GCF_001652995.1 - 27 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_BBVA01000002.1 (Micromonospora sp. NBRC 110037)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	terpene-precursor	66,770	87,852
Region 2.2	terpene	142,819	163,769
Region 2.3	RiPP-like,terpene	306,898	331,431	Low	lymphostin/neolymphostinol B/lymphostinol/neolymphostin b	PKS+NRPS:Type I
Region 2.4	NRPS,2dos,T1PKS,NRPS-like	480,345	706,271	High	quinolidomicin A	PKS
Region 2.5	T1PKS,NRPS-like,NRPS,T3PKS,other,terpene-precursor	819,446	936,846	High	diazaquinomycin H/diazaquinomycin J	other:other
Region 2.6	oligosaccharide,terpene	998,624	1,037,681
Region 2.7	NI-siderophore,thioamide-NRP,t3nrps-iterative	1,080,397	1,166,366
Region 2.8	T2PKS	1,276,435	1,348,950	Low	pradimicin-A	PKS
Region 2.9	terpene	1,519,287	1,540,471
Region 2.10	lanthipeptide-class-iii	1,599,924	1,622,539
Region 2.11	RRE-containing,RiPP-like	1,943,985	1,965,889
Region 2.12	NRPS,T1PKS,NRPS-like	1,993,620	2,061,225
Region 2.13	terpene-precursor	2,121,012	2,142,055
Region 2.14	PKS-like,NRPS,T1PKS,NRPS-like	2,142,541	2,210,506
Region 2.15	lanthipeptide-class-i	2,388,486	2,414,946

NZ_BBVA01000003.1 (Micromonospora sp. NBRC 110037)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	T3PKS	436,512	477,558	High	loseolamycin A1/loseolamycin A2	PKS

NZ_BBVA01000004.1 (Micromonospora sp. NBRC 110037)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	triceptide	144,349	165,664

NZ_BBVA01000005.1 (Micromonospora sp. NBRC 110037)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	hydrogen-cyanide	36,149	48,920
Region 5.2	azole-containing-RiPP	107,727	129,845
Region 5.3	T1PKS	145,570	191,341	Low	calicheamicin	PKS

NZ_BBVA01000006.1 (Micromonospora sp. NBRC 110037)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	NAGGN	293,849	308,661

NZ_BBVA01000009.1 (Micromonospora sp. NBRC 110037)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	terpene-precursor	40,717	61,784	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I

NZ_BBVA01000010.1 (Micromonospora sp. NBRC 110037)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	terpene	35,705	57,850	Low	isorenieratene	terpene
Region 10.2	terpene	131,435	152,400

NZ_BBVA01000012.1 (Micromonospora sp. NBRC 110037)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	lanthipeptide-class-i	1	15,468
Region 12.2	azole-containing-RiPP,thioamitides	38,371	74,964

NZ_BBVA01000024.1 (Micromonospora sp. NBRC 110037)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	T1PKS	1	3,707

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	terpene-precursor	66,770	87,852
Region 2.2	terpene	142,819	163,769
Region 2.3	RiPP-like,terpene	306,898	331,431	Low	lymphostin/neolymphostinol B/lymphostinol/neolymphostin b	PKS+NRPS:Type I
Region 2.4	NRPS,2dos,T1PKS,NRPS-like	480,345	706,271	High	quinolidomicin A	PKS
Region 2.5	T1PKS,NRPS-like,NRPS,T3PKS,other,terpene-precursor	819,446	936,846	High	diazaquinomycin H/diazaquinomycin J	other:other
Region 2.6	oligosaccharide,terpene	998,624	1,037,681
Region 2.7	NI-siderophore,thioamide-NRP,t3nrps-iterative	1,080,397	1,166,366
Region 2.8	T2PKS	1,276,435	1,348,950	Low	pradimicin-A	PKS
Region 2.9	terpene	1,519,287	1,540,471
Region 2.10	lanthipeptide-class-iii	1,599,924	1,622,539
Region 2.11	RRE-containing,RiPP-like	1,943,985	1,965,889
Region 2.12	NRPS,T1PKS,NRPS-like	1,993,620	2,061,225
Region 2.13	terpene-precursor	2,121,012	2,142,055
Region 2.14	PKS-like,NRPS,T1PKS,NRPS-like	2,142,541	2,210,506
Region 2.15	lanthipeptide-class-i	2,388,486	2,414,946
Region 3.1	T3PKS	436,512	477,558	High	loseolamycin A1/loseolamycin A2	PKS
Region 4.1	triceptide	144,349	165,664
Region 5.1	hydrogen-cyanide	36,149	48,920
Region 5.2	azole-containing-RiPP	107,727	129,845
Region 5.3	T1PKS	145,570	191,341	Low	calicheamicin	PKS
Region 6.1	NAGGN	293,849	308,661
Region 9.1	terpene-precursor	40,717	61,784	Low	CDA1b/CDA2a/CDA2b/CDA3a/CDA3b/CDA4a/CDA4b	NRPS:Type I
Region 10.1	terpene	35,705	57,850	Low	isorenieratene	terpene
Region 10.2	terpene	131,435	152,400
Region 12.1	lanthipeptide-class-i	1	15,468
Region 12.2	azole-containing-RiPP,thioamitides	38,371	74,964
Region 24.1	T1PKS	1	3,707

No secondary metabolite regions were found in these records:: NZ_BBVA01000001.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000007.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000008.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000011.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000013.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000014.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000015.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000016.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000017.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000018.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000019.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000020.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000021.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000022.1 (Micromonospora sp. NBRC 110037); NZ_BBVA01000023.1 (Micromonospora sp. NBRC 110037)

Compact view

NZ_BBVA01000002.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 66,770 - 87,852 nt. (total: 21,083 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A4R25_RS00395: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

A4R25_RS00375: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.45	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.41	terpene	carotenoid	Myxococcus xanthus
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000645.3	0.40	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000644.3	0.39	terpene	carotenoid	Dietzia sp. CQ4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.45	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.41	terpene	carotenoid	Myxococcus xanthus
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000645.3	0.40	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000644.3	0.39	terpene	carotenoid	Dietzia sp. CQ4

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

A4R25_RS00375: PT_FPPS_like

Domain 1 (44 - 351): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (6):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.66 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 14.93 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.09 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.70 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.82 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBVA01000002.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 142,819 - 163,769 nt. (total: 20,951 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A4R25_RS00690: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

A4R25_RS00710: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: cyclase

A4R25_RS00725: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

A4R25_RS00720: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001592.5	0.42	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.42	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002687.2	0.41	NRPS, PKS	Massiliachelin	Massilia sp. NR 4-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.51	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.49	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001592.5	0.42	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.42	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000513.3	0.42	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002687.2	0.41	NRPS, PKS	Massiliachelin	Massilia sp. NR 4-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

A4R25_RS00725: T1TS

Domain 1 (6 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 25.32 out of 29.72

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.05 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.03 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.10 out of 20.97

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBVA01000002.1 - Region 3 - RiPP-like,terpene

Download region GenBank file

Download region SVG

Location: 306,898 - 331,431 nt. (total: 24,534 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A4R25_RS01425: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A4R25_RS01470: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

A4R25_RS01515: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

A4R25_RS01455: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: hydratase

A4R25_RS01410: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A4R25_RS01450: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001007.5	0.33	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001006.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001910.4	0.20	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002391.2	0.20	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002425.3	0.20	ribosomal	stlassin	Streptomyces sp.
BGC0002805.2	0.19	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000188.5	0.19	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001911.3	0.18	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.17	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000297.5	0.17	NRPS, PKS, saccharide	aeruginoside 126B, aeruginoside 126A	Planktothrix agardhii NIVA-CYA 126

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001910.4	0.53	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002391.2	0.52	terpene	zealexin B3, zealexin C2	Zea mays
BGC0001911.3	0.49	terpene	raimonol	Streptomyces anulatus
BGC0001197.5	0.48	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001006.5	0.47	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001007.5	0.47	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0001483.4	0.47	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000286.3	0.44	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000623.3	0.43	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

