GCF_001570605.1 - 37 region(s)

Download region SVG

Location: 1 - 34,994 nt. (total: 34,994 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: esterase protease

AW270_RS00010: putative esterase

smcogs: SMCOG1104: putative esterase

AW270_RS00115: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase

AW270_RS00015: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS00020: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS00025: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.70 out of 27.18

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

Additional weak hits (15):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.26 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.50 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.44 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.59 out of 36.54

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.44 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.26 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.73 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.32 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.26 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.12 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.23 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.91 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.06 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 34994:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Asp)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS00020: X - X

AMP-binding (436..785): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGMTFDISAVELQAITAGEINGYGPTETTIYSTT
Nearest Stachelhaus code(s):: Ala DILQIGQIYK (79% 8Å match); Aol DIWFVAGIYK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1404..1744): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMAFDTHAEEPDLILGGEVNTYGPTEGTIIATA
Nearest Stachelhaus code(s):: Lys DTEDIGSVIK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AW270_RS00025: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (471..842): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQFDFGITVLKILLGGEVNHYGPTEATVGVTT
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (74% 8Å match); Asn DLTKLGEVGK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
NrdR	Represses ribonucleotide reductase encoding genes

NZ_BBXG01000001.1 - Region 2 - T1PKS

Download region SVG

Location: 134,851 - 338,419 nt. (total: 203,569 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AW270_RS00610: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AW270_RS00725: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acylase carboxylase transferase

AW270_RS00745: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AW270_RS00750: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

AW270_RS00755: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

AW270_RS40930: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

AW270_RS00720: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

AW270_RS00660: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW270_RS00680: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS00705: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS00780: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

AW270_RS40405: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS40890: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS40900: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS40905: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS40910: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS40935: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS41685: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS41690: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000166.5	0.65	PKS	tylactone	Streptomyces fradiae
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000018.5	0.64	PKS	angolamycin	Streptomyces eurythermus
BGC0001012.3	0.64	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000166.5	0.65	PKS	tylactone	Streptomyces fradiae
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000018.5	0.64	PKS	angolamycin	Streptomyces eurythermus
BGC0001012.3	0.64	NRPS, PKS	meridamycin	Streptomyces violaceusniger
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (29):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.72 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.39 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.85 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.58 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.53 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.20 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.27 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.23 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.49 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.57 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.94 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.26 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.04 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.88 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.68 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.64 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.01 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.56 out of 20.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 25.01 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.59 out of 33.14

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.37 out of 32.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.59 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 15.90 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.03 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 35.63

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.62 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 134850 - 338419:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (ohmal - redmal - ohmal - Me-ohmal - ohmal) + (ohmal - redmal - ohmal) + (Me-ohmal - ccmal - ccmal - ccmal) + (ccmal - ohmal - ohmal) + (pk - pk - ccmal) + (ohmal - Me-ohmal - Me-ohmal - ohmal) + (Me-ohmal - redmal - ohmal) + (ohmal - redmal - redmal) + (ccmal - ccmal) + (ohmal - Me-ohmal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS00660: mmal

PKS_AT (519..806): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 176.1
Ethylmalonyl-CoA: 158.7
Methoxymalonyl-CoA: 143.0
2-Methylbutyryl-CoA: 101.7
trans-1,2-CPDA: 95.9
Propionyl-CoA: 91.4
Malonyl-CoA: 90.3
CHC-CoA: 80.8
Isobutyryl-CoA: 66.2
Acetyl-CoA: 49.4
Benzoyl-CoA: 35.2
3-Methylbutyryl-CoA: 30.9
fatty_acid: 16.9
inactive: 15.5

AW270_RS40890: mal - mal - mal - mmal - mal

PKS_AT (625..886): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.5
inactive: 96.4
Methoxymalonyl-CoA: 48.7
Methylmalonyl-CoA: 32.2
Acetyl-CoA: 14.2
Isobutyryl-CoA: 12.0
trans-1,2-CPDA: 10.7
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (2105..2355): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 183.5
inactive: 92.1
Methoxymalonyl-CoA: 58.0
Methylmalonyl-CoA: 45.6
Acetyl-CoA: 20.4
Benzoyl-CoA: 18.6
Ethylmalonyl-CoA: 16.0
Isobutyryl-CoA: 15.1
trans-1,2-CPDA: 14.3
Propionyl-CoA: 13.2
CHC-CoA: 12.3
fatty_acid: 9.9
2-Methylbutyryl-CoA: 2.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (3927..4193): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.7
inactive: 75.7
Methoxymalonyl-CoA: 53.5
Methylmalonyl-CoA: 40.8
Isobutyryl-CoA: 24.0
Acetyl-CoA: 19.7
Benzoyl-CoA: 19.4
Ethylmalonyl-CoA: 16.0
Propionyl-CoA: 15.2
trans-1,2-CPDA: 9.3
2-Methylbutyryl-CoA: 7.9
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5247..5532): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.8
Ethylmalonyl-CoA: 206.2
Methoxymalonyl-CoA: 168.5
2-Methylbutyryl-CoA: 143.9
trans-1,2-CPDA: 133.2
Propionyl-CoA: 110.2
CHC-CoA: 98.5
Malonyl-CoA: 97.2
Isobutyryl-CoA: 62.5
Benzoyl-CoA: 47.9
Acetyl-CoA: 47.4
3-Methylbutyryl-CoA: 44.6
fatty_acid: 28.1
inactive: 23.4

PKS_AT (6642..6909): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.8
inactive: 81.3
Methoxymalonyl-CoA: 55.1
Methylmalonyl-CoA: 45.7
Propionyl-CoA: 20.2
Acetyl-CoA: 17.1
Isobutyryl-CoA: 14.8
Benzoyl-CoA: 13.4
fatty_acid: 10.3
trans-1,2-CPDA: 9.9
2-Methylbutyryl-CoA: 8.1
CHC-CoA: 7.5
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -3.9

AW270_RS40900: mal - mal - mal

PKS_AT (593..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.5
inactive: 100.4
Methoxymalonyl-CoA: 52.3
Methylmalonyl-CoA: 36.9
Acetyl-CoA: 17.4
Isobutyryl-CoA: 13.8
trans-1,2-CPDA: 11.8
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (2032..2282): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 184.6
inactive: 92.2
Methoxymalonyl-CoA: 58.1
Methylmalonyl-CoA: 46.2
Acetyl-CoA: 21.5
Benzoyl-CoA: 18.5
Ethylmalonyl-CoA: 16.6
CHC-CoA: 15.3
Isobutyryl-CoA: 15.2
trans-1,2-CPDA: 14.3
Propionyl-CoA: 14.1
fatty_acid: 9.9
2-Methylbutyryl-CoA: 2.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (3908..4167): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 191.6
inactive: 94.4
Methoxymalonyl-CoA: 59.0
Methylmalonyl-CoA: 46.6
Ethylmalonyl-CoA: 26.8
Benzoyl-CoA: 22.6
Isobutyryl-CoA: 20.2
Acetyl-CoA: 18.3
trans-1,2-CPDA: 16.5
fatty_acid: 15.1
Propionyl-CoA: 12.6
CHC-CoA: 8.3
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -1.3

AW270_RS40905: mmal - mal - mal - mal

PKS_AT (540..821): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 186.5
Ethylmalonyl-CoA: 166.9
Methoxymalonyl-CoA: 158.6
2-Methylbutyryl-CoA: 129.5
Malonyl-CoA: 112.1
trans-1,2-CPDA: 104.7
Propionyl-CoA: 102.6
CHC-CoA: 78.3
Isobutyryl-CoA: 56.0
Acetyl-CoA: 36.3
inactive: 31.9
Benzoyl-CoA: 29.9
3-Methylbutyryl-CoA: 29.3
fatty_acid: 20.7

PKS_AT (1985..2253): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.5
inactive: 76.6
Methoxymalonyl-CoA: 50.8
Methylmalonyl-CoA: 41.6
Benzoyl-CoA: 18.2
Acetyl-CoA: 17.8
Isobutyryl-CoA: 16.5
Ethylmalonyl-CoA: 15.9
Propionyl-CoA: 14.9
CHC-CoA: 13.2
2-Methylbutyryl-CoA: 9.4
trans-1,2-CPDA: 9.2
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3565..3895): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.1
inactive: 83.8
Methoxymalonyl-CoA: 56.1
Methylmalonyl-CoA: 47.1
Isobutyryl-CoA: 22.9
Acetyl-CoA: 18.2
Benzoyl-CoA: 17.2
Propionyl-CoA: 13.2
Ethylmalonyl-CoA: 8.7
fatty_acid: 8.0
2-Methylbutyryl-CoA: 7.6
CHC-CoA: 2.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5186..5477): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.8
inactive: 85.7
Methoxymalonyl-CoA: 60.2
Methylmalonyl-CoA: 58.6
Acetyl-CoA: 24.3
Isobutyryl-CoA: 23.9
Ethylmalonyl-CoA: 22.4
Benzoyl-CoA: 20.0
Propionyl-CoA: 12.8
trans-1,2-CPDA: 12.3
fatty_acid: 11.1
CHC-CoA: 9.1
2-Methylbutyryl-CoA: 7.0
3-Methylbutyryl-CoA: 0.0

AW270_RS00680: mal - mal - mal

PKS_AT (543..824): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.1
inactive: 76.5
Methoxymalonyl-CoA: 58.7
Methylmalonyl-CoA: 52.9
Acetyl-CoA: 22.7
Benzoyl-CoA: 21.1
Propionyl-CoA: 19.9
Ethylmalonyl-CoA: 19.9
Isobutyryl-CoA: 19.1
fatty_acid: 17.0
trans-1,2-CPDA: 16.1
2-Methylbutyryl-CoA: 11.4
CHC-CoA: 10.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (2138..2388): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.0
inactive: 85.8
Methoxymalonyl-CoA: 58.1
Methylmalonyl-CoA: 54.3
Isobutyryl-CoA: 20.0
Acetyl-CoA: 19.5
Propionyl-CoA: 17.4
Benzoyl-CoA: 16.5
trans-1,2-CPDA: 15.4
Ethylmalonyl-CoA: 14.3
2-Methylbutyryl-CoA: 9.5
fatty_acid: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3569..3834): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.0
inactive: 81.9
Methoxymalonyl-CoA: 53.7
Methylmalonyl-CoA: 44.4
Acetyl-CoA: 18.2
Isobutyryl-CoA: 16.7
Benzoyl-CoA: 14.4
Propionyl-CoA: 14.0
trans-1,2-CPDA: 13.2
Ethylmalonyl-CoA: 12.3
2-Methylbutyryl-CoA: 7.7
CHC-CoA: 7.2
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

AW270_RS40910: pk - pk - mal

PKS_AT (556..837): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 203.5
Methylmalonyl-CoA: 201.4
Methoxymalonyl-CoA: 167.5
2-Methylbutyryl-CoA: 150.5
trans-1,2-CPDA: 119.9
Propionyl-CoA: 113.4
CHC-CoA: 95.2
Malonyl-CoA: 94.3
Isobutyryl-CoA: 74.6
Benzoyl-CoA: 50.6
Acetyl-CoA: 48.7
3-Methylbutyryl-CoA: 40.7
fatty_acid: 24.7
inactive: 23.1

PKS_AT (2172..2457): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 207.9
Methylmalonyl-CoA: 207.0
Methoxymalonyl-CoA: 168.0
2-Methylbutyryl-CoA: 150.2
trans-1,2-CPDA: 136.3
Propionyl-CoA: 116.1
Malonyl-CoA: 100.8
CHC-CoA: 95.2
Isobutyryl-CoA: 67.3
Benzoyl-CoA: 51.6
Acetyl-CoA: 48.7
3-Methylbutyryl-CoA: 37.4
inactive: 25.0
fatty_acid: 24.4

PKS_AT (3595..3845): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 179.1
inactive: 72.3
Methoxymalonyl-CoA: 63.0
Methylmalonyl-CoA: 58.0
Ethylmalonyl-CoA: 24.1
Isobutyryl-CoA: 20.4
fatty_acid: 18.1
CHC-CoA: 17.8
Propionyl-CoA: 16.9
Acetyl-CoA: 16.6
trans-1,2-CPDA: 13.8
Benzoyl-CoA: 13.0
2-Methylbutyryl-CoA: 10.9
3-Methylbutyryl-CoA: 0.0

AW270_RS41685: mal - mmal - mmal - mal

PKS_AT (540..794): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 162.9
inactive: 67.4
Methoxymalonyl-CoA: 56.5
Methylmalonyl-CoA: 51.6
Ethylmalonyl-CoA: 28.1
Propionyl-CoA: 21.9
Isobutyryl-CoA: 21.3
trans-1,2-CPDA: 20.6
fatty_acid: 19.0
Benzoyl-CoA: 17.5
Acetyl-CoA: 15.0
CHC-CoA: 9.7
2-Methylbutyryl-CoA: 4.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (1934..2216): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.0
Ethylmalonyl-CoA: 198.5
Methoxymalonyl-CoA: 169.9
2-Methylbutyryl-CoA: 146.1
trans-1,2-CPDA: 119.5
Propionyl-CoA: 107.8
Malonyl-CoA: 98.1
CHC-CoA: 95.8
Isobutyryl-CoA: 73.7
Benzoyl-CoA: 66.9
Acetyl-CoA: 51.9
3-Methylbutyryl-CoA: 40.4
fatty_acid: 33.8
inactive: 22.3

PKS_AT (3373..3661): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.0
Ethylmalonyl-CoA: 200.8
Methoxymalonyl-CoA: 176.3
2-Methylbutyryl-CoA: 143.3
trans-1,2-CPDA: 115.5
Malonyl-CoA: 111.7
Propionyl-CoA: 109.0
CHC-CoA: 102.0
Isobutyryl-CoA: 98.6
Benzoyl-CoA: 69.8
3-Methylbutyryl-CoA: 65.2
Acetyl-CoA: 62.5
inactive: 35.2
fatty_acid: 34.0

PKS_AT (4827..5109): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.7
inactive: 127.9
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 46.7
Isobutyryl-CoA: 32.7
Propionyl-CoA: 18.6
Acetyl-CoA: 14.3
Benzoyl-CoA: 12.7
CHC-CoA: 4.5
Ethylmalonyl-CoA: 2.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

AW270_RS40930: mmal - mal - mal

PKS_AT (558..839): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 83.3%; Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 188.4
Ethylmalonyl-CoA: 172.3
Methoxymalonyl-CoA: 160.7
2-Methylbutyryl-CoA: 133.5
Malonyl-CoA: 113.8
trans-1,2-CPDA: 108.7
Propionyl-CoA: 106.9
CHC-CoA: 80.1
Isobutyryl-CoA: 56.9
Benzoyl-CoA: 39.2
Acetyl-CoA: 38.5
inactive: 32.0
3-Methylbutyryl-CoA: 29.9
fatty_acid: 19.1

PKS_AT (2034..2330): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 199.6
inactive: 91.1
Methoxymalonyl-CoA: 54.9
Methylmalonyl-CoA: 43.6
Benzoyl-CoA: 18.1
Acetyl-CoA: 18.0
Isobutyryl-CoA: 16.5
Ethylmalonyl-CoA: 15.8
CHC-CoA: 15.1
Propionyl-CoA: 13.0
2-Methylbutyryl-CoA: 9.1
trans-1,2-CPDA: 8.8
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (3972..4272): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.2
inactive: 80.6
Methoxymalonyl-CoA: 64.9
Methylmalonyl-CoA: 63.1
Acetyl-CoA: 23.7
Ethylmalonyl-CoA: 20.4
Benzoyl-CoA: 19.4
Isobutyryl-CoA: 17.6
Propionyl-CoA: 16.4
fatty_acid: 11.5
CHC-CoA: 11.3
trans-1,2-CPDA: 9.7
2-Methylbutyryl-CoA: 8.8
3-Methylbutyryl-CoA: 0.0

AW270_RS40935: mal - mal - mal

PKS_AT (546..838): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.8
inactive: 81.8
Methoxymalonyl-CoA: 65.1
Methylmalonyl-CoA: 59.2
Isobutyryl-CoA: 30.5
Propionyl-CoA: 29.3
Acetyl-CoA: 26.0
Ethylmalonyl-CoA: 21.2
Benzoyl-CoA: 19.5
2-Methylbutyryl-CoA: 16.3
fatty_acid: 9.9
CHC-CoA: 9.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1981..2245): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.2
inactive: 85.9
Methoxymalonyl-CoA: 57.1
Methylmalonyl-CoA: 45.2
Propionyl-CoA: 20.6
Ethylmalonyl-CoA: 18.4
Acetyl-CoA: 16.6
Benzoyl-CoA: 15.6
Isobutyryl-CoA: 14.6
3-Methylbutyryl-CoA: 8.3
fatty_acid: 7.9
2-Methylbutyryl-CoA: 7.8
CHC-CoA: 5.7
trans-1,2-CPDA: 0.0

PKS_AT (3899..4167): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.6
inactive: 95.5
Methoxymalonyl-CoA: 49.2
Methylmalonyl-CoA: 40.6
Benzoyl-CoA: 19.7
Acetyl-CoA: 19.3
Propionyl-CoA: 19.2
Isobutyryl-CoA: 17.2
Ethylmalonyl-CoA: 15.9
trans-1,2-CPDA: 10.3
2-Methylbutyryl-CoA: 7.8
CHC-CoA: 7.3
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

AW270_RS00705: mal - mal

PKS_AT (544..820): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 199.9
inactive: 83.5
Methoxymalonyl-CoA: 65.1
Methylmalonyl-CoA: 50.7
Isobutyryl-CoA: 24.7
Propionyl-CoA: 19.6
Benzoyl-CoA: 18.1
Acetyl-CoA: 16.2
Ethylmalonyl-CoA: 15.1
3-Methylbutyryl-CoA: 8.1
2-Methylbutyryl-CoA: 2.5
CHC-CoA: 2.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0

PKS_AT (2221..2496): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.6
inactive: 94.8
Methoxymalonyl-CoA: 63.9
Methylmalonyl-CoA: 50.3
Propionyl-CoA: 29.3
Isobutyryl-CoA: 20.3
Acetyl-CoA: 18.1
Benzoyl-CoA: 12.7
trans-1,2-CPDA: 12.1
Ethylmalonyl-CoA: 10.2
2-Methylbutyryl-CoA: 9.9
CHC-CoA: 8.5
3-Methylbutyryl-CoA: 8.3
fatty_acid: 0.0

AW270_RS40405: mal - mmal - mal

PKS_AT (627..887): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.2
inactive: 82.8
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 51.3
Isobutyryl-CoA: 35.6
Ethylmalonyl-CoA: 27.3
Benzoyl-CoA: 13.9
Acetyl-CoA: 12.7
trans-1,2-CPDA: 9.6
CHC-CoA: 8.3
Propionyl-CoA: 0.8
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -0.2

PKS_AT (2071..2356): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 202.1
Ethylmalonyl-CoA: 200.8
Methoxymalonyl-CoA: 164.4
2-Methylbutyryl-CoA: 131.5
trans-1,2-CPDA: 128.9
Propionyl-CoA: 100.1
CHC-CoA: 92.7
Malonyl-CoA: 89.2
Isobutyryl-CoA: 65.3
Benzoyl-CoA: 51.2
Acetyl-CoA: 40.0
inactive: 24.3
3-Methylbutyryl-CoA: 23.5
fatty_acid: 19.7

PKS_AT (3489..3738): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 171.7
inactive: 74.8
Methoxymalonyl-CoA: 66.6
Methylmalonyl-CoA: 53.6
Isobutyryl-CoA: 25.8
Ethylmalonyl-CoA: 21.7
Propionyl-CoA: 16.2
Acetyl-CoA: 15.8
Benzoyl-CoA: 14.6
fatty_acid: 14.1
2-Methylbutyryl-CoA: 11.3
CHC-CoA: 9.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

AW270_RS41690: mal

PKS_AT (547..813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 172.7
inactive: 93.2
Methoxymalonyl-CoA: 47.4
Methylmalonyl-CoA: 40.5
Acetyl-CoA: 21.5
Isobutyryl-CoA: 20.8
Propionyl-CoA: 10.5
Benzoyl-CoA: 9.7
fatty_acid: 9.0
CHC-CoA: 0.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -3.5

