GCF_001672455.2 - 14 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP021070.1 (Mesorhizobium sp. WSM1497)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RRE-containing	222,318	242,605
Region 1.2	lassopeptide	247,961	270,741
Region 1.3	RRE-containing	428,667	449,098
Region 1.4	terpene-precursor	1,426,933	1,447,850
Region 1.5	hserlactone	2,828,745	2,849,335
Region 1.6	RiPP-like	2,957,513	2,968,910
Region 1.7	NAPAA	3,183,989	3,218,101
Region 1.8	terpene	3,883,342	3,904,184
Region 1.9	redox-cofactor	4,854,598	4,876,767
Region 1.10	hserlactone	6,164,497	6,185,132	Low	succinoglycan	saccharide
Region 1.11	terpene	6,279,024	6,301,870	High	gibberellin	terpene
Region 1.12	NRPS-like,T1PKS	6,328,783	6,374,200
Region 1.13	hserlactone	6,602,843	6,623,481

NZ_CP021071.1 (Mesorhizobium sp. WSM1497)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	thioamitides	268,409	290,291

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RRE-containing	222,318	242,605
Region 1.2	lassopeptide	247,961	270,741
Region 1.3	RRE-containing	428,667	449,098
Region 1.4	terpene-precursor	1,426,933	1,447,850
Region 1.5	hserlactone	2,828,745	2,849,335
Region 1.6	RiPP-like	2,957,513	2,968,910
Region 1.7	NAPAA	3,183,989	3,218,101
Region 1.8	terpene	3,883,342	3,904,184
Region 1.9	redox-cofactor	4,854,598	4,876,767
Region 1.10	hserlactone	6,164,497	6,185,132	Low	succinoglycan	saccharide
Region 1.11	terpene	6,279,024	6,301,870	High	gibberellin	terpene
Region 1.12	NRPS-like,T1PKS	6,328,783	6,374,200
Region 1.13	hserlactone	6,602,843	6,623,481
Region 2.1	thioamitides	268,409	290,291

Compact view

NZ_CP021070.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 222,318 - 242,605 nt. (total: 20,288 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: transferase

A9K65_RS01135: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: ligase

A9K65_RS01115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000749.3	0.55	saccharide	capsular polysaccharide	Escherichia coli
BGC0001549.3	0.44	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0002825.2	0.42	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0000592.5	0.40	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0000728.5	0.40	saccharide	capsular polysaccharide	Klebsiella pneumoniae subsp. ozaenae
BGC0000729.3	0.40	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0002049.3	0.40	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0002064.2	0.39	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000749.3	0.55	saccharide	capsular polysaccharide	Escherichia coli
BGC0001549.3	0.44	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0002825.2	0.42	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0000592.5	0.40	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0000728.5	0.40	saccharide	capsular polysaccharide	Klebsiella pneumoniae subsp. ozaenae
BGC0000729.3	0.40	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0002049.3	0.40	ribosomal	microviridin N9, microviridin N8, microviridin N7, microviridin N6, microviridin N5, microviridin N4, microviridin N3	Nostoc punctiforme PCC 73102
BGC0002064.2	0.39	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

Additional weak hits (1):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.60 out of 29.65

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 7 - 91; Score: 47.5; RRE type: PqqD_RRE; Location: 25 - 90; Score: 29.4

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_CP021070.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 247,961 - 270,741 nt. (total: 22,781 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A9K65_RS01185: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

A9K65_RS01260: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

A9K65_RS01170: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

A9K65_RS01245: sugar transferase

smcogs: SMCOG1146: sugar transferase

Hydrolases: hydrolase

A9K65_RS01225: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001548.4	0.51	ribosomal	citrulassin A	Streptomyces albulus
BGC0001356.4	0.50	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0000572.5	0.48	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0000800.5	0.48	saccharide	xanthan	Xanthomonas campestris
BGC0000868.5	0.48	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000740.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001548.4	0.51	ribosomal	citrulassin A	Streptomyces albulus
BGC0001356.4	0.50	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0000572.5	0.48	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0000800.5	0.48	saccharide	xanthan	Xanthomonas campestris
BGC0000868.5	0.48	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000740.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for A9K65_RS01210

A9K65_RS01210

Leader:

MEQNVEKHEYETPSLTVHGSIETITQ

Full core:

GGGGSTAIDASFPAHTPIGDLTFS

Putative macrolactam:

GGGGSTAID

antiSMASH-DB 4.0 matches for A9K65_RS01210

100.0%

NC_002678.2and 27 others:

NC_014923.1 Lassopeptides: MESCI_RS01205_lassopeptideNC_019973.1 Lassopeptides: MESAU_RS01210_lassopeptideNZ_AP023242.1 Lassopeptides: JN279_RS01270_lassopeptideNZ_AP023243.1 Lassopeptides: JG746_RS01220_lassopeptideNZ_AP023246.1 Lassopeptides: MesoLj_RS01255_lassopeptideNZ_AP023254.1 Lassopeptides: JG747_RS01230_lassopeptideNZ_AXAE01000013.1 Lassopeptides: A3AU_RS1000000137730_lassopeptideNZ_AXAL01000027.1 Lassopeptides: A3A9_RS43075_lassopeptideNZ_CP015062.1 Lassopeptides: A4R28_RS34150_lassopeptideNZ_CP015064.1 Lassopeptides: A4R29_RS32555_lassopeptideNZ_CP021070.1 Lassopeptides: A9K65_RS01210_lassopeptideNZ_CP033361.1 Lassopeptides: EB233_RS01335_lassopeptideNZ_CP033365.1 Lassopeptides: EB231_RS01220_lassopeptideNZ_CP033507.1 Lassopeptides: EB229_RS01240_lassopeptideNZ_CP034453.1 Lassopeptides: EJ076_RS07385_lassopeptideNZ_CP050296.1 Lassopeptides: HB778_RS17925_lassopeptideNZ_CP080525.1 Lassopeptides: BPNPMPFG_RS25760_lassopeptideNZ_CP088147.1 Lassopeptides: LRP29_RS01210_lassopeptideNZ_CP097252.1 Lassopeptides: M5D98_RS01245_lassopeptideNZ_JALJRL010000001.1 Lassopeptides: NR193_RS01610_lassopeptideNZ_KB913026.1 Lassopeptides: MESLO3_RS1000000141745_lassopeptideNZ_KI632510.1 Lassopeptides: MESLO_RS32475_lassopeptideNZ_KI911320.1 Lassopeptides: M729_RS1000000138215_lassopeptideNZ_KI912159.1 Lassopeptides: MESLO2_RS1000000139130_lassopeptideNZ_KI912610.1 Lassopeptides: MESCI2_RS1000000137645_lassopeptideNZ_QGGH01000004.1 Lassopeptides: C8D77_RS17730_lassopeptideNZ_RZRU01000003.1 Lassopeptides: EOA16_RS05930_lassopeptide

Lassopeptides: MAFF_RS37875_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTAIDASFPAHTPIGDLTFS

1

GGGGSTAIDASFPAHTPIGDLTFS

24

95.8%

NC_015675.1and 4 others:

NZ_CP034779.1 Lassopeptides: EJ079_RS03975_lassopeptideNZ_JANIFC010000015.1 Lassopeptides: NP503_RS29205_lassopeptideNZ_LMCP01000023.1 Lassopeptides: ASD12_RS33300_lassopeptideNZ_LMHO01000001.1 Lassopeptides: ASD99_RS31725_lassopeptide

Lassopeptides: MESOP_RS33200_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TAIDASFPAHTPIGDLTFS

1

GGGGNTAIDASFPAHTPIGDLTFS

24

95.8%

NZ_CP033334.1and 4 others:

NZ_CP033364.1 Lassopeptides: EB230_RS01250_lassopeptideNZ_CP034454.1 Lassopeptides: EJ077_RS27505_lassopeptideNZ_CP083952.1 Lassopeptides: FJ970_RS01240_lassopeptideNZ_LMHP01000012.1 Lassopeptides: ASE05_RS13255_lassopeptide

Lassopeptides: EB815_RS01225_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTA DASFPAHTPIGDLTFS

1

GGGGSTATDASFPAHTPIGDLTFS

24

with 87 more sequence matches

Only the first 10 are displayed here.

