.59	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.29	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0000019.5	0.28	PKS	angolamycin	Streptomyces eurythermus
BGC0000112.5	0.27	PKS	neocarzinostatin	Streptomyces carzinostaticus subsp. neocarzinostaticus
BGC0002642.2	0.26	other (other)	clipibycyclene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000262.5	0.26	PKS, saccharide	prejadomycin, rabelomycin, gaudimycin C, gaudimycin D, UWM6, gaudimycin A	Streptomyces sp. PGA64
BGC0001083.5	0.25	PKS, terpene	merochlorin A, merochlorin B, deschloro-merochlorin A, deschloro-merochlorin B, isochloro-merochlorin B, dichloro-merochlorin B, merochlorin D, merochlorin C	Streptomyces sp. CNH189
BGC0002078.2	0.25	NRPS	omnipeptin	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.15 out of 27.04

Confidence: medium

Additional weak hits (12):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.42 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.36 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.63 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.94 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.14 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.02 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.26 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor