GCF_001570545.1 - 40 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_BBXD01000008.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	terpene-precursor	545,144	566,076
Region 8.2	lanthipeptide-class-iii	866,981	889,530

NZ_BBXD01000009.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NRP-metallophore,NRPS	1	48,947	Medium	scabichelin	NRPS:Type I
Region 9.2	RRE-containing,azole-containing-RiPP	161,034	190,885
Region 9.3	NRPS	234,137	325,129
Region 9.4	terpene,NRPS	431,662	509,497	Medium	leupeptin Pr/leupeptin Ac	NRPS:Type I
Region 9.5	terpene-precursor	823,956	845,023

NZ_BBXD01000010.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	benzoxazole,NRPS-like	249,108	294,826	High	caboxamycin	other:shikimate-derived
Region 10.2	azole-containing-RiPP	311,744	335,174
Region 10.3	NRPS	358,308	413,311
Region 10.4	RiPP-like	427,750	438,550

NZ_BBXD01000011.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	T1PKS	49,862	122,995	Medium	abyssomicin C/atrop-abyssomicin C	PKS:Type I
Region 11.2	RRE-containing	495,544	516,626
Region 11.3	terpene,NRPS,lassopeptide	605,540	673,633

NZ_BBXD01000012.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	NRPS	168,349	213,499
Region 12.2	terpene	497,382	511,105

NZ_BBXD01000013.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	azole-containing-RiPP,thioamitides	26,247	54,554
Region 13.2	NRPS	391,889	430,095

NZ_BBXD01000014.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	NRPS,T1PKS	1	38,571
Region 14.2	terpene	369,295	390,353

NZ_BBXD01000015.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	hydrogen-cyanide	58,486	71,221	Low	aborycin	ribosomal:RiPP
Region 15.2	T3PKS	91,235	132,278	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 15.3	T1PKS	236,196	384,007	Medium	stambomycin A/stambomycin B/stambomycin C/stambomycin D	PKS:Type I+saccharide:hybrid/tailoring

NZ_BBXD01000017.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	T1PKS,t3nrps-iterative,HR-T2PKS	235,182	347,642	Low	butyrolactol A	PKS

NZ_BBXD01000018.1 (Herbidospora mongoliensis)

Region	Type	From	To
Region 18.1	T1PKS,NRPS	1	116,924
Region 18.2	terpene	141,732	162,289
Region 18.3	T1PKS	260,924	343,617

NZ_BBXD01000019.1 (Herbidospora mongoliensis)

Region	Type	From	To
Region 19.1	NI-siderophore	11,627	42,688
Region 19.2	lanthipeptide-class-v	96,205	139,339
Region 19.3	RiPP-like	172,873	183,694

NZ_BBXD01000020.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	NRPS	57,341	101,033	Medium	Ficellomycin	NRPS:Type I

NZ_BBXD01000023.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	terpene	84,305	105,801

NZ_BBXD01000024.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	NRPS	76,961	128,572

NZ_BBXD01000026.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 26.1	lanthipeptide-class-i	81,779	108,151

NZ_BBXD01000027.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 27.1	terpene-precursor	49,755	70,789
Region 27.2	terpene	89,387	111,540	High	geosmin	terpene:Sesquiterpene

NZ_BBXD01000030.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 30.1	terpene,lanthipeptide-class-ii,azole-containing-RiPP	24,760	66,370

NZ_BBXD01000031.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	PKS-like,T1PKS	37,916	84,009

NZ_BBXD01000032.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	T1PKS	21,479	43,462	Low	camporidine A/camporidine B	other:other+PKS

NZ_BBXD01000034.1 (Herbidospora mongoliensis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	terpene	24,582	44,216

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	terpene-precursor	545,144	566,076
Region 8.2	lanthipeptide-class-iii	866,981	889,530
Region 9.1	NRP-metallophore,NRPS	1	48,947	Medium	scabichelin	NRPS:Type I
Region 9.2	RRE-containing,azole-containing-RiPP	161,034	190,885
Region 9.3	NRPS	234,137	325,129
Region 9.4	terpene,NRPS	431,662	509,497	Medium	leupeptin Pr/leupeptin Ac	NRPS:Type I
Region 9.5	terpene-precursor	823,956	845,023
Region 10.1	benzoxazole,NRPS-like	249,108	294,826	High	caboxamycin	other:shikimate-derived
Region 10.2	azole-containing-RiPP	311,744	335,174
Region 10.3	NRPS	358,308	413,311
Region 10.4	RiPP-like	427,750	438,550
Region 11.1	T1PKS	49,862	122,995	Medium	abyssomicin C/atrop-abyssomicin C	PKS:Type I
Region 11.2	RRE-containing	495,544	516,626
Region 11.3	terpene,NRPS,lassopeptide	605,540	673,633
Region 12.1	NRPS	168,349	213,499
Region 12.2	terpene	497,382	511,105
Region 13.1	azole-containing-RiPP,thioamitides	26,247	54,554
Region 13.2	NRPS	391,889	430,095
Region 14.1	NRPS,T1PKS	1	38,571
Region 14.2	terpene	369,295	390,353
Region 15.1	hydrogen-cyanide	58,486	71,221	Low	aborycin	ribosomal:RiPP
Region 15.2	T3PKS	91,235	132,278	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 15.3	T1PKS	236,196	384,007	Medium	stambomycin A/stambomycin B/stambomycin C/stambomycin D	PKS:Type I+saccharide:hybrid/tailoring
Region 17.1	T1PKS,t3nrps-iterative,HR-T2PKS	235,182	347,642	Low	butyrolactol A	PKS
Region 18.1	T1PKS,NRPS	1	116,924
Region 18.2	terpene	141,732	162,289
Region 18.3	T1PKS	260,924	343,617
Region 19.1	NI-siderophore	11,627	42,688
Region 19.2	lanthipeptide-class-v	96,205	139,339
Region 19.3	RiPP-like	172,873	183,694
Region 20.1	NRPS	57,341	101,033	Medium	Ficellomycin	NRPS:Type I
Region 23.1	terpene	84,305	105,801
Region 24.1	NRPS	76,961	128,572
Region 26.1	lanthipeptide-class-i	81,779	108,151
Region 27.1	terpene-precursor	49,755	70,789
Region 27.2	terpene	89,387	111,540	High	geosmin	terpene:Sesquiterpene
Region 30.1	terpene,lanthipeptide-class-ii,azole-containing-RiPP	24,760	66,370
Region 31.1	PKS-like,T1PKS	37,916	84,009
Region 32.1	T1PKS	21,479	43,462	Low	camporidine A/camporidine B	other:other+PKS
Region 34.1	terpene	24,582	44,216

No secondary metabolite regions were found in these records:: NZ_BBXD01000001.1 (Herbidospora mongoliensis); NZ_BBXD01000002.1 (Herbidospora mongoliensis); NZ_BBXD01000003.1 (Herbidospora mongoliensis); NZ_BBXD01000004.1 (Herbidospora mongoliensis); NZ_BBXD01000005.1 (Herbidospora mongoliensis); NZ_BBXD01000006.1 (Herbidospora mongoliensis); NZ_BBXD01000007.1 (Herbidospora mongoliensis); NZ_BBXD01000016.1 (Herbidospora mongoliensis); NZ_BBXD01000021.1 (Herbidospora mongoliensis); NZ_BBXD01000022.1 (Herbidospora mongoliensis); NZ_BBXD01000025.1 (Herbidospora mongoliensis); NZ_BBXD01000028.1 (Herbidospora mongoliensis); NZ_BBXD01000029.1 (Herbidospora mongoliensis); NZ_BBXD01000033.1 (Herbidospora mongoliensis); NZ_BBXD01000035.1 (Herbidospora mongoliensis); NZ_BBXD01000036.1 (Herbidospora mongoliensis); NZ_BBXD01000037.1 (Herbidospora mongoliensis); NZ_BBXD01000038.1 (Herbidospora mongoliensis); NZ_BBXD01000039.1 (Herbidospora mongoliensis); NZ_BBXD01000040.1 (Herbidospora mongoliensis); NZ_BBXD01000041.1 (Herbidospora mongoliensis); NZ_BBXD01000042.1 (Herbidospora mongoliensis); NZ_BBXD01000043.1 (Herbidospora mongoliensis); NZ_BBXD01000044.1 (Herbidospora mongoliensis); NZ_BBXD01000045.1 (Herbidospora mongoliensis); NZ_BBXD01000046.1 (Herbidospora mongoliensis); NZ_BBXD01000047.1 (Herbidospora mongoliensis)

Compact view

NZ_BBXD01000008.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 545,144 - 566,076 nt. (total: 20,933 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW272_RS02795: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: sulfhydrylase

AW272_RS02810: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: hydrolase phosphatase

AW272_RS02775: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

AW272_RS02780: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Ligases: synthetase

AW272_RS02800: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0000815.4	0.45	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0002007.2	0.43	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000678.5	0.42	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000231.5	0.41	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001529.5	0.40	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0000665.5	0.40	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0000815.4	0.45	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0002007.2	0.43	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000678.5	0.42	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000231.5	0.41	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001184.4	0.41	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001529.5	0.40	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000234.5	0.40	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000888.5	0.40	other (other)	bacilysin	Bacillus sp. CS93
BGC0000665.5	0.40	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AW272_RS02800: PT_FPPS_like

Domain 1 (54 - 290): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.02 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.38 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.80 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.82 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.85 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.93 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.24 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_BBXD01000008.1 - Region 2 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 866,981 - 889,530 nt. (total: 22,550 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase

AW272_RS04320: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Translocases: transporter

AW272_RS04335: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.64	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.49	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.64	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000553.3	0.52	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.49	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AW272_RS04365

AW272_RS41775

Leader:

MVLLDLQAMELPGGGGGH

Core:

GGGGGGGGGSTLTLLGCASQTPSNLSLLLCH

Core with dehydrations:

GGGGGGGGGDhaDhbLDhbLLGCysADhaQDhbPDhaNLDhaLLLCysH

antiSMASH-DB 4.0 matches for AW272_RS41775

100.0%

NZ_BBXD01000008.1:

Lanthipeptides: AW272_RS41775_lanthipeptide

1

GGGGGGGGGSTLTLLGCASQTPSNLSLLLCH

31

GGGGGGGGGSTLTLLGCASQTPSNLSLLLCH

1

GGGGGGGGGSTLTLLGCASQTPSNLSLLLCH

31

90.9%

NZ_BBXC01000011.1and 4 others:

NZ_BBXE01000034.1 Lanthipeptides: AW273_RS37520_lanthipeptideNZ_BBXF01000002.1 Lanthipeptides: AW274_RS40200_lanthipeptideNZ_BBXG01000007.1 Lanthipeptides: AW270_RS38750_lanthipeptideNZ_WXEW01000008.1 Lanthipeptides: GT755_RS26540_lanthipeptide

Lanthipeptides: AW271_RS39780_lanthipeptide

1

GGGGGGGGGSTLTLLGCASQTPSNLSLLLCH

31

GGGG GGGGSTLTLLGCASQTPSNLSLLLCH

3

GGGGHGGGGSTLTLLGCASQTPSNLSLLLCH

33

74.2%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31645_lanthipeptide

6

GGGGSTLTLLGCASQTPSNLSLLLCH

31

GGGGSTLT+LGCAS TPSNLSL+LCH

1

GGGGSTLTVLGCASVTPSNLSLILCH

26

with 89 more sequence matches

Only the first 10 are displayed here.

74.2%

NZ_CP043661.1and 1 other:

NZ_SOCE01000001.1 Lanthipeptides: EV138_RS20105_lanthipeptide

Lanthipeptides: F1D05_RS17325_lanthipeptide

7

GGGSTLTLLGCASQTPSNLSLLLCH

31

GGGSTLT+LGCAS TPSNLSLLLCH

2

GGGSTLTVLGCASHTPSNLSLLLCH

26

74.2%

NZ_JACDUR010000003.1and 1 other:

NZ_JACDUR010000003.1 Lanthipeptides: HNR30_RS17930_lanthipeptide

Lanthipeptides: HNR30_RS17930_lanthipeptide

5

GGGGGSTLTLLGCASQTPSNLSLLLCH

31

G GGGSTLT+LGC S TPSNLSLLLCH

1

GHGGGSTLTVLGCNSYTPSNLSLLLCH

27

74.2%

NZ_JACHWA010000004.1:

Lanthipeptides: FHS43_RS13815_lanthipeptide

5

GGGGGSTLTLLGCASQTPSNLSLLLCH

31

G GGGSTLT+LGCAS PSNLSLLLCH

1

GHGGGSTLTVLGCASAKPSNLSLLLCH

27

74.2%

NZ_SHKR01000011.1and 7 others:

NZ_SLWR01000003.1 Lanthipeptides: EV646_RS09945_lanthipeptideNZ_SNWS01000006.1 Lanthipeptides: EV651_RS15130_lanthipeptideNZ_SODF01000002.1 Lanthipeptides: EV650_RS20180_lanthipeptideNZ_SODP01000004.1 Lanthipeptides: EV653_RS35635_lanthipeptideNZ_SODT01000012.1 Lanthipeptides: EV647_RS27100_lanthipeptideNZ_SODU01000003.1 Lanthipeptides: EV137_RS31660_lanthipeptideNZ_SZPZ01000003.1 Lanthipeptides: FDA38_RS24670_lanthipeptide

Lanthipeptides: EV645_RS10765_lanthipeptide

8

GGSTLTLLGCASQTPSNLSLLLCH

31

GGSTLT+LGCASQTPSNLSLLLCH

2

GGSTLTVLGCASQTPSNLSLLLCH

25

71.0%

NC_013595.1:

Lanthipeptides: SROS_RS48825_lanthipeptide

6

GGGGSTLTLLGCASQTPSNLSLLLCH

31

GGGGSTLT+LGC S PSNLSLLLCH

1

GGGGSTLTVLGCESYKPSNLSLLLCH

26

71.0%

NC_013729.1:

Lanthipeptides: KFLA_RS37060_lanthipeptide

6

GGGGSTLTLLGCASQTPSNLSLLLCH

31

GGGGSTLT+LGC S PSNLSLLLCH

1

GGGGSTLTVLGCGSAKPSNLSLLLCH

26

71.0%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31650_lanthipeptide

7

GGGSTLTLLGCASQTPSNLSLLLCH

31

GGGSTLT+LGCAS TPSNLSL+LCH

1

GGGSTLTVLGCASVTPSNLSLVLCH

25

71.0%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31640_lanthipeptide

8

GGSTLTLLGCASQTPSNLSLLLCH

31

GGSTLT+LGCAS TPSNLSLLLCH

7

GGSTLTVLGCASVTPSNLSLLLCH

30

71.0%

NZ_PVZV01000008.1:

Lanthipeptides: C2865_RS30430_lanthipeptide

7

GGGSTLTLLGCASQTPSNLSLLLCH

31

GGGSTLT+LGCAS PSNLSLLLCH

1

GGGSTLTVLGCASAKPSNLSLLLCH

25

71.0%

NZ_SLWN01000005.1:

Lanthipeptides: EV652_RS16625_lanthipeptide

8

GGSTLTLLGCASQTPSNLSLLLCH

31

GGSTLT+LGCASQ PSNLSLLLCH

3

GGSTLTVLGCASQRPSNLSLLLCH

26

MIBiG 4.0 matches for AW272_RS41775

19.4%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

4

GGGGGGSTLT

13

G GG TLT

13

GNNGGWCTLT

22

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.02 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.38 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.87 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.00 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.75 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.25 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.35 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.08 out of 29.65

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

AW272_RS41775 - Class III

Cleavage pHMM score: 7.00

RODEO score: 0

Monoisotopic mass: 2658.4 Da

Molecular weight: 2660.0 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2678.0 Da N = 1; 2696.0 Da N = 2; 2714.0 Da N = 3; 2732.0 Da N = 4; 2750.1 Da N = 5

TFBS definitions

Regulator	Description

NZ_BBXD01000009.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 1 - 48,947 nt. (total: 48,947 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AW272_RS04560: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: formyltransferase methyltransferase

AW272_RS04525: methyltransferase

smcogs: SMCOG1089: methyltransferase

AW272_RS04555: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: amidase

AW272_RS04585: amidase

smcogs: SMCOG1105: amidase

Lyases: dehydratase

AW272_RS04675: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.84	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.74	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.70	NRPS	AbT1	Aureobasidium pullulans
BGC0000423.5	0.69	NRPS	scabichelin	Streptomyces scabiei 87.22
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans
BGC0000423.5	0.68	NRPS	scabichelin	Streptomyces scabiei 87.22
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.86 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.11 out of 23.05

Confidence: medium

Additional weak hits (13):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.42 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.33 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.06 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.47 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.92 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.65 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.32 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.02 out of 21.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.88 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.64 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.33 out of 35.63

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.03 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.69 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 48947:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Fo-OH-Orn - Ser - NMe-OH-Orn - X - Ser - D-OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS04525: Fo-OH-Orn - Ser - OH-Orn - X - Ser - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (217..607): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDVAFWDLILLAGTEFNAYGPTEATTNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWILGATNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1632..2018): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFSSGEHNLYGPTEAAVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2640..3035): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4000..4357): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: glu (Glu)

Stachelhaus prediction details:

Stachelhaus sequence:: LGAAFDGSWEPWDLSVGGEHDLYGPTECAVDAYG
Nearest Stachelhaus code(s):: Orn DGEDAGLVDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4957..5334): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFLCSGEHNLYGPTEASVDVTA
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5927..6303): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDASWQPWEVGVGGEVNLYGPTEATVDALV
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DmdR1	Iron(II)-dependent repressor

NZ_BBXD01000009.1 - Region 2 - RRE-containing,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 161,034 - 190,885 nt. (total: 29,852 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase methyltransferase

AW272_RS05205: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

AW272_RS05280: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

AW272_RS05215: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.45	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001640.3	0.41	ribosomal	kocurin	Kocuria rosea
BGC0001146.5	0.41	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000603.5	0.40	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002311.3	0.40	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000613.5	0.38	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0000605.5	0.36	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0000606.5	0.34	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0000628.4	0.34	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0001174.4	0.33	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.55	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001640.3	0.53	ribosomal	kocurin	Kocuria rosea
BGC0001146.5	0.53	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000603.5	0.53	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002311.3	0.52	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000613.5	0.52	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0000605.5	0.50	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0000628.4	0.49	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0000606.5	0.48	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001174.4	0.48	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.52 out of 25.88

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (13):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.24 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.85 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.45 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.17 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.45 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.77 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.82 out of 26.06

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.18 out of 27.18

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.56 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.96 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.28 out of 33.14

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 2 - 81; Score: 73.2
: RRE type: Thiopeptide_F_RRE; Location: 2 - 81; Score: 73.2

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
PsrA	Oleic acid responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_BBXD01000009.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 234,137 - 325,129 nt. (total: 90,993 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AW272_RS05725: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

AW272_RS05755: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

AW272_RS05825: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: glycosyltransferase

AW272_RS05665: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

AW272_RS05760: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

AW272_RS05775: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: esterase protease

AW272_RS05495: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

AW272_RS05610: putative esterase

smcogs: SMCOG1104: putative esterase

Lyases: hydratase

AW272_RS05670: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

AW272_RS05675: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase synthase

AW272_RS05595: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS05600: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS05605: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS05620: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

AW272_RS05765: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS05785: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Translocases: transporter

AW272_RS05730: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.84	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.71	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.16 out of 26.33

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 30.11 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

Additional weak hits (20):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.59 out of 27.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.12 out of 25.88

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.46 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.96 out of 36.54

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.44 out of 20.01

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.59 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.50 out of 36.54

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.34 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.51 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.74 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.08 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.54 out of 30.25

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.66 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.03 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 234136 - 325129:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn) + (X - X) + (Asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 234136 - 285311:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 279801 - 325129:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS05595: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (470..843): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQFDFGITVLKILLGGEVNHYGPTEATVGVTT
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (74% 8Å match); Asn DLTKLGEVGK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AW272_RS05600: X - X

AMP-binding (437..786): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGMTFDISAVELQAITAGEINGYGPTETTIYSTT
Nearest Stachelhaus code(s):: Ala DILQIGQIYK (79% 8Å match); Aol DIWFVAGIYK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1405..1745): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMAFDTHAEEPDLILGGEVNTYGPTEGTIIATA
Nearest Stachelhaus code(s):: Lys DTEDIGSVIK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AW272_RS05765: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (504..884): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWAGFDLVVPNAKLVVAGEINEYGPTEATVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (74% 8Å match); Asn DLTKVGEVGK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor

NZ_BBXD01000009.1 - Region 4 - NRPS,terpene

Download region GenBank file

Download region SVG

Location: 431,662 - 509,497 nt. (total: 77,836 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase reductase

AW272_RS06315: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

AW272_RS06440: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AW272_RS06535: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: aminotransferase glycosyltransferase kinase methyltransferase

AW272_RS06305: methyltransferase

smcogs: SMCOG1089: methyltransferase

AW272_RS06395: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

AW272_RS06485: aminotransferase

smcogs: SMCOG1019: aminotransferase

AW272_RS06530: methyltransferase

smcogs: SMCOG1089: methyltransferase

AW272_RS06585: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: esterase

AW272_RS06525: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase lyase

AW272_RS06360: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

AW272_RS06460: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

AW272_RS06435: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS06445: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS06470: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AW272_RS06490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS06500: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS06505: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS06510: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