95.8%

NZ_JACHEF010000002.1:

Lassopeptides: HNQ71_RS14800_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTAID SFPAHTPIGDLTFS

1

GGGGSTAIDVSFPAHTPIGDLTFS

24

91.7%

NZ_CP015318.1:

Lassopeptides: A6B35_RS34290_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTA+DASFPAHTPIG+LTFS

1

GGGGSTALDASFPAHTPIGELTFS

24

91.7%

NZ_ML703270.1:

Lassopeptides: C7I87_RS19195_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TA+DASFPAHTPIGDLTFS

1

GGGGNTALDASFPAHTPIGDLTFS

24

87.5%

NZ_CP080524.1:

Lassopeptides: LHFGNBLO_RS06050_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTA+DA+FPAHTPIG+LTFS

1

GGGGSTALDAAFPAHTPIGELTFS

24

87.5%

NZ_CP083950.1:

Lassopeptides: FJW03_RS26870_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TA D SFPAHTPIGDLTFS

1

GGGGNTATDVSFPAHTPIGDLTFS

24

87.5%

NZ_CP083954.1:

Lassopeptides: FJ972_RS01095_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TA+DA+FPAHTPIGDLTFS

1

GGGGNTALDAAFPAHTPIGDLTFS

24

87.5%

NZ_CP085135.1:

Lassopeptides: LGH82_RS15665_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TAIDASFPAHTPI LTFS

1

GGGGNTAIDASFPAHTPISQLTFS

24

83.3%

NZ_CP083951.1:

Lassopeptides: FJ430_RS01235_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GG G+TA+DASFPAHTPIG+LTFS

1

GGAGTTALDASFPAHTPIGELTFS

24

79.2%

NZ_AP024109.1and 2 others:

NZ_CP083956.1 Lassopeptides: FJ974_RS01165_lassopeptideNZ_FOVT01000001.1 Lassopeptides: F3H96_RS01735_lassopeptide

Lassopeptides: MJ8_RS02965_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GG G+TA+DASFPAHTP+G+LTFS

1

GGAGTTALDASFPAHTPVGELTFS

24

79.2%

NZ_ATYO01000004.1:

Lassopeptides: YU3_RS40500_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GG G TA+DASFPAHTP+G+LTFS

1

GGAGVTALDASFPAHTPVGELTFS

24

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.63 out of 28.19

Confidence: medium

Additional weak hits (15):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.17 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.86 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.00 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.71 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.58 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.54 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.86 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.70 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.87 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.20 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.72 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.81 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.06 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.71 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.49 out of 32.74

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

A9K65_RS01210 - Class II: Cleavage pHMM score: -0.30; RODEO score: 25; Monoisotopic mass: 2257.1 Da; Molecular weight: 2258.4 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 14 - 98; Score: 101.5

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP021070.1 - Region 3 - RRE-containing

Download region GenBank file

Download region SVG

Location: 428,667 - 449,098 nt. (total: 20,432 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucosidase hydrolase

A9K65_RS01975: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

A9K65_RS02055: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000737.3	0.47	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000741.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0002285.2	0.46	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000740.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000748.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000789.3	0.43	saccharide	O-antigen	Escherichia coli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000737.3	0.47	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000741.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0002285.2	0.46	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000740.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000748.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000789.3	0.43	saccharide	O-antigen	Escherichia coli

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.38 out of 20.97

Confidence: medium

Additional weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.37 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.38 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.55 out of 35.63

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 10 - 79; Score: 39.5

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_CP021070.1 - Region 4 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1,426,933 - 1,447,850 nt. (total: 20,918 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A9K65_RS07085: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase sulfotransferase

A9K65_RS07020: methyltransferase

smcogs: SMCOG1089: methyltransferase

A9K65_RS07065: glutathione S-transferase

smcogs: SMCOG1193: glutathione S-transferase

Hydrolases: hydrolase

A9K65_RS07060: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthetase

A9K65_RS07025: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001616.3	0.50	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002496.3	0.42	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001605.3	0.41	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002227.3	0.40	NRPS	AKML B, AKML D, AKML A, AKML C	Aspergillus luchuensis IFO 4308
BGC0000665.5	0.40	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001616.3	0.50	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002496.3	0.42	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001605.3	0.41	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002227.3	0.40	NRPS	AKML B, AKML D, AKML A, AKML C	Aspergillus luchuensis IFO 4308
BGC0000665.5	0.40	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

A9K65_RS07025: PT_FPPS_like

Domain 1 (43 - 304): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

Binding sites found:

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 26.12 out of 26.12

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.91 out of 26.33

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (9):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.60 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.44 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.49 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.15 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.80 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.06 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.49 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.54 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
LuxO	Repressor of luminescence
RpoN	Regulator of nitrogen assimilation and virulence

NZ_CP021070.1 - Region 5 - hserlactone

Download region GenBank file

Download region SVG

Location: 2,828,745 - 2,849,335 nt. (total: 20,591 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucosidase

A9K65_RS13725: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

A9K65_RS13730: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Translocases: transporter

A9K65_RS13710: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.48	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001553.5	0.39	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0000497.3	0.37	ribosomal	BHT-Aα, BHT-Aβ	Streptococcus ratti
BGC0000552.3	0.37	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0002425.3	0.36	ribosomal	stlassin	Streptomyces sp.
BGC0000595.3	0.36	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002710.2	0.35	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23
BGC0001510.5	0.34	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0002754.2	0.33	NRPS	hectoramide B	Moorena producens JHB

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.48	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001553.5	0.39	NRPS, PKS	clifednamide A	Streptomyces sp. JV178
BGC0000497.3	0.37	ribosomal	BHT-Aα, BHT-Aβ	Streptococcus ratti
BGC0000552.3	0.37	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0002425.3	0.36	ribosomal	stlassin	Streptomyces sp.
BGC0000595.3	0.36	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002710.2	0.35	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23
BGC0001510.5	0.34	other (other)	anisomycin	Streptomyces hygrospinosus
BGC0002754.2	0.33	NRPS	hectoramide B	Moorena producens JHB

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.79 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.45 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CP021070.1 - Region 6 - RiPP-like

Download region GenBank file

Download region SVG

Location: 2,957,513 - 2,968,910 nt. (total: 11,398 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

A9K65_RS14250: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001485.4	0.37	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000188.5	0.31	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0002007.2	0.31	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001206.5	0.30	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002554.2	0.30	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0000632.5	0.30	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000925.5	0.29	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0001896.4	0.29	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001903.3	0.29	other (other)	neocarazostatin A	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001485.4	0.37	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000188.5	0.31	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0002007.2	0.31	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001206.5	0.30	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002554.2	0.30	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0000632.5	0.30	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000925.5	0.29	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0001896.4	0.29	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001903.3	0.29	other (other)	neocarazostatin A	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.72 out of 26.85

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP021070.1 - Region 7 - NAPAA

Download region GenBank file

Download region SVG

Location: 3,183,989 - 3,218,101 nt. (total: 34,113 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A9K65_RS15460: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase

A9K65_RS15500: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase

A9K65_RS15485: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

A9K65_RS15510: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.73	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.73	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.92 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.40 out of 20.97

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.59 out of 30.22

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.23 out of 27.78

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.83 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.48 out of 24.78

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

Additional weak hits (14):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.23 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.00 out of 27.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.79 out of 25.88

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.66 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.83 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.39 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.93 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.03 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.81 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.26 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.13 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 3183988 - 3218101:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A9K65_RS15510: X

AMP-binding (62..458): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FVAMFDFSSEEVACLVGGELNTYGPTEATVTATM
Nearest Stachelhaus code(s):: OH-Orn DGEAVGGVTK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ClgR	Caseinolytic protease gene regulator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
HypR	L-hydroxyproline utilization repressor
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_CP021070.1 - Region 8 - terpene

Download region GenBank file

Download region SVG

Location: 3,883,342 - 3,904,184 nt. (total: 20,843 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

A9K65_RS18870: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002439.3	0.32	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000698.5	0.25	saccharide	hygromycin A	Streptomyces hygroscopicus
BGC0000700.5	0.25	saccharide	istamycin	Streptomyces tenjimariensis
BGC0000001.5	0.22	PKS	abyssomicin C, atrop-abyssomicin C	Verrucosispora maris AB-18-032
BGC0000014.5	0.19	PKS	ambruticin	Sorangium cellulosum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002439.3	0.32	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000698.5	0.25	saccharide	hygromycin A	Streptomyces hygroscopicus
BGC0000700.5	0.25	saccharide	istamycin	Streptomyces tenjimariensis
BGC0000001.5	0.22	PKS	abyssomicin C, atrop-abyssomicin C	Verrucosispora maris AB-18-032
BGC0000014.5	0.19	PKS	ambruticin	Sorangium cellulosum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

A9K65_RS18900: PT_phytoene_like

Domain 1 (20 - 272): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.92 out of 27.78

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.19 out of 21.55

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.98 out of 20.97

Confidence: medium

Additional weak hits (13):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.57 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.11 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.23 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.51 out of 26.06