TFBS definitions

Regulator	Description

NZ_BBXG01000001.1 - Region 3 - NRP-metallophore,NRPS,RRE-containing,azole-containing-RiPP,terpene,terpene-precursor

Download region SVG

Location: 356,919 - 489,782 nt. (total: 132,864 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AW270_RS00990: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

AW270_RS01255: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

AW270_RS01310: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW270_RS01315: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW270_RS01365: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: acetyltransferase aminotransferase formyltransferase methyltransferase

AW270_RS00995: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

AW270_RS01020: methyltransferase

smcogs: SMCOG1089: methyltransferase

AW270_RS01040: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

AW270_RS01325: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: amidase dehalogenase glucosidase hydrolase

AW270_RS00975: amidase

smcogs: SMCOG1105: amidase

AW270_RS01110: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

AW270_RS01130: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AW270_RS01205: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase dehydratase

AW270_RS00885: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AW270_RS01165: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Isomerases: racemase

AW270_RS00880: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthetase

AW270_RS01395: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

AW270_RS01420: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000423.5	0.87	NRPS	scabichelin	Streptomyces scabiei 87.22
BGC0002135.2	0.84	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.70	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000423.5	0.76	NRPS	scabichelin	Streptomyces scabiei 87.22
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Terpene cluster 1 (421,451 - 443,605):

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

AW270_RS01165: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (330 - 680): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Terpene cluster 2 (468,747 - 489,782):

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AW270_RS01395: PT_FPPS_like

Domain 1 (53 - 322): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.87 out of 29.72

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.09 out of 26.85

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.11 out of 23.05

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.29 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.33 out of 23.79

Confidence: medium

Additional weak hits (47):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.38 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.97 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.88 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.31 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.96 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.04 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.91 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.21 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.89 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.45 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.87 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.24 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.08 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.35 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.85 out of 39.62

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.56 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.13 out of 23.43

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.91 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.21 out of 32.74

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.93 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.11 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.82 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.82 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.73 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.58 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.85 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.79 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.44 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.59 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.90 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.51 out of 26.06

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.33 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.58 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.56 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.33 out of 28.14

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.47 out of 33.14

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Terpene

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 3, location 356918 - 489782:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Fo-OH-Orn - Ser - NMe-OH-Orn - Orn - Ser - D-OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 356918 - 422939:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Fo-OH-Orn - Ser - NMe-OH-Orn - Orn - Ser - D-OH-Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS01020: Fo-OH-Orn - Ser - OH-Orn - Orn - Ser - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (167..557): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDVAFWDLILLAGTEFNAYGPTEATTNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWILGATNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1538..1935): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFSSGEHNLYGPTEAAVDVTF
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2557..2952): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3906..4268): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHAFDGSWEPWDLSVGGEHDLYGPTECAVDAYG
Nearest Stachelhaus code(s):: Orn DGEDAGLVDK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4868..5248): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFLCSGEHNLYGPTEASVDVTA
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5841..6212): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDASWQPWEVGVGGEVNLYGPTEATVDALV
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AW270_RS01420: X

AMP-binding (78..362): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AIRSYTGAGLANAATMIGG--------YGVAATP
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 3 - 83; Score: 71.9; RRE type: Heterocycloanthracin_C_RRE; Location: 16 - 93; Score: 27.7
: RRE type: Thiopeptide_F_RRE; Location: 3 - 83; Score: 71.9; RRE type: Heterocycloanthracin_C_RRE; Location: 16 - 93; Score: 27.7

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_BBXG01000002.1 - Region 1 - NRPS

Download region SVG

Location: 354,900 - 398,586 nt. (total: 43,687 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AW270_RS04255: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

AW270_RS04275: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: methyltransferase

AW270_RS04305: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

AW270_RS04365: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

AW270_RS04340: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

AW270_RS04315: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS04320: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS04325: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (12):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.81 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.34 out of 26.06

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.55 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.38 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.30 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.52 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.70 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.68 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.84 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

AW270_RS04320: X

AMP-binding (398..748): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSMASGLSALELQALIDGEVNVYGHTETTVWSTF
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AW270_RS04325: X

AMP-binding (17..382): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GPRFSNAGQN-VFVASTAAVNCYTSTEAAPAQTE
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BBXG01000003.1 - Region 1 - NRPS,lassopeptide,terpene

Download region SVG

Location: 124,617 - 192,505 nt. (total: 67,889 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AW270_RS06495: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

AW270_RS06655: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: glycosyltransferase kinase

AW270_RS06515: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

AW270_RS06575: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Hydrolases: hydrolase

AW270_RS06535: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase

AW270_RS06675: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

AW270_RS06570: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS06585: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.40	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.38	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001539.4	0.38	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001825.4	0.37	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001548.4	0.37	ribosomal	citrulassin A	Streptomyces albulus
BGC0001506.5	0.37	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001128.4	0.37	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002053.3	0.37	ribosomal	ulleungdin	Streptomyces sp.
BGC0001261.3	0.37	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AW270_RS06675: T1TS

Domain 1 (6 - 284): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

Additional weak hits (14):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.00 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.46 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.33 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.29 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.21 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.80 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.51 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.43 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.62 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.72 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 124616 - 192505:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 125375 - 175164:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS06570: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (446..826): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMSFDISALELQS--GGEVNVYGPTETTIWSTT
Nearest Stachelhaus code(s):: Gly DILQFGVIWK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW270_RS06585: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (470..834): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQFDFGVTVLKMILGGEVNHYGPTEATVGVTT
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 8 - 78; Score: 44.7

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BBXG01000003.1 - Region 2 - RRE-containing

Download region SVG

Location: 281,649 - 302,734 nt. (total: 21,086 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AW270_RS07115: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002317.2	0.49	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0000585.5	0.44	ribosomal	microcin C7	Escherichia coli
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000522.3	0.39	ribosomal	lacticin Z	Lactococcus lactis
BGC0000620.3	0.38	ribosomal	lacticin Q	Lactococcus lactis
BGC0001863.4	0.38	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000552.3	0.37	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0002144.3	0.36	ribosomal	phazolicin	Rhizobium sp. Pop5
BGC0000571.3	0.36	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001928.2	0.36	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002317.2	0.49	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0000585.5	0.44	ribosomal	microcin C7	Escherichia coli
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000522.3	0.39	ribosomal	lacticin Z	Lactococcus lactis
BGC0000620.3	0.38	ribosomal	lacticin Q	Lactococcus lactis
BGC0001863.4	0.38	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000552.3	0.37	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0002144.3	0.36	ribosomal	phazolicin	Rhizobium sp. Pop5
BGC0000571.3	0.36	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001928.2	0.36	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.86 out of 36.53

Confidence: medium

Additional weak hits (7):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.43 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.34 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.19 out of 23.43

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 93; Score: 59.8

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_BBXG01000003.1 - Region 3 - 2dos

Download region SVG

Location: 397,118 - 432,408 nt. (total: 35,291 nt) Show pHMM detection rules used

2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

AW270_RS07605: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

AW270_RS07610: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: aminotransferase transferase

AW270_RS07635: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AW270_RS07650: aminotransferase

smcogs: SMCOG1019: aminotransferase

AW270_RS07675: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: dehydratase hydratase

AW270_RS07630: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

AW270_RS07665: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: synthase

AW270_RS07730: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002439.3	0.51	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000701.5	0.46	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0001206.5	0.45	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002148.2	0.44	other (other)	guanitoxin	Sphaerospermopsis torques-reginae ITEP-024
BGC0000719.5	0.42	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.3	0.42	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000925.5	0.40	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0000897.5	0.39	other (other)	dehydrophos	Streptomyces luridus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002439.3	0.51	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000701.5	0.46	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0001206.5	0.45	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002148.2	0.44	other (other)	guanitoxin	Sphaerospermopsis torques-reginae ITEP-024
BGC0000719.5	0.42	saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.3	0.42	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000925.5	0.40	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0000897.5	0.39	other (other)	dehydrophos	Streptomyces luridus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (14):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.13 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.49 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.28 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.98 out of 39.62

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.92 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.34 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.64 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.33 out of 32.93

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.49 out of 25.88

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_BBXG01000004.1 - Region 1 - T1PKS,hydrogen-cyanide

Download region SVG

Location: 1 - 29,070 nt. (total: 29,070 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

AW270_RS08250: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AW270_RS41750: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: aminotransferase transketolase

AW270_RS08180: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AW270_RS08210: transketolase

smcogs: SMCOG1204: transketolase

Ligases: synthase

AW270_RS08175: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.33	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001160.5	0.26	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.26	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.24	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.24	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.24	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.24	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.24	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.23	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.23	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.57	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.57	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.45 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.77 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.44 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.56 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.07 out of 22.40

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

AW270_RS08175: mal

PKS_AT (538..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.5
inactive: 102.8
Methoxymalonyl-CoA: 79.0
Methylmalonyl-CoA: 68.5
Ethylmalonyl-CoA: 36.4
Propionyl-CoA: 33.5
Isobutyryl-CoA: 27.7
Benzoyl-CoA: 27.6
Acetyl-CoA: 23.2
2-Methylbutyryl-CoA: 19.6
trans-1,2-CPDA: 19.5
CHC-CoA: 17.9
fatty_acid: 13.7
3-Methylbutyryl-CoA: 8.3

TFBS definitions

Regulator	Description

NZ_BBXG01000004.1 - Region 2 - T3PKS

Download region SVG

Location: 56,368 - 97,411 nt. (total: 41,044 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AW270_RS08475: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

AW270_RS08535: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW270_RS08540: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW270_RS08555: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase methyltransferase sulfotransferase

AW270_RS08415: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

AW270_RS08440: aminotransferase

smcogs: SMCOG1019: aminotransferase

AW270_RS08470: methyltransferase

smcogs: SMCOG1248: methyltransferase

AW270_RS08480: Methylation

MITE: MITE0000155Methylation (identity: 74.00%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Lyases: hydratase

AW270_RS08405: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: mutase

AW270_RS08565: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

AW270_RS08450: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS08485: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.82	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001831.3	0.56	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001928.2	0.49	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000917.3	0.48	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000243.4	0.48	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001226.4	0.47	ribosomal	streptocollin	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.82	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001831.3	0.56	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002193.2	0.56	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000866.5	0.50	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001928.2	0.49	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000917.3	0.48	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000243.4	0.48	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0001226.4	0.47	ribosomal	streptocollin	Streptomyces collinus Tu 365

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.27 out of 23.79

Confidence: medium

Additional weak hits (10):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.29 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.78 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.88 out of 20.97

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.67 out of 29.51

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.90 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.08 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.61 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

AW270_RS08450: X

AMP-binding (22..476): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: EATLHIARVLSLFGMAAGLQAAYEAADAALLAVV
Nearest Stachelhaus code(s):: Trp GALFFAAGVK (29% 8Å match); Leu or Ile DALFMGATFK (24% 8Å match); Leu DALFMGAVAK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_BBXG01000004.1 - Region 3 - RiPP-like

Download region SVG

Location: 203,981 - 214,436 nt. (total: 10,456 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001725.3	0.41	other (other)	oxetanocin A	Bacillus megaterium
BGC0002318.2	0.38	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000496.5	0.37	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000553.3	0.35	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000503.5	0.34	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001561.4	0.34	NRPS	curacomycin	Streptomyces curacoi
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000546.3	0.33	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001725.3	0.41	other (other)	oxetanocin A	Bacillus megaterium
BGC0002318.2	0.38	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000496.5	0.37	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001364.3	0.37	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000553.3	0.35	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000503.5	0.34	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001561.4	0.34	NRPS	curacomycin	Streptomyces curacoi
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000546.3	0.33	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.41 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.41 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.91 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BBXG01000004.1 - Region 4 - NRPS,T1PKS

Download region SVG

Location: 225,920 - 276,320 nt. (total: 50,401 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

AW270_RS09220: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

AW270_RS09250: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

AW270_RS09285: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW270_RS09355: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AW270_RS09370: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

AW270_RS09395: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: hydrolase

AW270_RS09205: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: hydratase

AW270_RS09330: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: synthase

AW270_RS09295: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000894.4	0.37	other (other)	citrinin	Monascus aurantiacus
BGC0002147.2	0.31	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0001928.2	0.30	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000528.5	0.30	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002158.2	0.30	NRPS, PKS	tenuazonic acid	Pyricularia oryzae 70-15
BGC0001585.3	0.29	other (other)	melinacidin IV	Escovopsis weberi
BGC0001480.3	0.28	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0000393.5	0.28	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000894.4	0.51	other (other)	citrinin	Monascus aurantiacus
BGC0002147.2	0.46	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0001928.2	0.45	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000528.5	0.45	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002158.2	0.45	NRPS, PKS	tenuazonic acid	Pyricularia oryzae 70-15
BGC0001585.3	0.45	other (other)	melinacidin IV	Escovopsis weberi
BGC0001480.3	0.44	other (other)	tundrenone	Methylobacter tundripaludum 21/22
BGC0000393.5	0.44	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.14 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (23):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.56 out of 39.62

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.22 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.59 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.76 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.72 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.75 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.63 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.19 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.28 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.52 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.11 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.90 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.94 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.49 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 24.05 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.02 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.92 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.31 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.75 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.31 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 225919 - 276320:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - ohmal - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS09295: NH2 - mal - X

CAL_domain (127..423): NH2

minowa: NH2

Prediction, score:

NH2: 36.5
fatty_acid: 35.9
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1082..1344): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 66.7%; Ethylmalonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 108.1
Methoxymalonyl-CoA: 77.6
Methylmalonyl-CoA: 76.5
Ethylmalonyl-CoA: 58.8
inactive: 36.9
Propionyl-CoA: 28.4
fatty_acid: 27.9
trans-1,2-CPDA: 22.3
2-Methylbutyryl-CoA: 21.8
CHC-CoA: 16.0
Isobutyryl-CoA: 12.2
Benzoyl-CoA: 9.7
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (2269..2621): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWAAFDASVRQASSHVGGEANLYGPTEATINATC
Nearest Stachelhaus code(s):: Gln DACSTGVINK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXG01000005.1 - Region 1 - NRPS

Download region SVG

Location: 9,045 - 54,348 nt. (total: 45,304 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AW270_RS11160: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

AW270_RS11200: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

AW270_RS11265: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: glycosyltransferase

AW270_RS11205: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

AW270_RS11220: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Ligases: ligase synthase

AW270_RS11210: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS11230: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Translocases: transporter

AW270_RS11165: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.51 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.52 out of 39.62

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.70 out of 30.12

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 9044 - 54348:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS11210: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (495..876): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWAGFDLVVPNAKLVVAGEINEYGPTEATVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (74% 8Å match); Asn DLTKVGEVGK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

NZ_BBXG01000005.1 - Region 2 - NRPS,terpene

Download region SVG

Location: 178,716 - 255,054 nt. (total: 76,339 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase reductase

AW270_RS11825: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

AW270_RS11955: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AW270_RS12055: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: aminotransferase glycosyltransferase kinase methyltransferase

AW270_RS11905: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

AW270_RS12000: aminotransferase

smcogs: SMCOG1019: aminotransferase

AW270_RS12050: methyltransferase

smcogs: SMCOG1089: methyltransferase

AW270_RS12115: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: esterase hydrolase

AW270_RS11945: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AW270_RS12040: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase lyase

AW270_RS11880: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

AW270_RS11975: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

AW270_RS11950: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS11960: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS11985: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AW270_RS12005: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS12015: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS12020: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS12025: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

AW270_RS11930: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.96	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.47	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002135.2	0.43	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.42	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.39	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.39	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.39	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.39	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.38	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.38	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.77	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH

Genes with terpene domains:

AW270_RS11880: T1TS + T1TS

Domain 1 (1 - 320): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (371 - 619): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.25 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.25 out of 20.97

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

Additional weak hits (9):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.41 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.42 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.79 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.69 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.37 out of 36.54

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.25 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 178715 - 255054:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (Tyr) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 185999 - 255054:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (Tyr) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS11950: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (957..1330): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEANLYGPTEAAVDVTS
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AW270_RS11960: Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (20..380): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: AARFFDGAMTPGLTICAGECNEYGPTECTIWATY
Nearest Stachelhaus code(s):: His DSALIAEVWK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

AW270_RS12005: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (10..388): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HTQAFDSFIDQPDCVFGGEVSVYGATECSIGSVE
Nearest Stachelhaus code(s):: Arg DAEDVGVIGK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

AW270_RS12015: X

AMP-binding (1101..1495): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWDNFDPSFLESGAISGGEINHYGPTEVNTASSH
Nearest Stachelhaus code(s):: Leu or Ile DALFIGGTFK (56% 8Å match); Val DALWIGGTFK (50% 8Å match)
Stachelhaus code match:: 60% (weak)

AW270_RS12020: X

AMP-binding (9..388): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FYLAFDPSVHDLYSMFAGEDNIYGPTELAACCDY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AW270_RS12025: X

AMP-binding (535..933): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RFMTFDDSALEWQVVSSGEDNTWGATEVSIDSTT
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (59% 8Å match); Gly DILQVGMIWK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXG01000005.1 - Region 3 - RiPP-like

Download region SVG

Location: 348,193 - 360,106 nt. (total: 11,914 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AW270_RS12635: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.53	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000521.3	0.38	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.53	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000521.3	0.38	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 27.36 out of 32.74

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 28.06 out of 32.74

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (8):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.12 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.64 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.56 out of 29.38

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 25.46 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 24.53 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.66 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 25.46 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.52 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CatR	H2O2-responsive repressor
FuR variant 2	Ferric Uptake Regulator

NZ_BBXG01000006.1 - Region 1 - NRPS

Download region SVG

Location: 25,923 - 70,959 nt. (total: 45,037 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW270_RS12985: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase synthase

AW270_RS12925: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS12935: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS12940: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS12945: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS39845: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Translocases: transporter

AW270_RS12905: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002174.2	0.61	NRPS	ε-Poly-L-lysine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002174.2	0.61	NRPS	ε-Poly-L-lysine	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

Additional weak hits (23):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.76 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.01 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.51 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.00 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.49 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.26 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.61 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.11 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.07 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.46 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.24 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.68 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.27 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.49 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.58 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.16 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.73 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.06 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 25922 - 70959:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS12935: X

AMP-binding (443..807): X

nrpys: Asp, Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YDAQFDFGITVLKLIFGGEVNHYGPTEAIVGVST
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (65% 8Å match); Asn DFTKIGEVGK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW270_RS12940: X

AMP-binding (8..369): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDPFTNAGQMMNFLGSAAATNYYTSTEAAPAQTI
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXG01000006.1 - Region 2 - terpene

Download region SVG

Location: 347,559 - 368,464 nt. (total: 20,906 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

AW270_RS14415: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.37	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000583.5	0.35	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001920.4	0.33	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.33	ribosomal	MS-271	Streptomyces mirabilis
BGC0000885.3	0.33	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002318.2	0.32	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001374.5	0.32	other (other)	thienodolin	Streptomyces albogriseolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.37	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000583.5	0.35	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001920.4	0.33	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.33	ribosomal	MS-271	Streptomyces mirabilis
BGC0000885.3	0.33	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002318.2	0.32	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001374.5	0.32	other (other)	thienodolin	Streptomyces albogriseolus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AW270_RS14415: T1TS

Domain 1 (63 - 300): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 27.36 out of 35.63

Confidence: medium

Additional weak hits (5):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.16 out of 27.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.00 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.10 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.73 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
NrtR	NAD synthesis repressor

NZ_BBXG01000007.1 - Region 1 - lanthipeptide-class-iii

BGC0002110.3 (QKV49893.1):

Download region SVG

Location: 162,836 - 185,346 nt. (total: 22,511 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase

AW270_RS15270: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Translocases: transporter

AW270_RS15290: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.64	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000546.3	0.46	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.64	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000546.3	0.46	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AW270_RS15320

AW270_RS38750

Leader:

MVLLDLQAMELPGGGH

Core:

PGGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

Core with dehydrations:

PGGGGHGGGGDhaDhbLDhbLLGCysADhaQDhbPDhaNLDhaLLLCysH

antiSMASH-DB 4.0 matches for AW270_RS38750

100.0%

NZ_BBXE01000034.1and 2 others:

NZ_BBXG01000007.1 Lanthipeptides: AW270_RS38750_lanthipeptideNZ_WXEW01000008.1 Lanthipeptides: GT755_RS26540_lanthipeptide

Lanthipeptides: AW273_RS37520_lanthipeptide

1

PGGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

32

PGGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

1

PGGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

32

93.9%

NZ_BBXC01000011.1and 1 other:

NZ_BBXF01000002.1 Lanthipeptides: AW274_RS40200_lanthipeptide

Lanthipeptides: AW271_RS39780_lanthipeptide

2

GGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

3

GGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

33

93.8%

NZ_BBXD01000008.1:

Lanthipeptides: AW272_RS41775_lanthipeptide

2

GGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGG GGGGSTLTLLGCASQTPSNLSLLLCH

1

GGGGGGGGGSTLTLLGCASQTPSNLSLLLCH

31

with 85 more sequence matches

Only the first 10 are displayed here.