AW272_RS06420: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.95	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000657.5	0.47	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002135.2	0.43	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.41	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.39	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.39	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.39	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.39	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.38	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.37	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.77	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH

Genes with terpene domains:

AW272_RS06360: T1TS + T1TS

Domain 1 (2 - 324): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (347 - 624): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.25 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.25 out of 20.97

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.89 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.47 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.23 out of 27.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.50 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.75 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.29 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.38 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 431661 - 509497:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (Tyr) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 440413 - 509497:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (Tyr) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS06435: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (957..1330): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEANLYGPTEAAVDVTS
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AW272_RS06445: Tyr

Search NORINE for peptide: strict or relaxed

AMP-binding (2..367): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: AARFFDGAMTPGLTICAGECNEYGPTECTIWATY
Nearest Stachelhaus code(s):: His DSALIAEVWK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

AW272_RS06490: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (10..388): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VQLAFDSFIDQPDCVFGGEVSVYGATECSIGSVE
Nearest Stachelhaus code(s):: Arg DAEDVGVIGK (50% 8Å match)
Stachelhaus code match:: 80% (moderate)

AW272_RS06500: X

AMP-binding (1101..1495): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWDNFDPSFLESGAISGGEINHYGPTEVNTASSH
Nearest Stachelhaus code(s):: Leu or Ile DALFIGGTFK (56% 8Å match); Val DALWIGGTFK (50% 8Å match)
Stachelhaus code match:: 60% (weak)

AW272_RS06505: X

AMP-binding (9..388): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FYLAFDPSVHDLYSMFAGEDNIYGPTELAACCDF
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AW272_RS06510: X

AMP-binding (535..933): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RFMTFDDSALEWQVVSSGEDNTWGATEVSIDSTT
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (59% 8Å match); Gly DILQVGMIWK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000009.1 - Region 5 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 823,956 - 845,023 nt. (total: 21,068 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AW272_RS08150: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

AW272_RS08155: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: phosphorylase

AW272_RS08140: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Ligases: synthetase

AW272_RS08135: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001521.3	0.41	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001521.3	0.41	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AW272_RS08135: PT_FPPS_like

Domain 1 (47 - 348): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.49 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.00 out of 24.78

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.56 out of 29.65

Confidence: medium

Additional weak hits (6):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.99 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.44 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.56 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.38 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_BBXD01000010.1 - Region 1 - NRPS-like,benzoxazole

Download region GenBank file

Download region SVG

Location: 249,108 - 294,826 nt. (total: 45,719 nt) Show pHMM detection rules used

benzoxazole: (ksIII and AMP-binding and PP-binding and Amidohydro_1)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

AW272_RS10025: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW272_RS10085: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW272_RS10105: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

AW272_RS10130: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW272_RS10150: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase sulfotransferase transketolase

AW272_RS10100: transketolase

smcogs: SMCOG1204: transketolase

AW272_RS10125: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

AW272_RS10135: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Hydrolases: back translocase hydrolase

AW272_RS10020: isochorismatase

smcogs: SMCOG1027: isochorismatase

AW272_RS10145: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Isomerases: isomerase

AW272_RS10015: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

AW272_RS10050: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

AW272_RS10040: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS10045: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AW272_RS10055: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS10065: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AW272_RS10090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS10095: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.76	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001444.5	0.76	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0002164.2	0.62	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.58	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.57	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.57	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.55	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.55	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.70	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001444.5	0.70	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0002164.2	0.64	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.78 out of 29.72

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.19 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

Additional weak hits (14):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.23 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.58 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.64 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.89 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.74 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.75 out of 39.62

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.19 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.18 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.35 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.96 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.58 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 249107 - 294826:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS10040: X

AMP-binding (32..403): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: QIVLFTWGCPGGSVQIGGAQQVFGMAEGLLSMSR
Nearest Stachelhaus code(s):: Hpa TWPSQGVLCK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW272_RS10055: X

AMP-binding (138..527): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSMAYGMVEVESLLRICGEFNLYGSAEATVVSTC
Nearest Stachelhaus code(s):: Boz GMVLRAVVVK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

AW272_RS10090: X

AMP-binding (12..396): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MAQGQAGFTWNMMGATGSAYALWGMTENGCVTIT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000010.1 - Region 2 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 311,744 - 335,174 nt. (total: 23,431 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002551.2	0.48	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.47	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.47	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000565.5	0.46	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000480.5	0.44	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0000475.5	0.44	ribosomal	patellamide A, patellamide C	Prochloron didemni
BGC0002584.2	0.43	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000471.4	0.42	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000477.3	0.40	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0000473.4	0.40	ribosomal	aerucyclamide A, aerucyclamide B, aerucyclamide C, aerucyclamide D	Microcystis aeruginosa NIES-298

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002551.2	0.48	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.47	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.47	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000565.5	0.46	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000480.5	0.44	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0000475.5	0.44	ribosomal	patellamide A, patellamide C	Prochloron didemni
BGC0002584.2	0.43	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000471.4	0.42	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000477.3	0.40	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0000473.4	0.40	ribosomal	aerucyclamide A, aerucyclamide B, aerucyclamide C, aerucyclamide D	Microcystis aeruginosa NIES-298

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.96 out of 30.25

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

Additional weak hits (10):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.64 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.78 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.35 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.16 out of 30.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.17 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.26 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.66 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.66 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.16 out of 24.78

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 4 - 101; Score: 67.7; RRE type: NHLP_CD_RRE; Location: 5 - 97; Score: 40.7; RRE type: Cyanobactin_D_RRE; Location: 3 - 60; Score: 32.9

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
ColR	Phenol-responsive regulator

Core peptide predictions

No core peptides found.

NZ_BBXD01000010.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 358,308 - 413,311 nt. (total: 55,004 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW272_RS10640: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

AW272_RS10580: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: glucosidase hydrolase

AW272_RS10525: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

AW272_RS10600: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase

AW272_RS10490: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase

AW272_RS10545: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS10550: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS10555: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS10570: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

AW272_RS10510: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (20):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.73 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.38 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.51 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 39.62

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.11 out of 26.85

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.47 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.95 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.41 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.93 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.70 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.01 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.74 out of 32.93

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.85 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 358307 - 413311:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Gly) + (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS10545: X

AMP-binding (10..374): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHFTNAGQMMNFVSSSADVNYYTSTEAVPAQTT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AW272_RS10550: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (436..824): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LSITFDISGLELQALVGGEFNVYGPTETTIWSTI
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AW272_RS10555: X

AMP-binding (437..814): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMAFDAHVEEPDLILGGDVNTYGPTEATVIATV
Nearest Stachelhaus code(s):: Lys DAEDIGSVIK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW272_RS10570: X

AMP-binding (449..815): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAFPFDASVGDPDTMVGGEVNHYGPTEATVCATT
Nearest Stachelhaus code(s):: CysA DATKMGHVGK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A

NZ_BBXD01000010.1 - Region 4 - RiPP-like

Download region GenBank file

Download region SVG

Location: 427,750 - 438,550 nt. (total: 10,801 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002425.3	0.37	ribosomal	stlassin	Streptomyces sp.
BGC0000515.4	0.35	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0001788.3	0.33	ribosomal	suicin 65	Streptococcus suis
BGC0000526.5	0.33	ribosomal	macedocin	Streptococcus macedonicus
BGC0002285.2	0.32	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000310.5	0.31	NRPS	bacitracin	Bacillus licheniformis
BGC0000550.3	0.30	ribosomal	salivaricin G32	Streptococcus salivarius
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002000.4	0.28	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000232.5	0.27	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002425.3	0.37	ribosomal	stlassin	Streptomyces sp.
BGC0000515.4	0.35	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0001788.3	0.33	ribosomal	suicin 65	Streptococcus suis
BGC0000526.5	0.33	ribosomal	macedocin	Streptococcus macedonicus
BGC0002285.2	0.32	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000310.5	0.31	NRPS	bacitracin	Bacillus licheniformis
BGC0000550.3	0.30	ribosomal	salivaricin G32	Streptococcus salivarius
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0002000.4	0.28	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000232.5	0.27	PKS	hatomarubigin A, hatomarubigin B, hatomarubigin C, hatomarubigin D	Streptomyces sp. 2238-SVT4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.15 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.86 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.65 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.63 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_BBXD01000011.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 49,862 - 122,995 nt. (total: 73,134 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AW272_RS12145: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AW272_RS12175: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acyltransferase

AW272_RS12140: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: hydrolase phosphatase

AW272_RS12085: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

AW272_RS12155: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: cyclase

AW272_RS12075: Diels-Alderase cyclase

extras: DA_cyclase: Diels-Alderase cyclase

Isomerases: racemase

AW272_RS12180: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase

AW272_RS12080: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AW272_RS12165: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW272_RS12170: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW272_RS45985: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000067.5	0.63	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000067.5	0.63	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.94 out of 20.01

Confidence: medium

Additional weak hits (18):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.65 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.58 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.55 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.54 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.01 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.78 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.55 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.20 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.99 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.23 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.57 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.78 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.52 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.35 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.71 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.29 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 49861 - 122995:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ccmal - ccmal) + (Me-ccmal - Me-redmal) + (mal)
Non-colinear ordering:: AW272_RS45985 + AW272_RS12165 + AW272_RS12170

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS45985: mal - mal - mal - mal

PKS_AT (520..791): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.6
inactive: 102.0
Methoxymalonyl-CoA: 60.1
Methylmalonyl-CoA: 51.5
Propionyl-CoA: 50.3
Isobutyryl-CoA: 38.0
fatty_acid: 17.2
Acetyl-CoA: 15.6
Ethylmalonyl-CoA: 13.9
2-Methylbutyryl-CoA: 8.9
CHC-CoA: 2.0
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1508..1788): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 200.7
inactive: 111.9
Methoxymalonyl-CoA: 67.4
Methylmalonyl-CoA: 64.4
Propionyl-CoA: 44.6
Isobutyryl-CoA: 43.2
Ethylmalonyl-CoA: 37.3
2-Methylbutyryl-CoA: 28.8
Acetyl-CoA: 25.0
Benzoyl-CoA: 19.8
fatty_acid: 15.6
CHC-CoA: 15.6
3-Methylbutyryl-CoA: 0.0
trans-1,2-CPDA: -2.4

PKS_AT (3244..3522): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 183.7
inactive: 81.4
Methoxymalonyl-CoA: 59.9
Methylmalonyl-CoA: 46.0
Isobutyryl-CoA: 28.4
Propionyl-CoA: 27.5
Acetyl-CoA: 15.5
fatty_acid: 11.2
Benzoyl-CoA: 9.0
Ethylmalonyl-CoA: 7.5
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (4892..5172): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.6
inactive: 105.8
Methoxymalonyl-CoA: 72.9
Methylmalonyl-CoA: 66.6
Propionyl-CoA: 48.3
Isobutyryl-CoA: 42.2
2-Methylbutyryl-CoA: 31.0
Ethylmalonyl-CoA: 29.7
Acetyl-CoA: 25.0
Benzoyl-CoA: 18.4
CHC-CoA: 17.9
fatty_acid: 16.4
trans-1,2-CPDA: 13.6
3-Methylbutyryl-CoA: 0.0

AW272_RS12165: mmal - mmal

PKS_AT (565..850): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 193.7
Ethylmalonyl-CoA: 188.4
Methoxymalonyl-CoA: 149.7
trans-1,2-CPDA: 104.7
2-Methylbutyryl-CoA: 104.7
CHC-CoA: 100.6
Propionyl-CoA: 94.4
Malonyl-CoA: 87.5
Isobutyryl-CoA: 60.1
Benzoyl-CoA: 52.9
3-Methylbutyryl-CoA: 31.2
fatty_acid: 25.8
Acetyl-CoA: 23.0
inactive: 14.4

PKS_AT (2296..2581): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 193.3
Ethylmalonyl-CoA: 191.7
Methoxymalonyl-CoA: 149.2
2-Methylbutyryl-CoA: 109.2
trans-1,2-CPDA: 105.3
CHC-CoA: 98.2
Propionyl-CoA: 96.9
Malonyl-CoA: 87.6
Isobutyryl-CoA: 66.1
Benzoyl-CoA: 51.8
3-Methylbutyryl-CoA: 27.4
Acetyl-CoA: 25.9
fatty_acid: 25.0
inactive: 12.7

AW272_RS12170: mal

PKS_AT (590..889): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.8
inactive: 90.4
Methoxymalonyl-CoA: 61.8
Methylmalonyl-CoA: 58.6
Isobutyryl-CoA: 47.7
Propionyl-CoA: 32.8
Ethylmalonyl-CoA: 24.3
2-Methylbutyryl-CoA: 20.5
fatty_acid: 18.1
Acetyl-CoA: 17.0
Benzoyl-CoA: 11.0
CHC-CoA: 9.1
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BBXD01000011.1 - Region 2 - RRE-containing

Download region GenBank file

Download region SVG

Location: 495,544 - 516,626 nt. (total: 21,083 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AW272_RS13865: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002317.2	0.49	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0000585.5	0.44	ribosomal	microcin C7	Escherichia coli
BGC0000701.5	0.42	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000522.3	0.39	ribosomal	lacticin Z	Lactococcus lactis
BGC0000620.3	0.38	ribosomal	lacticin Q	Lactococcus lactis
BGC0001863.4	0.38	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000552.3	0.37	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0002144.3	0.36	ribosomal	phazolicin	Rhizobium sp. Pop5
BGC0000571.3	0.36	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002317.2	0.49	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0000585.5	0.44	ribosomal	microcin C7	Escherichia coli
BGC0000701.5	0.42	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000522.3	0.39	ribosomal	lacticin Z	Lactococcus lactis
BGC0000620.3	0.38	ribosomal	lacticin Q	Lactococcus lactis
BGC0001863.4	0.38	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000552.3	0.37	ribosomal	SmbA, SmbB	Streptococcus mutans
BGC0002144.3	0.36	ribosomal	phazolicin	Rhizobium sp. Pop5
BGC0000571.3	0.36	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.86 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (10):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.34 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.43 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.39 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.64 out of 20.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.72 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 0 - 92; Score: 61.4

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000011.1 - Region 3 - NRPS,lassopeptide,terpene

Download region GenBank file

Download region SVG

Location: 605,540 - 673,633 nt. (total: 68,094 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AW272_RS14310: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

AW272_RS14470: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: glycosyltransferase kinase

AW272_RS14390: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

AW272_RS14450: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: hydrolase

AW272_RS14350: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

AW272_RS14430: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase

AW272_RS14290: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

AW272_RS14380: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS14395: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.40	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.38	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001506.5	0.38	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001825.4	0.37	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002053.3	0.37	ribosomal	ulleungdin	Streptomyces sp.
BGC0001128.4	0.37	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.37	NRPS	AM-toxin	Alternaria alternata
BGC0001548.4	0.37	ribosomal	citrulassin A	Streptomyces albulus
BGC0000342.4	0.36	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AW272_RS14290: T1TS

Domain 1 (5 - 321): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.61 out of 23.79

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.20 out of 26.33

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

Additional weak hits (14):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.21 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.80 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.29 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.33 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.00 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.21 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.62 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.51 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.10 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.92 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.67 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 3, location 605539 - 673633:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 623163 - 672994:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp) + (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS14380: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (470..838): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQFDFGVTILKMILGGEINHYGPTEATVGVTT
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW272_RS14395: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (446..826): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMSFDISALELQS--GGEVNVYGPTETTIWSTT
Nearest Stachelhaus code(s):: Gly DILQFGVIWK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 8 - 77; Score: 43.7

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BBXD01000012.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 168,349 - 213,499 nt. (total: 45,151 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW272_RS15760: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW272_RS15785: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase synthase

AW272_RS15715: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS15725: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS15730: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS15735: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS43780: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Translocases: transporter

AW272_RS15695: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (19):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.58 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.15 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.76 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.01 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.00 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.26 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.61 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.11 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.07 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.16 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.65 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.65 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.66 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.06 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 168348 - 213499:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS15725: X

AMP-binding (442..806): X

nrpys: Asn, Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YDAQFDFGITILKLIFGGEVNHYGPTEAIVGVST
Nearest Stachelhaus code(s):: Asn DFTKIGEVGK (62% 8Å match); Asp DLTKIGHVGK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW272_RS15730: X

AMP-binding (8..368): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDPFTNAGQMMNFLGSAAATNYYTSTEAAPAQTI
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000012.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 497,382 - 511,105 nt. (total: 13,724 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

AW272_RS17185: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.38	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000583.5	0.34	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000885.3	0.33	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001374.5	0.32	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002318.2	0.32	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0002015.4	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001920.4	0.31	ribosomal	siamycin I	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.38	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000583.5	0.34	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000903.3	0.33	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000885.3	0.33	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001374.5	0.32	other (other)	thienodolin	Streptomyces albogriseolus
BGC0002318.2	0.32	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0002015.4	0.31	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001920.4	0.31	ribosomal	siamycin I	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AW272_RS17185: T1TS

Domain 1 (63 - 300): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 27.36 out of 35.63

Confidence: medium

Additional weak hits (2):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.16 out of 27.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
NrtR	NAD synthesis repressor

NZ_BBXD01000013.1 - Region 1 - azole-containing-RiPP,thioamitides

Download region GenBank file

Download region SVG

Location: 26,247 - 54,554 nt. (total: 28,308 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AW272_RS17340: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

AW272_RS17355: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase

AW272_RS17350: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: protease

AW272_RS17315: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: decarboxylase

AW272_RS17390: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.48	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.48	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001849.4	0.46	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002631.2	0.42	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002560.3	0.34	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001336.5	0.32	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001655.3	0.31	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002260.3	0.31	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0001485.4	0.31	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000902.4	0.30	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002560.3	0.48	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001336.5	0.46	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001655.3	0.46	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0002260.3	0.46	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0001485.4	0.45	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000902.4	0.45	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.86 out of 26.85

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.30 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.82 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.73 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.82 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 87; Score: 39.6
: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 87; Score: 39.6

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_BBXD01000013.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 391,889 - 430,095 nt. (total: 38,207 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW272_RS19100: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: methyltransferase

AW272_RS19060: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

AW272_RS19005: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

AW272_RS19040: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS19045: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS19050: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (10):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.05 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.99 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.25 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.70 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.52 out of 18.57

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.38 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.55 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.34 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.84 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

AW272_RS19040: X

AMP-binding (15..382): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GARFTNAGQAMNFVGSTAAVNYYTSTEATPAQTV
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AW272_RS19045: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (398..753): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LSMTVDISALELQALTGGEVNVYGPTETTVWSTF
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000014.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 38,571 nt. (total: 38,571 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AW272_RS19145: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW272_RS19210: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: hydrolase

AW272_RS19135: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AW272_RS19175: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

AW272_RS19155: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

AW272_RS19125: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001641.4	0.57	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000894.4	0.37	other (other)	citrinin	Monascus aurantiacus
BGC0002518.3	0.37	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000221.5	0.31	PKS	erdacin	uncultured soil bacterium V167
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002147.2	0.30	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0000528.5	0.30	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000894.4	0.51	other (other)	citrinin	Monascus aurantiacus
BGC0002518.3	0.50	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0000221.5	0.46	PKS	erdacin	uncultured soil bacterium V167
BGC0001928.2	0.45	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002147.2	0.45	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0000528.5	0.45	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.48 out of 23.79

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 23.10 out of 27.55

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (16):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.33 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.82 out of 30.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.76 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.32 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.37 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.33 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.75 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.11 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.92 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.03 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.91 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.40 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.85 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 38571:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - ohmal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS19155: fatty_acid - mal - X

CAL_domain (126..422): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 38.5
NH2: 32.2
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1083..1344): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 66.7%; Ethylmalonyl-CoA: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 107.8
Methoxymalonyl-CoA: 78.7
Methylmalonyl-CoA: 76.5
Ethylmalonyl-CoA: 47.9
inactive: 43.7
Propionyl-CoA: 31.9
trans-1,2-CPDA: 28.1
CHC-CoA: 18.3
fatty_acid: 15.5
2-Methylbutyryl-CoA: 14.6
Isobutyryl-CoA: 9.3
Benzoyl-CoA: 8.6
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (2272..2624): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWAAFDASVRQASSHVGGEANLYGPTESTINTTC
Nearest Stachelhaus code(s):: Gln DACSTGVINK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism

NZ_BBXD01000014.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 369,295 - 390,353 nt. (total: 21,059 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AW272_RS20695: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

AW272_RS20730: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase

AW272_RS20705: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: hydrolase

AW272_RS20685: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase

AW272_RS20690: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002391.2	0.52	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000674.5	0.48	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002406.2	0.41	other (other)	hydroxycinnamoyltyramine	Oryza sativa Japonica Group
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002391.2	0.52	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000674.5	0.48	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0001910.4	0.42	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002406.2	0.41	other (other)	hydroxycinnamoyltyramine	Oryza sativa Japonica Group
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AW272_RS20690: T1TS

Domain 1 (7 - 327): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.49 out of 27.04

Confidence: medium

Additional weak hits (9):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.16 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.50 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.21 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.33 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.19 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.46 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.34 out of 29.38

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000015.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 58,486 - 71,221 nt. (total: 12,736 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