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.71 out of 30.11

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.56 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.93 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.60 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.96 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.90 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.30 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.47 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria

NZ_CP021070.1 - Region 9 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 4,854,598 - 4,876,767 nt. (total: 22,170 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

A9K65_RS23895: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000582.4	0.37	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000398.5	0.35	NRPS	orfamide B	Pseudomonas sp. CMR12a
BGC0001100.5	0.35	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000399.5	0.32	NRPS	orfamide A, orfamide C	Pseudomonas protegens Pf-5
BGC0000526.5	0.28	ribosomal	macedocin	Streptococcus macedonicus
BGC0001763.5	0.27	NRPS, PKS	rufomycin	Streptomyces atratus
BGC0002470.2	0.27	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001715.4	0.27	NRPS	octapeptin C4	Bacillus circulans
BGC0001620.5	0.27	NRPS, PKS	ilamycin B1, ilamycin B2, ilamycin C1, ilamycin C2, ilamycin D, ilamycin E1	Streptomyces atratus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000582.4	0.37	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000398.5	0.35	NRPS	orfamide B	Pseudomonas sp. CMR12a
BGC0001100.5	0.35	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000399.5	0.32	NRPS	orfamide A, orfamide C	Pseudomonas protegens Pf-5
BGC0000526.5	0.28	ribosomal	macedocin	Streptococcus macedonicus
BGC0001763.5	0.27	NRPS, PKS	rufomycin	Streptomyces atratus
BGC0002470.2	0.27	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001715.4	0.27	NRPS	octapeptin C4	Bacillus circulans
BGC0001620.5	0.27	NRPS, PKS	ilamycin B1, ilamycin B2, ilamycin C1, ilamycin C2, ilamycin D, ilamycin E1	Streptomyces atratus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

Additional weak hits (14):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.47 out of 30.25

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.65 out of 29.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.42 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.44 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.50 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.06 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.71 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.72 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.50 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 7 - 96; Score: 85.5; RRE type: Thurincin_rSAM_RRE; Location: 34 - 90; Score: 27.2; RRE type: Stand_Alone_Lasso_RRE; Location: 43 - 96; Score: 25.5

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_CP021070.1 - Region 10 - hserlactone

Download region GenBank file

Download region SVG

Location: 6,164,497 - 6,185,132 nt. (total: 20,636 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

A9K65_RS30290: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001238.3	0.58	other (other)	biotin	Aspergillus nidulans
BGC0001239.3	0.55	other (other)	biotin	Aspergillus nidulans
BGC0000802.5	0.55	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0001217.5	0.52	other (other)	PreQ0 Base	Streptomyces qinglanensis
BGC0002354.4	0.48	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0001937.4	0.46	other (other)	tubercidin	Streptomyces tubercidicus
BGC0000762.3	0.45	saccharide	exopolysaccharide	Rhizobium leguminosarum bv. viciae
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000879.5	0.42	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0001380.3	0.41	saccharide	salecan	Agrobacterium sp. ZX09

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001238.3	0.58	other (other)	biotin	Aspergillus nidulans
BGC0001239.3	0.55	other (other)	biotin	Aspergillus nidulans
BGC0000802.5	0.55	saccharide	succinoglycan	Sinorhizobium meliloti
BGC0001217.5	0.52	other (other)	PreQ0 Base	Streptomyces qinglanensis
BGC0002354.4	0.48	other (other)	huimycin	Kutzneria albida DSM 43870
BGC0001937.4	0.46	other (other)	tubercidin	Streptomyces tubercidicus
BGC0000762.3	0.45	saccharide	exopolysaccharide	Rhizobium leguminosarum bv. viciae
BGC0002362.3	0.45	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0000879.5	0.42	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0001380.3	0.41	saccharide	salecan	Agrobacterium sp. ZX09

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 21.84 out of 21.84

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.19 out of 20.97

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.42 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.63 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.40 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.28 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.20 out of 29.65

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.47 out of 32.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.64 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.03 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_CP021070.1 - Region 11 - terpene

Download region GenBank file

Download region SVG

Location: 6,279,024 - 6,301,870 nt. (total: 22,847 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A9K65_RS30725: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