A4R25_RS01480: T2TS

Domain 1 (15 - 504): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

Additional weak hits (6):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.03 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.16 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.02 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.57 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
MexT	Global virulence regulator

NZ_BBVA01000002.1 - Region 4 - 2dos,NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 480,345 - 706,271 nt. (total: 225,927 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

A4R25_RS02250: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

A4R25_RS02290: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

A4R25_RS02305: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase aminotransferase glycosyltransferase methyltransferase

A4R25_RS02210: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

A4R25_RS02245: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

A4R25_RS02295: methyltransferase

smcogs: SMCOG1089: methyltransferase

A4R25_RS02400: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

A4R25_RS02255: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

A4R25_RS02300: thioesterase

smcogs: SMCOG1004: thioesterase

A4R25_RS02410: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

A4R25_RS02260: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS02265: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A4R25_RS02275: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

A4R25_RS02285: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A4R25_RS02310: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS02320: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS02325: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS02330: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS02335: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS02340: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A4R25_RS02345: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS02350: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A4R25_RS02355: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A4R25_RS02360: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS02365: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS02390: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS02405: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

A4R25_RS02190: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	1.67	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001261.3	1.67	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	1.64	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	1.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002520.2	1.62	PKS	quinolidomicin A	Micromonospora sp.
BGC0002135.2	1.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	1.56	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.56	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.51	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	1.48	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002520.2	0.90	PKS	quinolidomicin A	Micromonospora sp.
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.19 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

Additional weak hits (29):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.23 out of 20.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.01 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.03 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.23 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.09 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.39 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.56 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.56 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.17 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.49 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.32 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.75 out of 36.54

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.53 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.67 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.84 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.97 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.23 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.14 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.40 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.77 out of 20.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.27 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.36 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.71 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 480344 - 706271:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - X) + (AHBA - ccmal - Me-redmal) + (ccmal) + (ccmal - ohmal - ohmal) + (redmal - pk - ccmal - ohmal) + (ohmal - ccmal - ccmal - ccmal - ohmal - ohmal) + (ohmal) + (ccmal - Me-ohmal - ohmal) + (ohmal - Me-redmal) + (ohmal - Me-ohmal - Me-ohmal) + (ccmal - Me-ccmal) + (Me-ohmal) + (Me-ohmal - ohmal) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A4R25_RS02260: X

AMP-binding (224..613): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWMCFDVALGETFCTLAGEINAYGPAEASVACTW
Nearest Stachelhaus code(s):: Gly DVGYLIAVAK (56% 8Å match); Hty DLGFTGAVCK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

A4R25_RS02265: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (220..609): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWMAFDAAFGEAFGIFGGEVNAYGPAEIAVACTW
Nearest Stachelhaus code(s):: Ile DAGFIGAVFK (50% 8Å match)
Stachelhaus code match:: 90% (moderate)

A4R25_RS02285: AHBA - mal - mmal

CAL_domain (35..442): AHBA

minowa: AHBA

Prediction, score:

AHBA: 391.9
shikimic_acid: 260.1
Acetyl-CoA: 8.6
fatty_acid: 0.0
NH2: 0.0

PKS_AT (1643..1941): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.0
inactive: 110.8
Methoxymalonyl-CoA: 62.7
Methylmalonyl-CoA: 44.6
Propionyl-CoA: 30.7
Ethylmalonyl-CoA: 23.0
Acetyl-CoA: 21.8
Benzoyl-CoA: 13.1
Isobutyryl-CoA: 10.7
fatty_acid: 10.5
trans-1,2-CPDA: 9.5
CHC-CoA: 4.0
3-Methylbutyryl-CoA: 2.5
2-Methylbutyryl-CoA: -4.1

PKS_AT (3364..3660): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 221.9
Ethylmalonyl-CoA: 216.1
Methoxymalonyl-CoA: 181.3
2-Methylbutyryl-CoA: 144.9
trans-1,2-CPDA: 131.4
Malonyl-CoA: 122.5
Propionyl-CoA: 110.0
CHC-CoA: 97.2
Isobutyryl-CoA: 83.3
Benzoyl-CoA: 72.0
Acetyl-CoA: 67.9
inactive: 39.4
fatty_acid: 34.6
3-Methylbutyryl-CoA: 18.2

A4R25_RS02305: mal

PKS_AT (559..855): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.7
inactive: 103.1
Methoxymalonyl-CoA: 52.8
Methylmalonyl-CoA: 44.1
Propionyl-CoA: 25.6
fatty_acid: 22.5
Acetyl-CoA: 22.1
Isobutyryl-CoA: 19.0
Ethylmalonyl-CoA: 16.4
Benzoyl-CoA: 8.6
CHC-CoA: 3.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -5.8

A4R25_RS02310: mal - mal - mal

PKS_AT (569..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.7
inactive: 97.7
Methoxymalonyl-CoA: 75.0
Methylmalonyl-CoA: 71.9
Isobutyryl-CoA: 46.2
Ethylmalonyl-CoA: 33.6
Propionyl-CoA: 28.4
Benzoyl-CoA: 27.9
Acetyl-CoA: 25.3
2-Methylbutyryl-CoA: 20.6
3-Methylbutyryl-CoA: 15.7
CHC-CoA: 14.7
fatty_acid: 10.6
trans-1,2-CPDA: 6.1

PKS_AT (2302..2598): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.7
inactive: 94.0
Methoxymalonyl-CoA: 54.0
Methylmalonyl-CoA: 41.8
Propionyl-CoA: 28.6
Ethylmalonyl-CoA: 22.5
fatty_acid: 15.3
Isobutyryl-CoA: 15.1
Acetyl-CoA: 13.7
Benzoyl-CoA: 10.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (3834..4132): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.7
inactive: 92.3
Methoxymalonyl-CoA: 54.0
Methylmalonyl-CoA: 40.4
Propionyl-CoA: 28.1
Ethylmalonyl-CoA: 18.2
Isobutyryl-CoA: 17.4
fatty_acid: 16.5
Acetyl-CoA: 16.5
Benzoyl-CoA: 16.4
CHC-CoA: 8.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

A4R25_RS02320: mal - pk - mal - mal

PKS_AT (567..864): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.8
inactive: 103.8
Methoxymalonyl-CoA: 66.4
Methylmalonyl-CoA: 59.3
Propionyl-CoA: 37.9
Ethylmalonyl-CoA: 28.7
Isobutyryl-CoA: 24.8
Benzoyl-CoA: 24.1
Acetyl-CoA: 16.3
2-Methylbutyryl-CoA: 15.4
fatty_acid: 14.5
CHC-CoA: 13.6
trans-1,2-CPDA: 13.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2635..2932): pk

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 195.3
Methylmalonyl-CoA: 191.4
Methoxymalonyl-CoA: 157.3
2-Methylbutyryl-CoA: 136.2
trans-1,2-CPDA: 113.1
Propionyl-CoA: 105.9
CHC-CoA: 105.0
Isobutyryl-CoA: 98.2
Malonyl-CoA: 89.9
Benzoyl-CoA: 62.8
Acetyl-CoA: 38.6
3-Methylbutyryl-CoA: 37.2
inactive: 19.4
fatty_acid: 19.3

PKS_AT (4704..5003): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 230.1
inactive: 111.8
Methoxymalonyl-CoA: 66.5
Methylmalonyl-CoA: 64.6
Propionyl-CoA: 41.4
Isobutyryl-CoA: 33.7
Ethylmalonyl-CoA: 30.1
2-Methylbutyryl-CoA: 26.8
Acetyl-CoA: 22.2
Benzoyl-CoA: 20.4
fatty_acid: 14.0
CHC-CoA: 11.6
trans-1,2-CPDA: 8.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (6452..6750): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.4
inactive: 108.7
Methoxymalonyl-CoA: 67.6
Methylmalonyl-CoA: 58.2
Propionyl-CoA: 36.5
Isobutyryl-CoA: 31.4
Ethylmalonyl-CoA: 27.5
Benzoyl-CoA: 21.9
Acetyl-CoA: 17.7
2-Methylbutyryl-CoA: 13.7
fatty_acid: 12.0
CHC-CoA: 9.3
trans-1,2-CPDA: 8.3
3-Methylbutyryl-CoA: 0.0