AW272_RS21525: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AW272_RS21535: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.53	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001013.5	0.28	NRPS, PKS	meridamycin	Streptomyces sp.
BGC0000721.4	0.27	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001872.3	0.26	PKS	fabclavine-polyamine	Xenorhabdus bovienii SS-2004
BGC0001011.5	0.22	NRPS, PKS	meridamycin	Streptomyces sp. NRRL 30748
BGC0002101.3	0.22	PKS	heronamide C, heronamide A, heronamide B	Streptomyces sp. CMB-0406 CBM-0406
BGC0000135.5	0.22	PKS	reveromycin A	Streptomyces sp. SN-593
BGC0000029.5	0.22	PKS	BE-14106	Streptomyces sp. DSM 21069
BGC0000097.5	0.22	PKS	ML-449	Streptomyces sp. MP39-85

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.53	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.36	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001013.5	0.28	NRPS, PKS	meridamycin	Streptomyces sp.
BGC0000721.4	0.27	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001872.3	0.26	PKS	fabclavine-polyamine	Xenorhabdus bovienii SS-2004
BGC0001011.5	0.22	NRPS, PKS	meridamycin	Streptomyces sp. NRRL 30748
BGC0002101.3	0.22	PKS	heronamide C, heronamide A, heronamide B	Streptomyces sp. CMB-0406 CBM-0406
BGC0000135.5	0.22	PKS	reveromycin A	Streptomyces sp. SN-593
BGC0000029.5	0.22	PKS	BE-14106	Streptomyces sp. DSM 21069
BGC0000097.5	0.22	PKS	ML-449	Streptomyces sp. MP39-85

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.26 out of 23.79

Confidence: medium

Additional weak hits (2):

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.56 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 20.07 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BBXD01000015.1 - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 91,235 - 132,278 nt. (total: 41,044 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AW272_RS21740: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

AW272_RS21800: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW272_RS21805: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW272_RS21820: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase methyltransferase sulfotransferase

AW272_RS21680: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

AW272_RS21705: aminotransferase

smcogs: SMCOG1019: aminotransferase

AW272_RS21735: methyltransferase

smcogs: SMCOG1248: methyltransferase

AW272_RS21745: Methylation

MITE: MITE0000155Methylation (identity: 72.80%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Lyases: hydratase

AW272_RS21670: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: mutase

AW272_RS21830: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

AW272_RS21715: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS21750: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.75	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002193.2	0.55	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000917.3	0.48	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.48	other (other)	bacilysin	Bacillus sp. CS93
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.46	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.75	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002193.2	0.55	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000917.3	0.48	other (other)	molybdenum cofactor	Rhodobacter capsulatus
BGC0000888.5	0.48	other (other)	bacilysin	Bacillus sp. CS93
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.46	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001962.3	0.45	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

Additional weak hits (12):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.77 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.87 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.94 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.78 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.88 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.52 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.29 out of 23.43

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

AW272_RS21715: X

AMP-binding (22..476): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: EATLHIARVLSLFGMTAGLQAAYEAADAGLLAFI
Nearest Stachelhaus code(s):: Leu or Ile DALFMGATFK (24% 8Å match); Leu DALFMGAVAK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
MexT	Global virulence regulator

NZ_BBXD01000015.1 - Region 3 - T1PKS

Download region GenBank file

Download region SVG

Location: 236,196 - 384,007 nt. (total: 147,812 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AW272_RS22385: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW272_RS22395: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

AW272_RS22425: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AW272_RS22460: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acylase carboxylase transferase

AW272_RS22490: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AW272_RS22500: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

AW272_RS22515: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

AW272_RS22520: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

AW272_RS44235: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase

AW272_RS22420: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AW272_RS22550: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

AW272_RS22440: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS22485: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS22545: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

AW272_RS43820: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS45185: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS45205: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS45660: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS45665: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.77	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000050.5	0.65	PKS	E-837	Streptomyces aculeolatus
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.77	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000050.5	0.65	PKS	E-837	Streptomyces aculeolatus
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.49 out of 30.22

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.47 out of 20.01

Confidence: medium

Additional weak hits (28):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.94 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.48 out of 32.74

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.71 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.00 out of 21.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.54 out of 30.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.80 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.97 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.47 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.52 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.52 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.93 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.49 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.77 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.20 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.73 out of 19.26

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.61 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.41 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.79 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.92 out of 23.43

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.78 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 236195 - 384007:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - pk - Me-ohmal - redmal - pk - pk - ohmal) + (Me-ohmal) + (ohmal - Me-redmal - ohmal - ohmal - ohmal) + (redmal - ohemal - pk) + (ohmal) + (pk - ccmal) + (redmal - Me-ohmal)
Non-colinear ordering:: AW272_RS45185 + AW272_RS45665 + AW272_RS45205 + AW272_RS44235 + AW272_RS45660 + AW272_RS22440 + AW272_RS43820

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS44235: mal - emal - pk

PKS_AT (564..856): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 91.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.5
inactive: 105.7
Methoxymalonyl-CoA: 61.7
Methylmalonyl-CoA: 45.5
Propionyl-CoA: 33.1
Ethylmalonyl-CoA: 25.5
Isobutyryl-CoA: 24.5
Acetyl-CoA: 19.9
fatty_acid: 18.3
Benzoyl-CoA: 17.6
2-Methylbutyryl-CoA: 15.5
CHC-CoA: 10.9
trans-1,2-CPDA: 5.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2591..2888): emal

ATSignature: Ethylmalonyl-CoA, Methoxymalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%; Methylmalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 211.5
Methylmalonyl-CoA: 195.0
Methoxymalonyl-CoA: 180.0
2-Methylbutyryl-CoA: 140.5
trans-1,2-CPDA: 129.5
Propionyl-CoA: 111.2
CHC-CoA: 110.2
Malonyl-CoA: 99.9
Isobutyryl-CoA: 93.6
Benzoyl-CoA: 59.9
Acetyl-CoA: 57.5
3-Methylbutyryl-CoA: 40.7
fatty_acid: 39.3
inactive: 25.5

PKS_AT (4138..4439): pk

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 100.0%; Methylmalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.3
Ethylmalonyl-CoA: 208.6
Methoxymalonyl-CoA: 173.3
2-Methylbutyryl-CoA: 148.9
trans-1,2-CPDA: 133.6
Propionyl-CoA: 108.4
Isobutyryl-CoA: 103.3
CHC-CoA: 95.2
Malonyl-CoA: 95.0
Benzoyl-CoA: 74.4
3-Methylbutyryl-CoA: 54.5
Acetyl-CoA: 48.2
fatty_acid: 33.8
inactive: 32.2

AW272_RS45660: mal

PKS_AT (536..801): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.9
inactive: 96.0
Methoxymalonyl-CoA: 71.3
Methylmalonyl-CoA: 56.4
Propionyl-CoA: 28.3
Ethylmalonyl-CoA: 26.5
Isobutyryl-CoA: 26.4
Acetyl-CoA: 25.0
Benzoyl-CoA: 24.0
fatty_acid: 21.7
trans-1,2-CPDA: 19.6
CHC-CoA: 13.6
2-Methylbutyryl-CoA: 11.8
3-Methylbutyryl-CoA: 0.0