A9K65_RS35750: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthetase

A9K65_RS30730: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001605.3	0.71	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001198.3	0.54	terpene	(+)-O-methylkolavelool	Herpetosiphon aurantiacus DSM 785
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.50	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000642.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0002398.2	0.44	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000643.3	0.42	terpene	carotenoid	Brevundimonas vesicularis
BGC0000639.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001605.3	0.71	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001198.3	0.54	terpene	(+)-O-methylkolavelool	Herpetosiphon aurantiacus DSM 785
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.50	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000642.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0002398.2	0.44	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000643.3	0.42	terpene	carotenoid	Brevundimonas vesicularis
BGC0000639.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

A9K65_RS30730: PT_FPPS_like

Domain 1 (61 - 327): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

A9K65_RS30735: T2TS

Domain 1 (5 - 499): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

Additional weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.94 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.42 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.10 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.63 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.25 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.88 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.88 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP021070.1 - Region 12 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 6,328,783 - 6,374,200 nt. (total: 45,418 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A9K65_RS30980: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: PPTase

A9K65_RS31000: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: peptidase

A9K65_RS31020: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: lyase

A9K65_RS30935: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

A9K65_RS30945: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

A9K65_RS30995: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001258.3	0.58	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000107.3	0.58	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001257.3	0.58	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.58	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001128.4	0.57	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.57	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.57	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.56	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.56	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001258.3	0.62	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000107.3	0.62	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001257.3	0.62	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002175.3	0.62	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.40 out of 27.18

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.20 out of 20.01

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.17 out of 25.88

Confidence: medium

Additional weak hits (9):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.22 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.29 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.47 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.99 out of 21.55

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.00 out of 27.18

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.27 out of 25.88

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.85 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.39 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.46 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 6328782 - 6374200:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal)
Non-colinear ordering:: A9K65_RS30995 + A9K65_RS30990

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A9K65_RS30995: X - mal

AMP-binding (276..674): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CQWG-------RLLYLSGEINYYGAAEACDVSHI
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

PKS_AT (1412..1711): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 42.6
Methoxymalonyl-CoA: 34.2
Methylmalonyl-CoA: 25.8
inactive: 17.5
CHC-CoA: 14.7
Acetyl-CoA: 14.2
fatty_acid: 13.5
Ethylmalonyl-CoA: 11.5
Propionyl-CoA: 9.9
Benzoyl-CoA: 7.4
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
NrdR	Represses ribonucleotide reductase encoding genes
PsrA	Oleic acid responsive regulator

NZ_CP021070.1 - Region 13 - hserlactone

Download region GenBank file

Download region SVG

Location: 6,602,843 - 6,623,481 nt. (total: 20,639 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase aminotransferase carbamoyltransferase

A9K65_RS32115: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

A9K65_RS32120: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

A9K65_RS32195: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: hydratase

A9K65_RS32150: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A9K65_RS32190: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000895.5	0.47	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.46	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002052.3	0.46	other (ectoine)	ectoine	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000895.5	0.47	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.46	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002052.3	0.46	other (ectoine)	ectoine	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

Additional weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.35 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.07 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.67 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.98 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.64 out of 18.57

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_CP021071.1 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 268,409 - 290,291 nt. (total: 21,883 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.42	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0000625.5	0.33	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002120.3	0.32	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001473.4	0.25	ribosomal	Sch 18640	Micromonospora arborensis
BGC0001753.3	0.25	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000604.4	0.25	ribosomal	GE2270A	Nonomuraea sp. WU8817
BGC0001474.4	0.24	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001471.5	0.23	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0001500.3	0.19	PKS	allocyclinone A, allocyclinone B, allocyclinone C, allocyclinone D	Actinoallomurus sp. ID145698
BGC0001687.3	0.19	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.42	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0000625.5	0.33	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002120.3	0.32	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001473.4	0.25	ribosomal	Sch 18640	Micromonospora arborensis
BGC0001753.3	0.25	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0000604.4	0.25	ribosomal	GE2270A	Nonomuraea sp. WU8817
BGC0001474.4	0.24	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001471.5	0.23	ribosomal	saalfelduracin	Amycolatopsis saalfeldensis
BGC0001500.3	0.19	PKS	allocyclinone A, allocyclinone B, allocyclinone C, allocyclinone D	Actinoallomurus sp. ID145698
BGC0001687.3	0.19	other (other)	N-tetradecanoyl tyrosine	uncultured bacterium CSL12

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

Additional weak hits (7):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.58 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.25 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.80 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.21 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.33 out of 20.01

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.25 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
ToxT	Regulator of MSHA biosynthesis