A4R25_RS02325: mal - mal - mal - mal - mal - mal

PKS_AT (572..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.1
inactive: 107.6
Methoxymalonyl-CoA: 62.4
Methylmalonyl-CoA: 51.7
Propionyl-CoA: 36.9
Isobutyryl-CoA: 25.3
Acetyl-CoA: 22.6
2-Methylbutyryl-CoA: 20.8
Ethylmalonyl-CoA: 20.6
Benzoyl-CoA: 13.3
CHC-CoA: 9.9
fatty_acid: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2123..2422): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 212.3
inactive: 106.3
Methoxymalonyl-CoA: 66.2
Methylmalonyl-CoA: 57.9
Propionyl-CoA: 34.8
Isobutyryl-CoA: 31.8
Ethylmalonyl-CoA: 29.6
Benzoyl-CoA: 20.0
Acetyl-CoA: 19.4
2-Methylbutyryl-CoA: 15.2
fatty_acid: 11.7
CHC-CoA: 11.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3875..4170): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.5
inactive: 95.3
Methoxymalonyl-CoA: 56.0
Methylmalonyl-CoA: 48.3
Propionyl-CoA: 30.6
Isobutyryl-CoA: 21.0
Ethylmalonyl-CoA: 18.2
Acetyl-CoA: 11.1
Benzoyl-CoA: 5.5
2-Methylbutyryl-CoA: 5.3
CHC-CoA: 2.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5618..5916): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.4
inactive: 107.9
Methoxymalonyl-CoA: 61.8
Methylmalonyl-CoA: 53.0
Isobutyryl-CoA: 32.9
Propionyl-CoA: 30.6
Ethylmalonyl-CoA: 23.8
2-Methylbutyryl-CoA: 21.7
Benzoyl-CoA: 19.9
Acetyl-CoA: 13.9
fatty_acid: 12.8
CHC-CoA: 12.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (7363..7662): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.2
inactive: 105.4
Methoxymalonyl-CoA: 62.6
Methylmalonyl-CoA: 55.2
Propionyl-CoA: 32.8
Isobutyryl-CoA: 27.8
Ethylmalonyl-CoA: 22.6
Acetyl-CoA: 17.8
Benzoyl-CoA: 17.5
fatty_acid: 12.8
2-Methylbutyryl-CoA: 12.7
CHC-CoA: 11.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8900..9198): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.3
inactive: 101.7
Methoxymalonyl-CoA: 63.0
Methylmalonyl-CoA: 54.1
Propionyl-CoA: 40.7
Benzoyl-CoA: 18.6
Acetyl-CoA: 17.2
Isobutyryl-CoA: 15.7
CHC-CoA: 13.0
trans-1,2-CPDA: 11.7
fatty_acid: 11.7
2-Methylbutyryl-CoA: 9.8
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -2.5

A4R25_RS02330: mal

PKS_AT (581..880): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.3
inactive: 108.3
Methoxymalonyl-CoA: 68.3
Methylmalonyl-CoA: 52.5
Propionyl-CoA: 38.3
Isobutyryl-CoA: 22.2
Ethylmalonyl-CoA: 21.6
Acetyl-CoA: 20.3
Benzoyl-CoA: 18.3
2-Methylbutyryl-CoA: 13.6
CHC-CoA: 12.3
trans-1,2-CPDA: 12.0
fatty_acid: 10.5
3-Methylbutyryl-CoA: 0.0

A4R25_RS02335: mal - mmal - mal

PKS_AT (571..867): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.4
inactive: 112.2
Methoxymalonyl-CoA: 69.1
Methylmalonyl-CoA: 65.4
Ethylmalonyl-CoA: 36.3
Propionyl-CoA: 29.8
Isobutyryl-CoA: 25.6
Benzoyl-CoA: 21.4
fatty_acid: 15.9
Acetyl-CoA: 15.6
CHC-CoA: 15.4
2-Methylbutyryl-CoA: 9.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2342..2545): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 46.0
2-Methylbutyryl-CoA: 39.1
Methoxymalonyl-CoA: 38.4
Propionyl-CoA: 34.8
CHC-CoA: 32.4
Ethylmalonyl-CoA: 30.2
trans-1,2-CPDA: 30.1
Isobutyryl-CoA: 11.6
Benzoyl-CoA: 9.0
Malonyl-CoA: 7.1
inactive: 0.0
fatty_acid: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3814..4104): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.7
inactive: 93.5
Methoxymalonyl-CoA: 59.0
Methylmalonyl-CoA: 43.4
Benzoyl-CoA: 18.2
Propionyl-CoA: 16.8
Acetyl-CoA: 15.0
fatty_acid: 12.4
Isobutyryl-CoA: 9.3
Ethylmalonyl-CoA: 7.2
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

A4R25_RS02340: mal - mmal

PKS_AT (563..867): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.4
inactive: 111.0
Methoxymalonyl-CoA: 62.6
Methylmalonyl-CoA: 52.8
Isobutyryl-CoA: 25.2
Propionyl-CoA: 23.8
Ethylmalonyl-CoA: 16.0
fatty_acid: 13.6
Acetyl-CoA: 12.9
Benzoyl-CoA: 8.6
CHC-CoA: 2.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -2.2

PKS_AT (2114..2409): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 169.5
Methoxymalonyl-CoA: 146.6
Ethylmalonyl-CoA: 145.2
2-Methylbutyryl-CoA: 121.3
Propionyl-CoA: 121.0
Malonyl-CoA: 103.7
trans-1,2-CPDA: 94.0
CHC-CoA: 75.8
Isobutyryl-CoA: 59.3
Acetyl-CoA: 41.3
3-Methylbutyryl-CoA: 40.3
inactive: 36.5
fatty_acid: 34.1
Benzoyl-CoA: 26.2

A4R25_RS02345: mal - mmal - mmal

PKS_AT (569..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.2
inactive: 106.3
Methoxymalonyl-CoA: 67.2
Methylmalonyl-CoA: 55.1
Propionyl-CoA: 31.9
Isobutyryl-CoA: 26.8
Ethylmalonyl-CoA: 26.8
Benzoyl-CoA: 20.2
Acetyl-CoA: 19.1
2-Methylbutyryl-CoA: 13.6
fatty_acid: 10.3
CHC-CoA: 4.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2075..2375): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 204.9
Ethylmalonyl-CoA: 198.1
Methoxymalonyl-CoA: 169.8
2-Methylbutyryl-CoA: 122.5
trans-1,2-CPDA: 116.0
Propionyl-CoA: 101.9
Malonyl-CoA: 92.0
Isobutyryl-CoA: 73.6
CHC-CoA: 72.8
Benzoyl-CoA: 69.8
3-Methylbutyryl-CoA: 47.3
Acetyl-CoA: 41.0
fatty_acid: 34.4
inactive: 32.4

PKS_AT (3641..3936): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 172.4
Methoxymalonyl-CoA: 147.6
Ethylmalonyl-CoA: 146.4
2-Methylbutyryl-CoA: 123.9
Propionyl-CoA: 117.2
Malonyl-CoA: 102.6
trans-1,2-CPDA: 90.0
CHC-CoA: 76.1
Isobutyryl-CoA: 54.7
Acetyl-CoA: 39.1
3-Methylbutyryl-CoA: 37.1
fatty_acid: 34.6
inactive: 34.3
Benzoyl-CoA: 27.7