75.0%

NZ_SLWR01000003.1:

Lanthipeptides: EV646_RS09945_lanthipeptide

6

HGGGGSTLTLLGCASQTPSNLSLLLCH

32

H GGSTLT+LGCASQTPSNLSLLLCH

1

HHPGGSTLTVLGCASQTPSNLSLLLCH

27

75.0%

NZ_SOCE01000001.1:

Lanthipeptides: EV138_RS20105_lanthipeptide

6

HGGGGSTLTLLGCASQTPSNLSLLLCH

32

H GGGSTLT+LGCAS TPSNLSLLLCH

1

HHGGGSTLTVLGCASHTPSNLSLLLCH

27

71.9%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31645_lanthipeptide

7

GGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGGSTLT+LGCAS TPSNLSL+LCH

1

GGGGSTLTVLGCASVTPSNLSLILCH

26

71.9%

NZ_CP043661.1:

Lanthipeptides: F1D05_RS17325_lanthipeptide

8

GGGSTLTLLGCASQTPSNLSLLLCH

32

GGGSTLT+LGCAS TPSNLSLLLCH

2

GGGSTLTVLGCASHTPSNLSLLLCH

26

71.9%

NZ_SHKR01000011.1and 6 others:

NZ_SNWS01000006.1 Lanthipeptides: EV651_RS15130_lanthipeptideNZ_SODF01000002.1 Lanthipeptides: EV650_RS20180_lanthipeptideNZ_SODP01000004.1 Lanthipeptides: EV653_RS35635_lanthipeptideNZ_SODT01000012.1 Lanthipeptides: EV647_RS27100_lanthipeptideNZ_SODU01000003.1 Lanthipeptides: EV137_RS31660_lanthipeptideNZ_SZPZ01000003.1 Lanthipeptides: FDA38_RS24670_lanthipeptide

Lanthipeptides: EV645_RS10765_lanthipeptide

9

GGSTLTLLGCASQTPSNLSLLLCH

32

GGSTLT+LGCASQTPSNLSLLLCH

2

GGSTLTVLGCASQTPSNLSLLLCH

25

68.8%

NC_013595.1:

Lanthipeptides: SROS_RS48825_lanthipeptide

7

GGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGGSTLT+LGC S PSNLSLLLCH

1

GGGGSTLTVLGCESYKPSNLSLLLCH

26

68.8%

NC_013729.1:

Lanthipeptides: KFLA_RS37060_lanthipeptide

7

GGGGSTLTLLGCASQTPSNLSLLLCH

32

GGGGSTLT+LGC S PSNLSLLLCH

1

GGGGSTLTVLGCGSAKPSNLSLLLCH

26

68.8%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31650_lanthipeptide

8

GGGSTLTLLGCASQTPSNLSLLLCH

32

GGGSTLT+LGCAS TPSNLSL+LCH

1

GGGSTLTVLGCASVTPSNLSLVLCH

25

68.8%

NZ_JACDUR010000003.1and 1 other:

NZ_JACDUR010000003.1 Lanthipeptides: HNR30_RS17930_lanthipeptide

Lanthipeptides: HNR30_RS17930_lanthipeptide

8

GGGSTLTLLGCASQTPSNLSLLLCH

32

GGGSTLT+LGC S TPSNLSLLLCH

3

GGGSTLTVLGCNSYTPSNLSLLLCH

27

68.8%

NZ_JACHWA010000004.1and 1 other:

NZ_PVZV01000008.1 Lanthipeptides: C2865_RS30430_lanthipeptide

Lanthipeptides: FHS43_RS13815_lanthipeptide

8

GGGSTLTLLGCASQTPSNLSLLLCH

32

GGGSTLT+LGCAS PSNLSLLLCH

3

GGGSTLTVLGCASAKPSNLSLLLCH

27

MIBiG 4.0 matches for AW270_RS38750

18.8%

Lanthipeptide: birimositide

5

GHGGGGSTLT

14

G+ GG TLT

13

GNNGGWCTLT

22

12.5%

BGC0000581.6 (AAD28494.1):

Lasso peptide: microcin J25

2

GGGGH

6

GG GH

1

GGAGH

5

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.21 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.51 out of 26.85

Confidence: medium

Additional weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.74 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.00 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.25 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.59 out of 18.57

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.75 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.35 out of 33.14

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

AW270_RS38750 - Class III

Cleavage pHMM score: 6.10

RODEO score: 0

Monoisotopic mass: 2835.4 Da

Molecular weight: 2837.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2855.2 Da N = 1; 2873.2 Da N = 2; 2891.2 Da N = 3; 2909.2 Da N = 4; 2927.3 Da N = 5

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BBXG01000008.1 - Region 1 - NRPS

Download region SVG

Location: 170,550 - 214,263 nt. (total: 43,714 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

AW270_RS17765: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW270_RS17770: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW270_RS17825: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

AW270_RS17855: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase kinase methyltransferase sulfotransferase transketolase

AW270_RS17700: methyltransferase

smcogs: SMCOG1089: methyltransferase

AW270_RS17790: Sulfotransferase domain

extras: Sulfotransfer_5: Sulfotransferase domain

AW270_RS17805: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

AW270_RS17810: transketolase

smcogs: SMCOG1204: transketolase

AW270_RS17830: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

AW270_RS17845: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AW270_RS17865: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

Hydrolases: deacetylase

AW270_RS17780: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: lyase

AW270_RS17850: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

AW270_RS17775: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS17815: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

AW270_RS17870: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

AW270_RS17860: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001593.5	0.72	NRPS	Ficellomycin	Streptomyces ficellus
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001593.5	0.72	NRPS	Ficellomycin	Streptomyces ficellus
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

Additional weak hits (10):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.18 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.67 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.53 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.65 out of 39.62

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.89 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.35 out of 20.01

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.78 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 170549 - 214263:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS17775: X

AMP-binding (444..834): X

nrpys: dn-dohHep

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSTAFDVSVFESDLFVGGEFNGYGPTECTVTMIV
Nearest Stachelhaus code(s):: dn-dohHep DVFDFGGVTK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AW270_RS17870: X

AMP-binding (11..355): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWLGSMVVVDFLIIMVSGSYHGYGATEAGSISVL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXG01000008.1 - Region 2 - NRPS

Download region SVG

Location: 367,161 - 418,802 nt. (total: 51,642 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW270_RS18590: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

AW270_RS18655: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

AW270_RS18750: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: sulfotransferase

AW270_RS18670: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Ligases: ligase

AW270_RS18630: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS18640: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS18645: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS18650: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001050.5	0.71	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001050.5	0.71	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.04 out of 29.25

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.82 out of 24.78

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

Additional weak hits (31):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.76 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.84 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.45 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.57 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.55 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.64 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.87 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.45 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.93 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.13 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.56 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.71 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.42 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.70 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.50 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.43 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.27 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.73 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.14 out of 25.88

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.79 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.29 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.03 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.39 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.79 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.57 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.27 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 367160 - 418802:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Gly) + (Asp)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS18640: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (483..860): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQFDFGITVLKIILGGEVNHYGPTEATVGVTT
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW270_RS18645: Gly - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (15..393): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDISGLELQALVGGEINVYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1555..1920): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDISGLELQALVGGEVNVYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
SypG	Regulator of biofilm formation and host colonization

NZ_BBXG01000009.1 - Region 1 - darobactin

Download region SVG

Location: 44,061 - 65,200 nt. (total: 21,140 nt) Show pHMM detection rules used

darobactin: ((cds(PF04055 and (TIGR04085 or SPASM)) and darobactin_precursor) or darobactin_rSAM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase methyltransferase

AW270_RS19285: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

AW270_RS19315: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001735.5	0.33	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0001457.4	0.27	NRPS	jomthonic acid A, jomthonic acid B, jomthonic acid C	Streptomyces caniferus
BGC0000344.5	0.25	NRPS	entolysin	Pseudomonas entomophila L48
BGC0002541.2	0.19	other (other)	notonesomycin A	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001735.5	0.33	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0001457.4	0.27	NRPS	jomthonic acid A, jomthonic acid B, jomthonic acid C	Streptomyces caniferus
BGC0000344.5	0.25	NRPS	entolysin	Pseudomonas entomophila L48
BGC0002541.2	0.19	other (other)	notonesomycin A	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

Additional weak hits (4):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.89 out of 36.54

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.12 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.01 out of 29.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CRP	Cyclic AMP receptor protein

NZ_BBXG01000009.1 - Region 2 - terpene-precursor

Download region SVG

Location: 379,223 - 396,994 nt. (total: 17,772 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW270_RS20890: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: sulfhydrylase

AW270_RS20905: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: hydrolase

AW270_RS20875: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: synthetase

AW270_RS20895: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0000815.4	0.43	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000678.5	0.42	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.42	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000231.5	0.41	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0001529.5	0.39	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0000815.4	0.43	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000678.5	0.42	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.42	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002007.2	0.41	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000231.5	0.41	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0001529.5	0.39	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AW270_RS20895: PT_FPPS_like

Domain 1 (55 - 284): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.49 out of 29.65

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.28 out of 24.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.38 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.73 out of 26.85

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.07 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response

NZ_BBXG01000012.1 - Region 1 - PKS-like,T1PKS

Download region SVG

Location: 60,230 - 106,319 nt. (total: 46,090 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AW270_RS23360: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

AW270_RS23390: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase methyltransferase