A4R25_RS02350: mal - mmal

PKS_AT (568..862): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.8
inactive: 106.4
Methoxymalonyl-CoA: 65.6
Methylmalonyl-CoA: 53.7
Propionyl-CoA: 32.2
Isobutyryl-CoA: 28.3
Ethylmalonyl-CoA: 25.0
Acetyl-CoA: 19.5
Benzoyl-CoA: 16.0
2-Methylbutyryl-CoA: 11.6
fatty_acid: 8.9
CHC-CoA: 3.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2344..2639): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 170.1
Ethylmalonyl-CoA: 145.0
Methoxymalonyl-CoA: 144.2
2-Methylbutyryl-CoA: 115.3
Propionyl-CoA: 115.2
Malonyl-CoA: 100.5
trans-1,2-CPDA: 96.6
CHC-CoA: 74.5
Isobutyryl-CoA: 49.8
Acetyl-CoA: 37.2
fatty_acid: 35.0
3-Methylbutyryl-CoA: 32.1
inactive: 28.2
Benzoyl-CoA: 26.5

A4R25_RS02355: mmal

PKS_AT (583..878): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 175.7
Methoxymalonyl-CoA: 148.1
Ethylmalonyl-CoA: 147.5
2-Methylbutyryl-CoA: 129.4
Propionyl-CoA: 118.3
Malonyl-CoA: 107.2
trans-1,2-CPDA: 104.0
CHC-CoA: 82.2
Isobutyryl-CoA: 61.5
Acetyl-CoA: 42.2
fatty_acid: 41.7
3-Methylbutyryl-CoA: 40.4
inactive: 34.4
Benzoyl-CoA: 31.1

A4R25_RS02360: mmal - mal

PKS_AT (570..865): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 174.2
Methoxymalonyl-CoA: 144.8
Ethylmalonyl-CoA: 143.1
2-Methylbutyryl-CoA: 116.5
Propionyl-CoA: 113.5
trans-1,2-CPDA: 100.9
Malonyl-CoA: 97.9
CHC-CoA: 81.0
Isobutyryl-CoA: 50.6
fatty_acid: 44.3
Acetyl-CoA: 42.1
Benzoyl-CoA: 34.1
3-Methylbutyryl-CoA: 31.3
inactive: 26.0

PKS_AT (2082..2386): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.2
inactive: 89.3
Methoxymalonyl-CoA: 86.1
Methylmalonyl-CoA: 85.1
Isobutyryl-CoA: 55.5
Ethylmalonyl-CoA: 52.3
Propionyl-CoA: 46.9
Acetyl-CoA: 36.1
CHC-CoA: 32.6
2-Methylbutyryl-CoA: 25.9
Benzoyl-CoA: 23.2
trans-1,2-CPDA: 18.5
fatty_acid: 16.0
3-Methylbutyryl-CoA: 5.0

A4R25_RS02365: mal

PKS_AT (570..866): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.2
inactive: 101.8
Methoxymalonyl-CoA: 66.5
Methylmalonyl-CoA: 50.1
Propionyl-CoA: 33.1
Ethylmalonyl-CoA: 26.9
Acetyl-CoA: 22.0
CHC-CoA: 19.8
Benzoyl-CoA: 19.2
2-Methylbutyryl-CoA: 19.0
Isobutyryl-CoA: 16.1
fatty_acid: 12.1
trans-1,2-CPDA: 8.9
3-Methylbutyryl-CoA: 0.0

A4R25_RS02390: X

AMP-binding (43..360): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DLLTYGLVVG-GASVSADGVQAYGTTETLVALTG
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

A4R25_RS02405: X

AMP-binding (11..378): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CGLH---LVLGGFGVSGSAVERYGMTETLITVSA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBVA01000002.1 - Region 5 - NRPS,NRPS-like,T1PKS,T3PKS,other,terpene-precursor

Download region GenBank file

Download region SVG

Location: 819,446 - 936,846 nt. (total: 117,401 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A4R25_RS02945: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

A4R25_RS03055: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

A4R25_RS03235: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A4R25_RS03245: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase glycosyltransferase

A4R25_RS02890: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

A4R25_RS02970: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: esterase hydrolase

A4R25_RS02995: thioesterase

smcogs: SMCOG1004: thioesterase

A4R25_RS03240: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: dehydratase lyase

A4R25_RS02900: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

A4R25_RS03025: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Isomerases: isomerase

A4R25_RS03200: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase synthetase

A4R25_RS02915: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

A4R25_RS02960: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A4R25_RS02975: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS02985: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS03000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS03040: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS03075: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

A4R25_RS03125: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

A4R25_RS03155: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

A4R25_RS30460: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS32090: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transport

A4R25_RS03010: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

A4R25_RS03110: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001327.5	1.79	NRPS, PKS	rakicidin A, rakicidin B	Micromonospora purpureochromogenes
BGC0001848.4	1.72	other (other)	diazaquinomycin H, diazaquinomycin J	Micromonospora sp. B006
BGC0000679.5	1.71	terpene	diazepinomicin	Micromonospora sp. M42
BGC0000342.4	1.40	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	1.28	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001164.3	1.20	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.20	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001135.5	1.20	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	1.19	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	1.19	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001327.5	0.90	NRPS, PKS	rakicidin A, rakicidin B	Micromonospora purpureochromogenes
BGC0001848.4	0.89	other (other)	diazaquinomycin H, diazaquinomycin J	Micromonospora sp. B006
BGC0000679.5	0.83	terpene	diazepinomicin	Micromonospora sp. M42
BGC0000342.4	0.76	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002458.3	0.72	NRPS	alazopeptin	Streptacidiphilus griseoplanus

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

A4R25_RS03125: PT_FPPS_like

Domain 1 (42 - 357): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.17 out of 23.79

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.89 out of 30.11

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.31 out of 29.51

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.31 out of 23.79

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.49 out of 30.22

Confidence: medium

Additional weak hits (25):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.56 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.61 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.70 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.25 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.57 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.40 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.07 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.41 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.34 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.01 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.95 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.54 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.30 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.60 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.62 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.41 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.42 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.71 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.26 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 819445 - 896735:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - Me-redmal) + (ohmal) + (Ser) + (ccmal) + (NMe-Gly) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 819445 - 882000:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - Me-redmal) + (ohmal) + (Ser) + (ccmal) + (NMe-Gly) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A4R25_RS02960: NH2 - mmal

CAL_domain (18..466): NH2

minowa: NH2

Prediction, score:

NH2: 41.1
fatty_acid: 21.1
AHBA: 11.0
Acetyl-CoA: 4.3
shikimic_acid: 0.0

PKS_AT (1241..1539): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 79.2%; Propionyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 148.3
Methoxymalonyl-CoA: 128.7
Malonyl-CoA: 111.2
Ethylmalonyl-CoA: 103.1
Isobutyryl-CoA: 88.3
Benzoyl-CoA: 77.4
Propionyl-CoA: 67.5
2-Methylbutyryl-CoA: 65.8
trans-1,2-CPDA: 59.0
3-Methylbutyryl-CoA: 53.7
fatty_acid: 39.5
inactive: 38.5
CHC-CoA: 36.1
Acetyl-CoA: 32.4

A4R25_RS32090: mal

PKS_AT (566..861): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.9
inactive: 124.5
Methoxymalonyl-CoA: 88.6
Methylmalonyl-CoA: 81.8
Propionyl-CoA: 64.7
Ethylmalonyl-CoA: 57.3
Isobutyryl-CoA: 55.5
2-Methylbutyryl-CoA: 54.3
Acetyl-CoA: 46.9
CHC-CoA: 36.7
Benzoyl-CoA: 35.4
trans-1,2-CPDA: 28.4
fatty_acid: 23.9
3-Methylbutyryl-CoA: 10.6

A4R25_RS02970: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (500..914): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

A4R25_RS02975: mal

PKS_AT (537..833): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 91.7%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 160.7
inactive: 96.6
Methoxymalonyl-CoA: 79.6
Methylmalonyl-CoA: 67.0
Propionyl-CoA: 46.1
Ethylmalonyl-CoA: 34.6
CHC-CoA: 28.5
2-Methylbutyryl-CoA: 24.9
Benzoyl-CoA: 22.5
Isobutyryl-CoA: 22.1
trans-1,2-CPDA: 21.4
Acetyl-CoA: 18.8
fatty_acid: 15.7
3-Methylbutyryl-CoA: 5.0

A4R25_RS30460: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (494..887): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAGLELQALAGGEWNMYGPTETTIWSAV
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

A4R25_RS02985: X

AMP-binding (505..932): X

nrpys: OH-Asn

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWLAAPAAVWEACFFCGGAHHVLVPPDVAAPVTA
Nearest Stachelhaus code(s):: OH-Asn PAWCFGVAPK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

A4R25_RS03000: X

AMP-binding (461..863): X

nrpys: Asp, Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWTSFDLGIPNTKMIAAGDATEYGPTEITIGNSG
Nearest Stachelhaus code(s):: Asp DLTKIGHIGK (56% 8Å match); Asn DLTKIGEVGK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

A4R25_RS03040: X

AMP-binding (16..423): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RPQVHSRLFTAIETSSTFDGQLYGQSEVGPVAAR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

A4R25_RS03225: X

AMP-binding (70..250): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LRFTLTGHLAHAWSFVGGEIEEYGSTETGSLAGE
Nearest Stachelhaus code(s):: nohBza or oh-nitroBza AGAWYAEPLK (71% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CelR	Cellobiose uptake repressor
ClgR	Caseinolytic protease gene regulator
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism

NZ_BBVA01000002.1 - Region 6 - oligosaccharide,terpene

Download region GenBank file

Download region SVG

Location: 998,624 - 1,037,681 nt. (total: 39,058 nt) Show pHMM detection rules used

oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

A4R25_RS03585: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A4R25_RS03620: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A4R25_RS03630: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A4R25_RS03635: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

A4R25_RS03660: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: PPTase aminotransferase glycosyltransferase methyltransferase

A4R25_RS03610: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

A4R25_RS03625: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

A4R25_RS03640: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

A4R25_RS03665: aminotransferase

smcogs: SMCOG1019: aminotransferase

A4R25_RS03680: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: ligase synthase synthetase

A4R25_RS03595: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS03615: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A4R25_RS03645: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

A4R25_RS03675: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

A4R25_RS03695: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002007.2	0.43	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002631.2	0.42	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000844.5	0.38	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001310.5	0.37	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001529.5	0.36	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001485.4	0.34	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002347.3	0.34	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001605.3	0.34	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002127.3	0.33	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001075.5	0.32	PKS, terpene	aurachin RE	Rhodococcus erythropolis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002007.2	0.55	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001201.3	0.52	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0000844.5	0.51	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001485.4	0.50	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001529.5	0.50	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002347.3	0.49	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001605.3	0.49	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000277.5	0.48	PKS	urdamycin	Streptomyces fradiae

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

A4R25_RS03645: PT_FPPS_like

Domain 1 (40 - 323): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

A4R25_RS03655: T2TS

Domain 1 (311 - 549): Type 2 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.93 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (15):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.89 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.21 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.26 out of 30.22

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.84 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.57 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.87 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.28 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.69 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.95 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBVA01000002.1 - Region 7 - NI-siderophore,t3nrps-iterative,thioamide-NRP

Download region GenBank file

Download region SVG

Location: 1,080,397 - 1,166,366 nt. (total: 85,970 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC
thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

A4R25_RS03930: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

A4R25_RS03990: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

A4R25_RS04000: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

A4R25_RS04010: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A4R25_RS04015: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase carboxylase

A4R25_RS04045: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

A4R25_RS04115: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: hydrolase phosphatase

A4R25_RS03880: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

A4R25_RS03995: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

A4R25_RS04125: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: decarboxylase

A4R25_RS03935: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

A4R25_RS04025: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase

A4R25_RS04005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS04030: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS04055: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	1.01	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.86	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.78	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.78	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.70	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.70	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002620.2	0.57	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.76	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.73	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.65	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.65	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0001132.4	0.62	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.78 out of 30.22

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.34 out of 20.97

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 35.53 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.77 out of 36.53

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.73 out of 30.22

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.58 out of 23.43

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.39 out of 27.04

Confidence: medium

Additional weak hits (28):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.09 out of 30.22

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.37 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.08 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.38 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.95 out of 39.62

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.72 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.08 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.29 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.29 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.84 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.84 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.23 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.77 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.69 out of 31.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.33 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.20 out of 29.65

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 39.62

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.99 out of 36.53

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.71 out of 25.88

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.45 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.82 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

A4R25_RS04005: X

AMP-binding (6..399): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FCCFFDPSVFDVFSLFAGEENLYGPTELTVTCTG
Nearest Stachelhaus code(s):: Ala DCFFFALITK (65% 8Å match); Pro DLFYLALVCK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

A4R25_RS04030: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (10..405): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGLYQLPCTNTGAQLMFGLTECKRAAIM
Nearest Stachelhaus code(s):: Asp DYYPTTMRAK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
ClgR	Caseinolytic protease gene regulator
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor

NZ_BBVA01000002.1 - Region 8 - T2PKS

Download region GenBank file

Download region SVG

Location: 1,276,435 - 1,348,950 nt. (total: 72,516 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

A4R25_RS04865: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

A4R25_RS05030: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase carboxylase transferase

A4R25_RS04900: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

A4R25_RS04910: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

A4R25_RS05045: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase protease

A4R25_RS05005: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

A4R25_RS05035: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

A4R25_RS05065: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

A4R25_RS04885: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

A4R25_RS04895: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

A4R25_RS04915: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Isomerases: mutase

A4R25_RS05075: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

A4R25_RS04830: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS04925: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS04930: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A4R25_RS04935: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS04950: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS04960: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS04965: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS04990: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

A4R25_RS05020: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.62	PKS	spore pigment	Streptomyces avermitilis
BGC0000275.4	0.61	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001513.3	0.60	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000261.5	0.59	PKS	R1128	Streptomyces sp. R1128
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.58	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.62	PKS	spore pigment	Streptomyces avermitilis
BGC0000275.4	0.61	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0001513.3	0.60	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000261.5	0.59	PKS	R1128	Streptomyces sp. R1128
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.58	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000215.5	0.57	PKS	curamycin	Streptomyces cyaneus
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.20 out of 26.33

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.66 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

Additional weak hits (12):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.82 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.53 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.88 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.89 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.88 out of 33.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.60 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.90 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.88 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

A4R25_RS04830: X

AMP-binding (86..338): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LRSVYGLFTGGGMVVFGAELDIYGLSEVAVECVE
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

A4R25_RS04935: X

AMP-binding (51..376): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ERYPLGLVGGLGVLTTGGEGNMYGMTEVGVIGTD
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

A4R25_RS04960: X

AMP-binding (48..431): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AHLLHTATVLMQFGFNTGD-----------VVTR
Nearest Stachelhaus code(s):: Trp GALFFAAGVK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

A4R25_RS05020: X

AMP-binding (17..408): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDFS--LASGQTFVNVGAGRIVYGLSEAVVICAL
Nearest Stachelhaus code(s):: Hph or Hty DLGFTGCVNK (38% 8Å match); Hty DLGFTGCVTK (35% 8Å match); 3Me-Glu or Glu DLGKTGVVNK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 1276434 to 1348950
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

A4R25_RS04885: CYC C4-C21/C2-C23|C2-C19 (Score: 117.4; E-value: 6.2e-37)
A4R25_RS04895: CYC C4-C21/C2-C23|C2-C19 (Score: 130.7; E-value: 4.5e-41)
A4R25_RS04915: CYC C9-C14 (Score: 241.8; E-value: 5e-75)
A4R25_RS04920: CYC C5-C18 (Score: 210.9; E-value: 1.2e-65)
A4R25_RS04925: KS (Score: 707.6; E-value: 1.1e-215)
A4R25_RS04930: CLF (Score: 500.8; E-value: 6.3e-153)
A4R25_RS04965: CLF (Score: 267.5; E-value: 4.3e-82)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor

NZ_BBVA01000002.1 - Region 9 - terpene

Download region GenBank file

Download region SVG

Location: 1,519,287 - 1,540,471 nt. (total: 21,185 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