AW270_RS23435: methyltransferase

smcogs: SMCOG1248: methyltransferase

AW270_RS23460: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: synthase

AW270_RS23465: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AW270_RS23475: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.57	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.55	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.54	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.53	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001257.3	0.53	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.29 out of 30.11

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.78 out of 28.19

Confidence: medium

Additional weak hits (24):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.51 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.40 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.27 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.46 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.70 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.20 out of 30.11

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.89 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.81 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.03 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.65 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.98 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.41 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.74 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.14 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.42 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.72 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 60229 - 106319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 60229 - 104009:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 64029 - 106319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS23460: pk

PKS_AT (529..819): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 126.9
Ethylmalonyl-CoA: 109.8
Methoxymalonyl-CoA: 100.9
Malonyl-CoA: 90.8
Isobutyryl-CoA: 67.6
Propionyl-CoA: 54.8
trans-1,2-CPDA: 54.0
2-Methylbutyryl-CoA: 51.8
Benzoyl-CoA: 35.7
Acetyl-CoA: 27.8
3-Methylbutyryl-CoA: 27.8
inactive: 23.3
fatty_acid: 23.2
CHC-CoA: 21.1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_BBXG01000013.1 - Region 1 - HR-T2PKS,T1PKS,t3nrps-iterative

Download region SVG

Location: 82,563 - 194,760 nt. (total: 112,198 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AW270_RS24510: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AW270_RS24520: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AW270_RS24525: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW270_RS24555: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AW270_RS24665: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW270_RS24680: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

AW270_RS24690: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW270_RS24710: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW270_RS24715: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase aminotransferase transferase

AW270_RS24480: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AW270_RS24565: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AW270_RS24615: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

AW270_RS24655: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AW270_RS24705: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: dehalogenase esterase hydrolase phosphatase

AW270_RS24560: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

AW270_RS24580: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AW270_RS24695: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

AW270_RS24700: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: decarboxylase dehydratase

AW270_RS24640: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

AW270_RS24765: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

AW270_RS24490: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

AW270_RS24545: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW270_RS24625: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS24635: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS24645: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS24660: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS24670: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS24675: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS24720: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.94	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.87	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.86	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.85	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.65	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001268.4	0.64	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.65 out of 26.85

Confidence: medium

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 31.71 out of 32.93

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.96 out of 29.72

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.55 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.85 out of 20.97

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.64 out of 25.88

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 29.40 out of 32.38

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (20):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.80 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.52 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.48 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.77 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.08 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.03 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.29 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.97 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.08 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.23 out of 32.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.47 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 82562 - 194760:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ccmal) + (ccmal) + (Me-ccmal) + (ohmal) + (ccmal - ohmal) + (ohmal)
Non-colinear ordering:: AW270_RS24655 + AW270_RS24660 + AW270_RS24665 + AW270_RS24670 + AW270_RS24675 + AW270_RS24720

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS24565: mal

PKS_AT (4..278): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 73.0
Methoxymalonyl-CoA: 33.8
inactive: 31.3
fatty_acid: 26.7
Methylmalonyl-CoA: 25.7
Isobutyryl-CoA: 21.5
Benzoyl-CoA: 19.6
Acetyl-CoA: 14.6
Ethylmalonyl-CoA: 13.3
Propionyl-CoA: 12.3
2-Methylbutyryl-CoA: 3.0
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AW270_RS24635: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (14..400): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSVLFDAGLSQTTCANTGGFLMYGLTEA-FRSTY
Nearest Stachelhaus code(s):: Asp DASTATMFRK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AW270_RS24655: mmal - mmal

PKS_AT (525..822): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 185.6
Ethylmalonyl-CoA: 166.9
Methoxymalonyl-CoA: 153.1
2-Methylbutyryl-CoA: 129.5
trans-1,2-CPDA: 127.0
Propionyl-CoA: 107.5
Malonyl-CoA: 104.2
CHC-CoA: 91.4
Isobutyryl-CoA: 58.5
Acetyl-CoA: 52.6
Benzoyl-CoA: 37.0
3-Methylbutyryl-CoA: 36.2
inactive: 25.4
fatty_acid: 22.1

PKS_AT (1507..1799): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 169.5
Ethylmalonyl-CoA: 165.3
Methoxymalonyl-CoA: 146.5
2-Methylbutyryl-CoA: 108.6
trans-1,2-CPDA: 91.3
Propionyl-CoA: 89.1
Malonyl-CoA: 85.8
CHC-CoA: 69.3
Benzoyl-CoA: 52.7
Isobutyryl-CoA: 44.7
Acetyl-CoA: 34.0
inactive: 28.0
3-Methylbutyryl-CoA: 25.9
fatty_acid: 20.1

AW270_RS24660: mal

PKS_AT (570..860): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 166.5
inactive: 79.7
Methoxymalonyl-CoA: 55.4
Methylmalonyl-CoA: 39.3
Acetyl-CoA: 24.6
Ethylmalonyl-CoA: 23.0
Isobutyryl-CoA: 17.1
CHC-CoA: 14.8
Benzoyl-CoA: 12.8
trans-1,2-CPDA: 11.9
Propionyl-CoA: 10.3
fatty_acid: 9.8
2-Methylbutyryl-CoA: 5.5
3-Methylbutyryl-CoA: 0.0

AW270_RS24665: mmal

PKS_AT (573..868): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 183.2
Ethylmalonyl-CoA: 169.4
Methoxymalonyl-CoA: 153.8
trans-1,2-CPDA: 105.2
2-Methylbutyryl-CoA: 98.7
Malonyl-CoA: 89.1
Propionyl-CoA: 87.4
CHC-CoA: 63.1
Benzoyl-CoA: 61.4
Isobutyryl-CoA: 51.3
Acetyl-CoA: 32.5
inactive: 31.2
fatty_acid: 24.1
3-Methylbutyryl-CoA: 18.5

AW270_RS24670: mal

PKS_AT (558..865): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 106.1
inactive: 61.2
Methoxymalonyl-CoA: 47.0
Methylmalonyl-CoA: 40.3
Propionyl-CoA: 23.1
2-Methylbutyryl-CoA: 9.9
fatty_acid: 9.1
Benzoyl-CoA: 3.3
Isobutyryl-CoA: 2.2
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AW270_RS24675: mal - mal

PKS_AT (531..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.2
inactive: 65.4
Methoxymalonyl-CoA: 50.9
Methylmalonyl-CoA: 40.2
Isobutyryl-CoA: 19.0
Propionyl-CoA: 15.9
Acetyl-CoA: 14.8
Benzoyl-CoA: 14.7
3-Methylbutyryl-CoA: 13.7
Ethylmalonyl-CoA: 12.0
fatty_acid: 6.2
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (2031..2331): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; 2-Rhyd-Malonyl-CoA: 66.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 127.4
inactive: 64.8
Methoxymalonyl-CoA: 55.1
Methylmalonyl-CoA: 43.2
Propionyl-CoA: 34.4
Isobutyryl-CoA: 12.2
2-Methylbutyryl-CoA: 11.8
fatty_acid: 10.4
CHC-CoA: 9.8
Ethylmalonyl-CoA: 8.8
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: -1.1

AW270_RS24720: mal

PKS_AT (542..845): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.7
inactive: 56.8
Methoxymalonyl-CoA: 53.3
Methylmalonyl-CoA: 37.1
Propionyl-CoA: 21.9
fatty_acid: 18.7
Isobutyryl-CoA: 18.6
Ethylmalonyl-CoA: 16.9
Benzoyl-CoA: 13.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
CsoR	Copper-responsive repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
PsrA	Oleic acid responsive regulator
RicR	Copper-responsive regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_BBXG01000015.1 - Region 1 - RiPP-like

Download region SVG

Location: 23,360 - 34,169 nt. (total: 10,810 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002152.2	0.35	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001321.3	0.23	terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0001322.3	0.19	terpene	lycosantalonol, β-phellandrene	Solanum lycopersicum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002152.2	0.35	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001321.3	0.23	terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0001322.3	0.19	terpene	lycosantalonol, β-phellandrene	Solanum lycopersicum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.86 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.82 out of 27.04

Confidence: medium

Additional weak hits (10):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.60 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.91 out of 27.04

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.37 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.42 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.23 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.43 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.74 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_BBXG01000016.1 - Region 1 - NRPS

Download region SVG

Location: 30,220 - 85,259 nt. (total: 55,040 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW270_RS27010: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

AW270_RS26950: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: glucosidase hydrolase

AW270_RS26895: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

AW270_RS26980: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase

AW270_RS26845: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase

AW270_RS26915: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW270_RS26920: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS26925: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS26940: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

AW270_RS26880: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0001251.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.69	NRPS	peramine	Epichloe festucae
BGC0001251.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (18):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.53 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.33 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.73 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.64 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.70 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.78 out of 23.43

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.19 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.92 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.84 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.92 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.72 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.74 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.48 out of 26.06

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.85 out of 27.18

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.32 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 30219 - 85259:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Gly) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS26915: X

AMP-binding (10..374): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHFTNAGQMMNFVSSSADVNYYTSTEAVPAQTT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AW270_RS26920: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (431..807): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LSITFDISGLELQALVGGEFNVYGPTETTIWSTI
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AW270_RS26925: X

AMP-binding (420..794): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMAFDAHVEEPDLILGGDVNTYGPTEATVIATA
Nearest Stachelhaus code(s):: Lys DAEDIGSVIK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW270_RS26940: X

AMP-binding (449..815): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAFPFDASVGDPDTMVGGEVNHYGPTEATVCATT
Nearest Stachelhaus code(s):: CysA DATKMGHVGK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXG01000016.1 - Region 2 - RiPP-like