A4R25_RS05915: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002690.2	0.42	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001725.3	0.40	other (other)	oxetanocin A	Bacillus megaterium
BGC0000903.3	0.40	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000844.5	0.39	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002316.2	0.38	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus
BGC0002669.2	0.37	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000664.5	0.36	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000468.5	0.36	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002690.2	0.42	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0001725.3	0.40	other (other)	oxetanocin A	Bacillus megaterium
BGC0000903.3	0.40	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000844.5	0.39	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002316.2	0.38	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus
BGC0002669.2	0.37	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000664.5	0.36	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000468.5	0.36	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

A4R25_RS05910: Lycopene_cycl

Domain 1 (10 - 379): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (8):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.24 out of 25.88

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.58 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.15 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.73 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.52 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.12 out of 28.14

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_BBVA01000002.1 - Region 10 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 1,599,924 - 1,622,539 nt. (total: 22,616 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A4R25_RS06395: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: deformylase hydrolase

A4R25_RS06300: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

A4R25_RS06305: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.54	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000551.5	0.53	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.53	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.53	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.52	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0001928.2	0.51	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000513.3	0.51	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000503.5	0.51	ribosomal	cinnamycin	Streptomyces cinnamoneus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.54	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000551.5	0.53	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.53	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.53	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.52	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0001928.2	0.51	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000513.3	0.51	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000503.5	0.51	ribosomal	cinnamycin	Streptomyces cinnamoneus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (4):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.89 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.49 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.06 out of 28.19

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BBVA01000002.1 - Region 11 - RRE-containing,RiPP-like

Download region GenBank file

Download region SVG

Location: 1,943,985 - 1,965,889 nt. (total: 21,905 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

A4R25_RS07980: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: glycosyltransferase

A4R25_RS07995: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: glucanase

A4R25_RS07945: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.28	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001146.5	0.27	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001174.4	0.26	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001145.5	0.25	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000604.4	0.22	ribosomal	GE2270A	Nonomuraea sp. WU8817
BGC0002262.2	0.22	PKS	trienylfuranol A, sporothriolide, dihydrosporothriolide, deoxysporothric acid, dihydroisosporothric acid, sporothric acid, isosporothric acid, sporochartine B	Hypomontagnella monticulosa
BGC0000603.5	0.22	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001155.5	0.22	ribosomal	GE2270	Planobispora rosea
BGC0000606.5	0.22	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001640.3	0.22	ribosomal	kocurin	Kocuria rosea

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002311.3	0.44	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001285.5	0.43	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001146.5	0.42	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001174.4	0.41	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001173.5	0.41	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0002262.2	0.40	PKS	trienylfuranol A, sporothriolide, dihydrosporothriolide, deoxysporothric acid, dihydroisosporothric acid, sporothric acid, isosporothric acid, sporochartine B	Hypomontagnella monticulosa
BGC0001145.5	0.40	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0001222.3	0.39	ribosomal	acidocin B	Lactobacillus acidophilus
BGC0000491.5	0.39	ribosomal	gassericin A	Lactobacillus gasseri

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.51 out of 30.11

Confidence: medium

Additional weak hits (4):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.42 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.15 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.96 out of 36.53

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 0 - 78; Score: 67.5; RRE type: Heterocycloanthracin_C_RRE; Location: 1 - 91; Score: 46.7
: RRE type: Thiopeptide_F_RRE; Location: 0 - 78; Score: 67.5; RRE type: Heterocycloanthracin_C_RRE; Location: 1 - 91; Score: 46.7

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_BBVA01000002.1 - Region 12 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1,993,620 - 2,061,225 nt. (total: 67,606 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxygenase

A4R25_RS08290: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

A4R25_RS08325: flavodoxin

smcogs: SMCOG1134: flavodoxin

A4R25_RS08345: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: methyltransferase

A4R25_RS08370: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: esterase hydrolase

A4R25_RS08310: thioesterase

smcogs: SMCOG1004: thioesterase

A4R25_RS08390: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase dehydratase hydratase

A4R25_RS08175: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

A4R25_RS08225: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

A4R25_RS08250: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: ligase synthase

A4R25_RS08275: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A4R25_RS08280: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS08295: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A4R25_RS08300: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS08315: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

A4R25_RS08350: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.25	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	1.22	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	1.19	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	1.15	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001261.3	1.15	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	1.14	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.12	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	1.11	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	1.11	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	1.09	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.71	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (24):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.61 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.83 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.38 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.50 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.21 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.35 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.49 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.78 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.71 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.62 out of 36.54

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.94 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.10 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.47 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.84 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.50 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.82 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 11.99 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.63 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.94 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 21, location 1993619 - 2061225:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Val) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 22, location 1993619 - 2052375:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Val) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 23, location 2017778 - 2061225:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Val) + (ccmal) + (Asn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A4R25_RS08275: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (496..901): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

A4R25_RS08280: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (454..842): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTGGKVVIGGEINEYGPTEATVGCVA
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (85% 8Å match); OH-Asn or Asn DLTKVGEVGK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

A4R25_RS08295: mal

PKS_AT (535..820): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 163.8
inactive: 101.8
Methoxymalonyl-CoA: 66.4
Methylmalonyl-CoA: 59.9
Propionyl-CoA: 43.2
Isobutyryl-CoA: 35.4
Ethylmalonyl-CoA: 31.9
Benzoyl-CoA: 30.7
Acetyl-CoA: 28.2
CHC-CoA: 28.1
2-Methylbutyryl-CoA: 23.3
fatty_acid: 20.8
trans-1,2-CPDA: 15.8
3-Methylbutyryl-CoA: 12.3

A4R25_RS08300: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (27..410): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FGVAFDAATMDVFILCGGELNGYGPTETTVLAVT
Nearest Stachelhaus code(s):: Val DAMFVGGVFK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

A4R25_RS08315: X

AMP-binding (12..389): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VNQAFDAAIPDPHCLLGGEVNGYGATEMTFAARH
Nearest Stachelhaus code(s):: Leu or Val DAIALGGCAK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
MexT	Global virulence regulator

NZ_BBVA01000002.1 - Region 13 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 2,121,012 - 2,142,055 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

A4R25_RS08815: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002219.2	0.40	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002447.3	0.39	ribosomal	cerecyclin	Bacillus cereus
BGC0000487.5	0.38	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0000932.5	0.38	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0000646.5	0.38	terpene	β-carotein	uncultured bacterium
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002110.3	0.37	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0000488.4	0.36	ribosomal	circularin A	Clostridium beijerinckii
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002219.2	0.40	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002447.3	0.39	ribosomal	cerecyclin	Bacillus cereus
BGC0000487.5	0.38	ribosomal	carnocyclin	Carnobacterium maltaromaticum
BGC0000932.5	0.38	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0000646.5	0.38	terpene	β-carotein	uncultured bacterium
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002110.3	0.37	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0000488.4	0.36	ribosomal	circularin A	Clostridium beijerinckii
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

A4R25_RS08815: PT_FPPS_like

Domain 1 (49 - 317): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

NZ_BBVA01000002.1 - Region 14 - NRPS,NRPS-like,PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 2,142,541 - 2,210,506 nt. (total: 67,966 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: esterase

A4R25_RS09020: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

A4R25_RS08945: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

A4R25_RS08960: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

A4R25_RS08970: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS08975: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS08985: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A4R25_RS08990: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A4R25_RS09010: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	2.07	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	1.86	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	1.84	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	1.82	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.78	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.78	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	1.78	NRPS	peramine	Epichloe festucae
BGC0000342.4	1.74	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	1.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.50 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.43 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.66 out of 27.55

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.50 out of 29.72

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.87 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.92 out of 21.55

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.79 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 25, location 2142540 - 2210506:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 26, location 2142540 - 2183551:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 27, location 2145879 - 2201371:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 28, location 2163016 - 2205380:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 29, location 2167860 - 2210506:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X) + (X) + (ohmal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

A4R25_RS08970: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (462..863): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEHNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

A4R25_RS08975: mal

PKS_AT (530..813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Methylmalonyl-CoA: 58.3%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 124.2
Methoxymalonyl-CoA: 64.4
Methylmalonyl-CoA: 63.5
inactive: 57.7
Propionyl-CoA: 38.3
2-Methylbutyryl-CoA: 33.4
Benzoyl-CoA: 32.9
Ethylmalonyl-CoA: 32.5
CHC-CoA: 29.1
Isobutyryl-CoA: 28.2
Acetyl-CoA: 25.5
fatty_acid: 24.0
trans-1,2-CPDA: 16.3
3-Methylbutyryl-CoA: 14.9

A4R25_RS08985: X

AMP-binding (27..410): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: KSIAFDASVVDAVLVTGGEISVYGPTEATVLVTW
Nearest Stachelhaus code(s):: aIle DALVFGVVLK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

A4R25_RS08995: X

AMP-binding (163..559): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GNHTYDMAVTDGHSVLGGEVNGYGTTEISFAAQH
Nearest Stachelhaus code(s):: Glu DAMHVGGTAK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

A4R25_RS09010: X

AMP-binding (21..414): X

nrpys: Ser, Thr, Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGAFDASVHESHFLCGGEFNGYGPSETSINVSY
Nearest Stachelhaus code(s):: Leu or Phe DAIMLGGIAK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_BBVA01000002.1 - Region 15 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 2,388,486 - 2,414,946 nt. (total: 26,461 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

A4R25_RS09770: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

A4R25_RS09775: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Ligases: synthase

A4R25_RS09810: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

Translocases: permease

A4R25_RS09760: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000544.4	0.46	ribosomal	planosporicin	Planomonospora alba
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.38	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001967.4	0.30	NRPS, PKS	acyldepsipeptide 1	Streptomyces hawaiiensis
BGC0000796.3	0.28	saccharide	S-layer glycan	Paenibacillus alvei
BGC0002448.2	0.27	NRPS	Q6402A	Streptomyces violaceusniger

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000544.4	0.46	ribosomal	planosporicin	Planomonospora alba
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.38	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.36	ribosomal	microbisporicin A2	Microbispora corallina
BGC0001967.4	0.30	NRPS, PKS	acyldepsipeptide 1	Streptomyces hawaiiensis
BGC0000796.3	0.28	saccharide	S-layer glycan	Paenibacillus alvei
BGC0002448.2	0.27	NRPS	Q6402A	Streptomyces violaceusniger

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.59 out of 27.18

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.28 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.69 out of 30.98

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 160 - 252; Score: 71.4

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NZ_BBVA01000003.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 436,512 - 477,558 nt. (total: 41,047 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A4R25_RS12090: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

A4R25_RS12145: Hydroxylation

MITE: MITE0000081Hydroxylation (identity: 77.50%)
smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: Prenylation aminotransferase methyltransferase

A4R25_RS12055: aminotransferase

smcogs: SMCOG1019: aminotransferase

A4R25_RS12150: methyltransferase

smcogs: SMCOG1089: methyltransferase

A4R25_RS12155: Prenylation

MITE: MITE0000083Prenylation (identity: 61.50%)

A4R25_RS12210: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deformylase

A4R25_RS12180: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Ligases: synthase

A4R25_RS12140: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002362.3	0.81	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001077.4	0.71	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001633.3	0.44	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000189.4	0.43	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002362.3	0.81	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0001077.4	0.71	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0000918.3	0.56	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0001633.3	0.44	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0001206.5	0.43	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000189.4	0.43	PKS	3-(2'-hydroxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-hydroxy-3'-oxo-4'-methylhexyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylpentyl)-indole, 3-(2'-acetoxy-3'-oxo-4'-methylhexyl)-indole	Xenorhabdus bovienii SS-2004
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002554.2	0.42	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0002584.2	0.41	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

Additional weak hits (10):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.57 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.36 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.39 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.38 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.38 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.63 out of 27.18

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.10 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBVA01000004.1 - Region 1 - triceptide

Download region GenBank file

Download region SVG

Location: 144,349 - 165,664 nt. (total: 21,316 nt) Show pHMM detection rules used

triceptide: ((cds(PF04055 and (TIGR04085 or SPASM)) and triceptide_precursor) or triceptide_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000907.5	0.22	other (other)	lincomycin	Streptomyces lincolnensis
BGC0001782.3	0.21	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0002426.3	0.20	NRPS	deschlorosvetamycin A, svetamycin H, svetamycin A	Streptomyces sp.
BGC0001048.5	0.19	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000907.5	0.22	other (other)	lincomycin	Streptomyces lincolnensis
BGC0001782.3	0.21	other (other)	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0002426.3	0.20	NRPS	deschlorosvetamycin A, svetamycin H, svetamycin A	Streptomyces sp.
BGC0001048.5	0.19	NRPS, PKS, saccharide	tallysomycin A, tallysomycin B	Streptoalloteichus hindustanus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.91 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

Additional weak hits (2):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.93 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.11 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism

NZ_BBVA01000005.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 36,149 - 48,920 nt. (total: 12,772 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

A4R25_RS16510: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

A4R25_RS16515: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

A4R25_RS16525: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: peptidase

A4R25_RS16520: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002436.2	0.37	other (other)	coformycin	Streptomyces citricolor
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0002083.3	0.31	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0002169.3	0.31	NRPS, PKS	acurin A	Aspergillus aculeatus ATCC 16872
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001006.5	0.30	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001379.5	0.28	NRPS	BD-12	Streptomyces luteocolor
BGC0000806.5	0.28	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002436.2	0.37	other (other)	coformycin	Streptomyces citricolor
BGC0001739.3	0.33	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001007.5	0.31	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin b	Salinispora arenicola CNS-205
BGC0002083.3	0.31	PKS	gladiofungin A, gladiofungin B	Burkholderia gladioli
BGC0002169.3	0.31	NRPS, PKS	acurin A	Aspergillus aculeatus ATCC 16872
BGC0002285.2	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001006.5	0.30	NRPS, PKS	lymphostin, neolymphostinol B, lymphostinol, neolymphostin B	Salinispora tropica CNB-440
BGC0001379.5	0.28	NRPS	BD-12	Streptomyces luteocolor
BGC0000806.5	0.28	saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

Additional weak hits (1):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.02 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBVA01000005.1 - Region 2 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 107,727 - 129,845 nt. (total: 22,119 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

A4R25_RS16815: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Ligases: ligase

A4R25_RS16825: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A4R25_RS16860: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A4R25_RS16885: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.60	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000567.3	0.47	ribosomal	trifolitoxin	Rhizobium leguminosarum
BGC0000351.5	0.43	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0001137.5	0.43	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0000353.5	0.41	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0001806.4	0.40	NRPS	tolaasin A	Pseudomonas tolaasii
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0001222.3	0.39	ribosomal	acidocin B	Lactobacillus acidophilus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.60	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000567.3	0.47	ribosomal	trifolitoxin	Rhizobium leguminosarum
BGC0000351.5	0.43	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0001137.5	0.43	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0000353.5	0.41	NRPS	tacrolimus	Streptomyces sp. MA6548
BGC0001806.4	0.40	NRPS	tolaasin A	Pseudomonas tolaasii
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0001222.3	0.39	ribosomal	acidocin B	Lactobacillus acidophilus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.65 out of 27.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.73 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.28 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.94 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.91 out of 20.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.87 out of 20.01

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description

Core peptide predictions

No core peptides found.