Download region SVG

Location: 96,358 - 107,158 nt. (total: 10,801 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002425.3	0.37	ribosomal	stlassin	Streptomyces sp.
BGC0000515.4	0.35	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0001788.3	0.33	ribosomal	suicin 65	Streptococcus suis
BGC0000526.5	0.33	ribosomal	macedocin	Streptococcus macedonicus
BGC0002285.2	0.32	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000310.5	0.31	NRPS	bacitracin	Bacillus licheniformis
BGC0001561.4	0.30	NRPS	curacomycin	Streptomyces curacoi
BGC0000550.3	0.30	ribosomal	salivaricin G32	Streptococcus salivarius
BGC0002000.4	0.28	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000232.5	0.27	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002425.3	0.37	ribosomal	stlassin	Streptomyces sp.
BGC0000515.4	0.35	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0001788.3	0.33	ribosomal	suicin 65	Streptococcus suis
BGC0000526.5	0.33	ribosomal	macedocin	Streptococcus macedonicus
BGC0002285.2	0.32	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000310.5	0.31	NRPS	bacitracin	Bacillus licheniformis
BGC0001561.4	0.30	NRPS	curacomycin	Streptomyces curacoi
BGC0000550.3	0.30	ribosomal	salivaricin G32	Streptococcus salivarius
BGC0002000.4	0.28	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000232.5	0.27	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.16 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BBXG01000017.1 - Region 1 - terpene-precursor

Download region SVG

Location: 89,660 - 110,727 nt. (total: 21,068 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AW270_RS28045: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AW270_RS28050: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: phosphorylase

AW270_RS28060: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Ligases: synthetase

AW270_RS28065: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001521.3	0.41	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001521.3	0.41	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AW270_RS28065: PT_FPPS_like

Domain 1 (47 - 351): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.71 out of 25.88

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 27.42 out of 29.65

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.64 out of 24.78

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.21 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.82 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.01 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.63 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.03 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.38 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.73 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
PsrA	Oleic acid responsive regulator

NZ_BBXG01000018.1 - Region 1 - T1PKS

Download region SVG

Location: 24,824 - 90,312 nt. (total: 65,489 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW270_RS28720: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW270_RS28775: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: transferase

AW270_RS28755: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: decarboxylase

AW270_RS28600: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

AW270_RS41455: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS41475: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW270_RS41905: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW270_RS41910: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (23):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.00 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.06 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.76 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.19 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.54 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.15 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.54 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.66 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.66 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.35 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.52 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.81 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.02 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.72 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.72 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.04 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.30 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 24823 - 90312:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk - mal) + (ohmal) + (ccmal - Me-mal) + (ccmal)
Non-colinear ordering:: AW270_RS41455 + AW270_RS41905 + AW270_RS41475 + AW270_RS41910

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS41455: pk - mal

PKS_AT (531..820): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 211.6
Methylmalonyl-CoA: 206.9
Methoxymalonyl-CoA: 169.1
trans-1,2-CPDA: 127.7
2-Methylbutyryl-CoA: 126.1
Propionyl-CoA: 102.6
Malonyl-CoA: 97.3
CHC-CoA: 93.5
Isobutyryl-CoA: 64.6
Benzoyl-CoA: 57.8
Acetyl-CoA: 48.8
3-Methylbutyryl-CoA: 37.6
fatty_acid: 30.7
inactive: 24.1

PKS_AT (1503..1784): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.2
inactive: 94.6
Methoxymalonyl-CoA: 53.2
Methylmalonyl-CoA: 39.0
Propionyl-CoA: 28.5
Acetyl-CoA: 20.7
Ethylmalonyl-CoA: 20.4
Isobutyryl-CoA: 20.0
2-Methylbutyryl-CoA: 18.4
fatty_acid: 13.8
Benzoyl-CoA: 11.5
trans-1,2-CPDA: 8.5
CHC-CoA: 8.2
3-Methylbutyryl-CoA: 0.0

AW270_RS41905: mal

PKS_AT (555..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.2
inactive: 98.4
Methoxymalonyl-CoA: 68.8
Methylmalonyl-CoA: 64.4
Isobutyryl-CoA: 58.5
Propionyl-CoA: 45.8
Ethylmalonyl-CoA: 33.4
Acetyl-CoA: 26.4
Benzoyl-CoA: 22.6
2-Methylbutyryl-CoA: 21.5
fatty_acid: 18.8
trans-1,2-CPDA: 16.3
CHC-CoA: 11.6
3-Methylbutyryl-CoA: 0.0

AW270_RS41475: mal - mmal

PKS_AT (563..860): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.6
inactive: 96.9
Methoxymalonyl-CoA: 67.5
Methylmalonyl-CoA: 64.3
Isobutyryl-CoA: 51.0
Propionyl-CoA: 42.5
Ethylmalonyl-CoA: 33.0
Acetyl-CoA: 22.0
Benzoyl-CoA: 19.3
2-Methylbutyryl-CoA: 17.8
trans-1,2-CPDA: 13.9
fatty_acid: 13.9
CHC-CoA: 10.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (2312..2598): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 199.3
Ethylmalonyl-CoA: 184.5
Methoxymalonyl-CoA: 157.9
2-Methylbutyryl-CoA: 142.2
trans-1,2-CPDA: 110.1
Propionyl-CoA: 108.5
Malonyl-CoA: 94.9
CHC-CoA: 90.9
Isobutyryl-CoA: 75.6
Acetyl-CoA: 59.6
Benzoyl-CoA: 56.5
3-Methylbutyryl-CoA: 37.1
inactive: 28.2
fatty_acid: 19.7

AW270_RS41910: mal

PKS_AT (579..899): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 204.3
inactive: 98.4
Methoxymalonyl-CoA: 70.0
Methylmalonyl-CoA: 65.3
Propionyl-CoA: 43.0
Isobutyryl-CoA: 42.1
Ethylmalonyl-CoA: 37.6
Acetyl-CoA: 28.9
Benzoyl-CoA: 21.4
2-Methylbutyryl-CoA: 20.7
trans-1,2-CPDA: 18.0
fatty_acid: 15.8
CHC-CoA: 9.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_BBXG01000020.1 - Region 1 - terpene

Download region SVG

Location: 46,828 - 68,324 nt. (total: 21,497 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase

AW270_RS30245: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

AW270_RS30280: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: dehalogenase

AW270_RS30300: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: hydratase

AW270_RS30240: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: isomerase

AW270_RS30235: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000913.3	0.50	other (other)	MK-8	Enterobacter cloacae
BGC0001910.4	0.46	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000674.5	0.46	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.43	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002000.4	0.41	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002339.3	0.40	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0002805.2	0.40	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0002514.3	0.39	PKS	julichrome Q6.6	Streptomyces sampsonii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000913.3	0.50	other (other)	MK-8	Enterobacter cloacae
BGC0001910.4	0.46	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000674.5	0.46	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.43	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002000.4	0.41	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002339.3	0.40	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0002805.2	0.40	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0002514.3	0.39	PKS	julichrome Q6.6	Streptomyces sampsonii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

AW270_RS30270: T2TS

Domain 1 (3 - 487): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

Additional weak hits (6):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.34 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.20 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.22 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.96 out of 29.25

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.35 out of 23.43

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.24 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXG01000022.1 - Region 1 - NI-siderophore

Download region SVG

Location: 10,505 - 41,581 nt. (total: 31,077 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase protease

AW270_RS31495: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

AW270_RS31565: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: decarboxylase

AW270_RS31535: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000678.5	0.47	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000943.5	0.41	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002466.3	0.37	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002138.2	0.37	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0002313.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002387.2	0.33	PKS	yangpumicin A	Micromonospora yangpuensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000678.5	0.47	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000943.5	0.41	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002466.3	0.37	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002138.2	0.37	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0002313.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002387.2	0.33	PKS	yangpumicin A	Micromonospora yangpuensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.03 out of 36.53

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.19 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.45 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.18 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.82 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.73 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.63 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.27 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BBXG01000024.1 - Region 1 - azole-containing-RiPP,lanthipeptide-class-ii,terpene

Download region SVG

Location: 76,319 - 114,591 nt. (total: 38,273 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

AW270_RS33160: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

AW270_RS33110: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

AW270_RS33165: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002698.2	0.62	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000590.5	0.52	ribosomal	microcin N	Escherichia coli
BGC0002699.2	0.51	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001210.5	0.42	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000496.5	0.42	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000516.4	0.42	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0002306.2	0.41	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001229.4	0.39	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.67	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.63	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002698.2	0.58	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002699.2	0.55	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000565.5	0.54	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.54	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.53	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.51	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000528.5	0.51	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AW270_RS33110

allorf_100945_101025

Leader:

MTPRRTAELGRIRSG

Core:

HLDCSLPLVTN

Core with dehydrations:

HLDCysDhaLPLVDhbN

antiSMASH-DB 4.0 matches for allorf_100945_101025

100.0%

NZ_BBXG01000024.1:

Lanthipeptides: allorf_100945_101025_lanthipeptide

1

HLDCSLPLVTN

11

HLDCSLPLVTN

1

HLDCSLPLVTN

11

22.7%

NZ_CP096021.1:

Lanthipeptides: allorf_383169_383288_lanthipeptide

3

DCSLPL

8

DCSLP+

17

DCSLPV

22

allorf_100970_101080

Leader:

MDGSGAGIWTARSPLSQIENRRFGA

Core:

TATESIDICHS

Core with dehydrations:

DhbADhbEDhaIDICysHDha

antiSMASH-DB 4.0 matches for allorf_100970_101080

100.0%

NZ_BBXG01000024.1:

Lanthipeptides: allorf_100970_101080_lanthipeptide

1

TATESIDICHS

11

TATESIDICHS

1

TATESIDICHS

11

21.7%

NZ_FNIE01000004.1:

Lanthipeptides: allorf_383644_383832_lanthipeptide

1

TATESIDICH

10

+A + ID+CH

13

SALKRIDVCH

22

allorf_101043_101213

Leader:

MSASAGG

Core:

SALSAAAADNSPRRNQRRPAHRPGRAFFCLLRADVMIVMNGRCQLILLR

Core with dehydrations:

DhaALDhaAAAADNDhaPRRNQRRPAHRPGRAFFCysLLRADVMIVMNGRCysQLILLR

antiSMASH-DB 4.0 matches for allorf_101043_101213

100.0%

NZ_BBXG01000024.1:

Lanthipeptides: allorf_101043_101213_lanthipeptide

1

SALSAAAADNSPRRNQRRPAHRPGRAFFCLLRADVMIVMNGRCQLILLR

49

SALSAAAADNSPRRNQRRPAHRPGRAFFCLLRADVMIVMNGRCQLILLR

1

SALSAAAADNSPRRNQRRPAHRPGRAFFCLLRADVMIVMNGRCQLILLR

49

17.5%

NZ_BMUU01000006.1:

Lanthipeptides: IE233_RS19525_lanthipeptide

16

QRRPAHRPGRAFFCLLRADVMIVMN

40

Q AH PG A L++ V I +N

10

QGVAAHSPGVASGNLVQIPVHIPIN

34

14.3%

NZ_KB896392.1:

Lanthipeptides: allorf_126253_126339_lanthipeptide

17

RRPAHRPGRAFFCLLRADV

35

R P + GR + C DV

1

REPLDQTGRGWTCAAVVDV

19

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

AW270_RS33165: T1TS

Domain 1 (74 - 387): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.96 out of 29.25

Confidence: medium

Additional weak hits (17):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.67 out of 30.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.10 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.23 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.38 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.78 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.23 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.84 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.59 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.61 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.70 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.06 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.36 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.47 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.54 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.86 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.37 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Lanthipeptides

RREFinder

Terpene

TFBS Finder

Azole RiPPs

Core peptide predictions

allorf_100945_101025 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 1174.6 Da

Molecular weight: 1175.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1193.4 Da N = 1

allorf_100970_101080 - Class II

Cleavage pHMM score: -7.30

RODEO score: 0

Monoisotopic mass: 1103.5 Da

Molecular weight: 1104.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1122.2 Da N = 1; 1140.2 Da N = 2; 1158.2 Da N = 3

allorf_101043_101213 - Class II

Cleavage pHMM score: -5.50

RODEO score: 0

Monoisotopic mass: 5433.9 Da

Molecular weight: 5437.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 5455.4 Da N = 1

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 5 - 99; Score: 74.7; RRE type: NHLP_CD_RRE; Location: 2 - 96; Score: 70.2; RRE type: Cyanobactin_D_RRE; Location: 5 - 79; Score: 65.8
: RRE type: Goadsporin_CD_RRE; Location: 5 - 99; Score: 74.7; RRE type: NHLP_CD_RRE; Location: 2 - 96; Score: 70.2; RRE type: Cyanobactin_D_RRE; Location: 5 - 79; Score: 65.8

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
SypG	Regulator of biofilm formation and host colonization

Core peptide predictions

No core peptides found.

NZ_BBXG01000027.1 - Region 1 - oligosaccharide

Download region SVG

Location: 57,086 - 99,716 nt. (total: 42,631 nt) Show pHMM detection rules used

oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW270_RS34635: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase transferase

AW270_RS34665: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

AW270_RS34670: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

AW270_RS34740: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

AW270_RS34760: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001526.4	0.42	other (other)	bartoloside E, bartoloside F, bartoloside G, bartoloside H, bartoloside I, bartoloside J, bartoloside K	Synechocystis salina LEGE 06099
BGC0000918.3	0.40	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0000507.5	0.37	ribosomal	epicidin	Staphylococcus epidermidis
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002509.3	0.34	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0000509.4	0.32	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0002284.3	0.32	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000197.5	0.32	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000214.5	0.32	PKS	cosmomycin B	Streptomyces olindensis
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001526.4	0.42	other (other)	bartoloside E, bartoloside F, bartoloside G, bartoloside H, bartoloside I, bartoloside J, bartoloside K	Synechocystis salina LEGE 06099
BGC0000918.3	0.40	other (other)	ochronotic pigment	Streptomyces avermitilis
BGC0000507.5	0.37	ribosomal	epicidin	Staphylococcus epidermidis
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002509.3	0.34	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0000509.4	0.32	ribosomal	epilancin 15x	Staphylococcus epidermidis
BGC0002284.3	0.32	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000197.5	0.32	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000214.5	0.32	PKS	cosmomycin B	Streptomyces olindensis
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

Additional weak hits (11):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.82 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.74 out of 26.06

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.94 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.29 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.32 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.82 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.83 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor

NZ_BBXG01000029.1 - Region 1 - azole-containing-RiPP

Download region SVG

Location: 1 - 20,828 nt. (total: 20,828 nt) Show pHMM detection rules used

Region on contig edge.

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002551.2	0.48	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.47	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.47	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000475.5	0.44	ribosomal	patellamide A, patellamide C	Prochloron didemni
BGC0000480.5	0.44	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0002584.2	0.43	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000471.4	0.42	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000565.5	0.41	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001849.4	0.41	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0000477.3	0.41	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002551.2	0.48	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.47	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.47	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000475.5	0.44	ribosomal	patellamide A, patellamide C	Prochloron didemni
BGC0000480.5	0.44	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0002584.2	0.43	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000471.4	0.42	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000565.5	0.41	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001849.4	0.41	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0000477.3	0.41	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

Additional weak hits (14):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.92 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.16 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.53 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.16 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.03 out of 26.85

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.80 out of 30.11

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 25.75

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.03 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.65 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.96 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.55 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 2 - 96; Score: 69.3; RRE type: NHLP_CD_RRE; Location: 2 - 92; Score: 41.8; RRE type: Cyanobactin_D_RRE; Location: 2 - 56; Score: 31.8

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor

Core peptide predictions

No core peptides found.

NZ_BBXG01000029.1 - Region 2 - NRPS-like,benzoxazole

Download region SVG

Location: 24,622 - 70,269 nt. (total: 45,648 nt) Show pHMM detection rules used

benzoxazole: (ksIII and AMP-binding and PP-binding and Amidohydro_1)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

AW270_RS35580: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW270_RS35605: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

AW270_RS35625: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW270_RS35685: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase sulfotransferase transketolase

AW270_RS35575: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

AW270_RS35585: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

AW270_RS35610: transketolase

smcogs: SMCOG1204: transketolase

Hydrolases: back translocase hydrolase

AW270_RS35565: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

AW270_RS35690: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

AW270_RS35660: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

AW270_RS35695: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

AW270_RS35615: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

AW270_RS35620: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS35645: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AW270_RS35655: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW270_RS35665: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AW270_RS35670: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.77	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001444.5	0.76	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.57	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.57	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.55	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.55	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001444.5	0.70	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0002164.2	0.64	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (16):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.62 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.29 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.57 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.17 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.05 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.93 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.77 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.10 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.66 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.96 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.03 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.35 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 24621 - 70269:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS35620: X

AMP-binding (8..392): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MAQGQAGFTWNMMGATGSAYALWGMTENGCVTIT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AW270_RS35655: X

AMP-binding (138..527): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSMAYGMVEVESLLRICGEFNLYGSAEATVVATC
Nearest Stachelhaus code(s):: Boz GMVLRAVVVK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AW270_RS35670: X

AMP-binding (32..403): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: QTVLFTWGCPGGSVQIGGAQQVFGMAEGLLSMSR
Nearest Stachelhaus code(s):: Hpa TWPSQGVLCK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description

NZ_BBXG01000030.1 - Region 1 - azole-containing-RiPP,thioamitides

Download region SVG

Location: 28,900 - 57,090 nt. (total: 28,191 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AW270_RS35985: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AW270_RS36000: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: methyltransferase

AW270_RS35990: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: protease

AW270_RS36030: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: decarboxylase

AW270_RS35950: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.48	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.48	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001849.4	0.46	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002391.2	0.39	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002560.3	0.34	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001336.5	0.31	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001655.3	0.31	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0000902.4	0.31	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001579.4	0.30	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002120.3	0.30	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002391.2	0.52	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002560.3	0.48	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001336.5	0.46	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001655.3	0.46	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001579.4	0.45	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002120.3	0.45	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.38 out of 25.88

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.73 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.86 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.30 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.03 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.51 out of 29.65

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 3 - 87; Score: 37.6
: RRE type: Stand_Alone_Lasso_RRE; Location: 3 - 87; Score: 37.6

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
PsrA	Oleic acid responsive regulator

Core peptide predictions

No core peptides found.

NZ_BBXG01000031.1 - Region 1 - T1PKS

Download region SVG

Location: 40,789 - 77,876 nt. (total: 37,088 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AW270_RS36275: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AW270_RS36300: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

AW270_RS36320: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AW270_RS36335: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: acetyltransferase

AW270_RS36290: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Ligases: synthase

AW270_RS36355: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW270_RS36360: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (20):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.29 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.93 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.87 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.70 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.55 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.73 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.18 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.88 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.81 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.60 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.47 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.95 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.20 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.25 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.39 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.35 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.60 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.93 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 40788 - 77876:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (ccmal)
Non-colinear ordering:: AW270_RS36360 + AW270_RS36355

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AW270_RS36355: mal

PKS_AT (559..849): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.5
inactive: 83.7
Methoxymalonyl-CoA: 64.6
Methylmalonyl-CoA: 53.0
trans-1,2-CPDA: 29.5
Acetyl-CoA: 26.0
Isobutyryl-CoA: 21.5
Propionyl-CoA: 19.3
Benzoyl-CoA: 19.0
Ethylmalonyl-CoA: 11.1
CHC-CoA: 11.0
fatty_acid: 8.3
2-Methylbutyryl-CoA: 7.5
3-Methylbutyryl-CoA: 7.3

AW270_RS36360: mal - mal

PKS_AT (614..903): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 177.1
inactive: 81.8
Methoxymalonyl-CoA: 55.7
Methylmalonyl-CoA: 49.9
Isobutyryl-CoA: 29.7
Propionyl-CoA: 26.5
Acetyl-CoA: 21.2
Ethylmalonyl-CoA: 18.3
Benzoyl-CoA: 15.4
fatty_acid: 10.6
trans-1,2-CPDA: 9.9
CHC-CoA: 6.4
2-Methylbutyryl-CoA: 4.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (2314..2594): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; Propionyl-CoA: 54.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 173.6
inactive: 76.5
Methoxymalonyl-CoA: 72.8
Methylmalonyl-CoA: 65.1
Isobutyryl-CoA: 36.3
Propionyl-CoA: 30.5
Ethylmalonyl-CoA: 28.6
Benzoyl-CoA: 28.1
2-Methylbutyryl-CoA: 20.2
trans-1,2-CPDA: 16.9
CHC-CoA: 12.9
Acetyl-CoA: 11.4
3-Methylbutyryl-CoA: 10.3
fatty_acid: 10.1

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein

NZ_BBXG01000032.1 - Region 1 - thioamitides