NZ_BBVA01000005.1 - Region 3 - T1PKS

Download region GenBank file

Download region SVG

Location: 145,570 - 191,341 nt. (total: 45,772 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

A4R25_RS17050: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

A4R25_RS17075: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: aminotransferase glycosyltransferase methyltransferase sulfhydrylase

A4R25_RS17010: methyltransferase

smcogs: SMCOG1089: methyltransferase

A4R25_RS17020: methyltransferase

smcogs: SMCOG1248: methyltransferase

A4R25_RS17030: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

A4R25_RS17040: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

A4R25_RS17060: methyltransferase

smcogs: SMCOG1089: methyltransferase

A4R25_RS17150: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

A4R25_RS17155: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Lyases: dehydratase

A4R25_RS17025: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

A4R25_RS17085: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002631.2	0.55	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002391.2	0.51	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000193.3	0.50	PKS	aclacinomycin	Streptomyces galilaeus
BGC0001817.5	0.50	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000898.5	0.49	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.70	PKS	esperamicin	Actinomadura verrucosospora
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.58	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002631.2	0.55	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002391.2	0.51	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000193.3	0.50	PKS	aclacinomycin	Streptomyces galilaeus
BGC0001817.5	0.50	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0000898.5	0.49	saccharide	desosamine, pikromycin, neomethymycin, narbomycin	Streptomyces venezuelae

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (17):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.38 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.90 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.54 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.19 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.61 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.75 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.24 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.33 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.48 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.68 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.60 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.28 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.88 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.42 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.34 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

A4R25_RS17085: mal

PKS_AT (611..841): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.7
Methoxymalonyl-CoA: 45.8
Methylmalonyl-CoA: 37.3
inactive: 29.6
Propionyl-CoA: 23.3
Isobutyryl-CoA: 17.6
Ethylmalonyl-CoA: 11.0
fatty_acid: 10.3
trans-1,2-CPDA: 6.2
CHC-CoA: 6.1
Benzoyl-CoA: 5.5
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBVA01000006.1 - Region 1 - NAGGN

Download region GenBank file

Download region SVG

Location: 293,849 - 308,661 nt. (total: 14,813 nt) Show pHMM detection rules used

NAGGN: ((TIGR03104 or cds(GATase_7 and Asn_synthase)) and TIGR03103 and (TIGR03106 or Peptidase_M42))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: sulfhydrylase

A4R25_RS19870: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: hydrolase

A4R25_RS19845: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Ligases: synthase

A4R25_RS19820: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.45	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001587.5	0.38	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001374.5	0.36	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000943.5	0.34	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000815.4	0.34	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0002568.2	0.34	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0000254.5	0.33	PKS	oxytetracycline	Streptomyces rimosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001880.3	0.45	ribosomal	scytodecamide	Scytonema sp. UIC 10036
BGC0000846.5	0.42	other (other)	tabtoxin	Pseudomonas syringae
BGC0000885.3	0.40	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001587.5	0.38	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001374.5	0.36	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000943.5	0.34	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000815.4	0.34	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0002568.2	0.34	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0000254.5	0.33	PKS	oxytetracycline	Streptomyces rimosus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.99 out of 23.43

Confidence: medium

Additional weak hits (4):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 27.04

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.55 out of 23.43

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.21 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBVA01000009.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 40,717 - 61,784 nt. (total: 21,068 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

A4R25_RS24125: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Ligases: synthetase

A4R25_RS24165: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0000643.3	0.34	terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.3	0.34	terpene	carotenoid	Brevundimonas sp. SD212
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.32	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0000644.3	0.31	terpene	carotenoid	Dietzia sp. CQ4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.39	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.38	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.35	terpene	raimonol	Streptomyces anulatus
BGC0000643.3	0.34	terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.3	0.34	terpene	carotenoid	Brevundimonas sp. SD212
BGC0001910.4	0.34	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.33	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.32	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.32	terpene	carotenoid	Streptomyces avermitilis
BGC0000644.3	0.31	terpene	carotenoid	Dietzia sp. CQ4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

A4R25_RS24165: PT_FPPS_like

Domain 1 (41 - 353): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.71 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.19 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_BBVA01000010.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 35,705 - 57,850 nt. (total: 22,146 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

A4R25_RS25535: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

A4R25_RS25560: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

A4R25_RS31590: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Hydrolases: deacetylase hydrolase

A4R25_RS25520: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

A4R25_RS25555: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: hydratase

A4R25_RS25565: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthetase

A4R25_RS25540: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.54	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000650.3	0.49	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.54	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0000649.3	0.52	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000650.3	0.49	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000648.3	0.49	terpene	carotenoid	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

A4R25_RS25540: PT_FPPS_like

Domain 1 (67 - 362): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

A4R25_RS25545: PT_phytoene_like

Domain 1 (5 - 288): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → diapophytoene; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.65 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (2):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.70 out of 36.53

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBVA01000010.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 131,435 - 152,400 nt. (total: 20,966 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A4R25_RS26050: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

A4R25_RS25975: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: cyclase

A4R25_RS26030: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: mutase

A4R25_RS25980: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

A4R25_RS26055: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.45	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.44	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000906.3	0.42	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.41	other (other)	heme D1	Heliobacillus mobilis
BGC0002148.2	0.40	other (other)	guanitoxin	Sphaerospermopsis torques-reginae ITEP-024
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002246.3	0.38	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0001151.5	0.37	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0001987.2	0.37	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000889.5	0.45	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.44	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000906.3	0.42	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.41	other (other)	heme D1	Heliobacillus mobilis
BGC0002148.2	0.40	other (other)	guanitoxin	Sphaerospermopsis torques-reginae ITEP-024
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002246.3	0.38	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4
BGC0002493.3	0.38	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0001151.5	0.37	other (non-nrp beta-lactam)	valclavam, (-)-2-(2-hydroxyethyl)clavam	Streptomyces antibioticus
BGC0001987.2	0.37	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

A4R25_RS26030: T1TS

Domain 1 (8 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.03 out of 23.43

Confidence: medium

Additional weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.98 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 39.62

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator

NZ_BBVA01000012.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 15,468 nt. (total: 15,468 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

A4R25_RS27295: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

A4R25_RS27300: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000514.5	0.42	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0001148.5	0.31	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0002805.2	0.29	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0002316.2	0.44	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001289.5	0.44	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000514.5	0.42	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0000544.4	0.42	ribosomal	planosporicin	Planomonospora alba
BGC0001148.5	0.31	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0002805.2	0.29	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (2):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.64 out of 32.74

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 26.85

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 151 - 238; Score: 47.9

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BBVA01000012.1 - Region 2 - azole-containing-RiPP,thioamitides

Download region GenBank file

Download region SVG

Location: 38,371 - 74,964 nt. (total: 36,594 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A4R25_RS27480: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.46	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002115.3	0.41	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002699.2	0.39	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001555.4	0.39	ribosomal	colicin V	Escherichia coli chi7122
BGC0002005.2	0.38	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000565.5	0.38	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.38	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0000590.5	0.38	ribosomal	microcin N	Escherichia coli
BGC0002485.2	0.37	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002115.3	0.53	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002699.2	0.52	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002698.2	0.52	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001555.4	0.51	ribosomal	colicin V	Escherichia coli chi7122
BGC0002005.2	0.51	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000565.5	0.51	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.51	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0000590.5	0.51	ribosomal	microcin N	Escherichia coli
BGC0002485.2	0.50	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.20 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.39 out of 30.11

Confidence: medium

Additional weak hits (13):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.25 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.61 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.49 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.51 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.18 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.69 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.83 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.84 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.12 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.47 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.56 out of 35.63

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: NHLP_CD_RRE; Location: 2 - 94; Score: 31.7
: RRE type: NHLP_CD_RRE; Location: 2 - 94; Score: 31.7

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor

Core peptide predictions

No core peptides found.

NZ_BBVA01000024.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 3,707 nt. (total: 3,707 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

A4R25_RS30380: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000393.5	0.52	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002749.2	0.49	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.48	PKS	curacin A	Moorea producens 19L

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0002171.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.59	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000393.5	0.52	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0002749.2	0.49	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0000043.5	0.48	PKS	curacin A	Moorea producens 19L

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

A4R25_RS30380: mal

PKS_AT (665..963): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.3
inactive: 99.3
Methoxymalonyl-CoA: 56.0
Methylmalonyl-CoA: 43.6
Propionyl-CoA: 28.1
Acetyl-CoA: 17.6
fatty_acid: 16.7
Ethylmalonyl-CoA: 16.2
Isobutyryl-CoA: 14.2
Benzoyl-CoA: 11.8
CHC-CoA: 4.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -0.8

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description