AW272_RS22440: pk - mal

PKS_AT (552..837): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 217.0
Methylmalonyl-CoA: 216.6
Methoxymalonyl-CoA: 177.4
2-Methylbutyryl-CoA: 161.3
trans-1,2-CPDA: 141.0
Propionyl-CoA: 116.6
CHC-CoA: 113.7
Malonyl-CoA: 97.0
Isobutyryl-CoA: 77.9
Benzoyl-CoA: 65.8
3-Methylbutyryl-CoA: 48.7
Acetyl-CoA: 45.7
inactive: 38.5
fatty_acid: 36.7

PKS_AT (2004..2266): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.4
inactive: 91.4
Methoxymalonyl-CoA: 68.2
Methylmalonyl-CoA: 53.3
Acetyl-CoA: 35.0
Propionyl-CoA: 25.0
Isobutyryl-CoA: 24.9
fatty_acid: 18.1
trans-1,2-CPDA: 17.6
Benzoyl-CoA: 15.6
Ethylmalonyl-CoA: 12.3
CHC-CoA: 10.0
2-Methylbutyryl-CoA: 9.4
3-Methylbutyryl-CoA: 0.0

AW272_RS45185: mal - pk - mmal - mal - pk - pk - mal

PKS_AT (523..779): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 173.7
inactive: 75.7
Methoxymalonyl-CoA: 63.8
Methylmalonyl-CoA: 62.0
Acetyl-CoA: 40.7
Isobutyryl-CoA: 37.9
Ethylmalonyl-CoA: 27.7
Propionyl-CoA: 27.6
fatty_acid: 18.2
Benzoyl-CoA: 17.7
CHC-CoA: 16.7
2-Methylbutyryl-CoA: 11.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (1495..1792): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 213.8
Methylmalonyl-CoA: 209.2
Methoxymalonyl-CoA: 169.2
2-Methylbutyryl-CoA: 136.7
trans-1,2-CPDA: 133.6
Propionyl-CoA: 124.5
Malonyl-CoA: 104.5
CHC-CoA: 103.9
Acetyl-CoA: 60.7
Isobutyryl-CoA: 58.3
Benzoyl-CoA: 57.4
3-Methylbutyryl-CoA: 48.5
fatty_acid: 43.5
inactive: 32.5

PKS_AT (3309..3594): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.0
Ethylmalonyl-CoA: 215.3
Methoxymalonyl-CoA: 173.7
2-Methylbutyryl-CoA: 152.9
trans-1,2-CPDA: 142.4
Propionyl-CoA: 114.7
CHC-CoA: 103.8
Malonyl-CoA: 93.1
Isobutyryl-CoA: 80.6
Benzoyl-CoA: 70.0
Acetyl-CoA: 43.8
3-Methylbutyryl-CoA: 43.7
fatty_acid: 38.3
inactive: 21.3

PKS_AT (4803..5098): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.9
inactive: 117.3
Methoxymalonyl-CoA: 59.3
Methylmalonyl-CoA: 46.2
Isobutyryl-CoA: 31.3
Propionyl-CoA: 24.3
Benzoyl-CoA: 20.3
Acetyl-CoA: 18.2
2-Methylbutyryl-CoA: 16.6
Ethylmalonyl-CoA: 14.0
fatty_acid: 10.8
CHC-CoA: 9.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (6804..7089): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 212.7
Methylmalonyl-CoA: 212.0
Methoxymalonyl-CoA: 169.6
2-Methylbutyryl-CoA: 165.3
trans-1,2-CPDA: 143.4
Propionyl-CoA: 118.0
CHC-CoA: 112.3
Malonyl-CoA: 94.0
Isobutyryl-CoA: 73.1
Benzoyl-CoA: 60.9
Acetyl-CoA: 49.0
3-Methylbutyryl-CoA: 48.4
fatty_acid: 37.8
inactive: 27.4

PKS_AT (8488..8773): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 212.2
Methylmalonyl-CoA: 210.3
Methoxymalonyl-CoA: 169.7
2-Methylbutyryl-CoA: 152.2
trans-1,2-CPDA: 135.3
Propionyl-CoA: 111.9
CHC-CoA: 109.0
Malonyl-CoA: 87.1
Isobutyryl-CoA: 66.4
Benzoyl-CoA: 63.4
3-Methylbutyryl-CoA: 47.3
Acetyl-CoA: 46.7
fatty_acid: 34.2
inactive: 24.9

PKS_AT (9949..10211): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.2
inactive: 97.3
Methoxymalonyl-CoA: 67.1
Methylmalonyl-CoA: 50.8
Acetyl-CoA: 32.1
Isobutyryl-CoA: 31.3
Propionyl-CoA: 21.4
Benzoyl-CoA: 18.5
fatty_acid: 15.0
Ethylmalonyl-CoA: 13.1
trans-1,2-CPDA: 9.5
2-Methylbutyryl-CoA: 4.9
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AW272_RS45665: mmal

PKS_AT (550..835): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.0
Ethylmalonyl-CoA: 201.7
Methoxymalonyl-CoA: 167.3
trans-1,2-CPDA: 119.9
Malonyl-CoA: 112.8
2-Methylbutyryl-CoA: 109.5
CHC-CoA: 100.9
Propionyl-CoA: 95.3
Isobutyryl-CoA: 79.3
Benzoyl-CoA: 77.0
Acetyl-CoA: 48.8
inactive: 46.4
3-Methylbutyryl-CoA: 40.6
fatty_acid: 23.0

AW272_RS43820: mal - mmal

PKS_AT (548..817): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 206.4
inactive: 82.5
Methoxymalonyl-CoA: 63.6
Methylmalonyl-CoA: 51.6
Acetyl-CoA: 38.2
Isobutyryl-CoA: 27.3
Propionyl-CoA: 26.3
fatty_acid: 21.6
trans-1,2-CPDA: 19.3
Benzoyl-CoA: 18.2
Ethylmalonyl-CoA: 18.1
2-Methylbutyryl-CoA: 9.6
CHC-CoA: 9.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (2572..2866): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.4
Ethylmalonyl-CoA: 199.8
2-Methylbutyryl-CoA: 164.0
Methoxymalonyl-CoA: 154.3
trans-1,2-CPDA: 116.8
Propionyl-CoA: 112.9
CHC-CoA: 103.7
Malonyl-CoA: 102.9
Isobutyryl-CoA: 90.0
Benzoyl-CoA: 62.3
3-Methylbutyryl-CoA: 43.6
Acetyl-CoA: 42.7
fatty_acid: 39.0
inactive: 28.4

AW272_RS45205: mal - mmal - mal - mal - mal

PKS_AT (603..874): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.1
inactive: 97.8
Methoxymalonyl-CoA: 74.5
Methylmalonyl-CoA: 60.7
Propionyl-CoA: 35.7
Acetyl-CoA: 31.1
Isobutyryl-CoA: 28.7
fatty_acid: 28.1
Ethylmalonyl-CoA: 27.2
Benzoyl-CoA: 24.3
trans-1,2-CPDA: 23.9
2-Methylbutyryl-CoA: 17.8
CHC-CoA: 16.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (2100..2385): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.6
Ethylmalonyl-CoA: 206.4
Methoxymalonyl-CoA: 165.3
2-Methylbutyryl-CoA: 158.1
trans-1,2-CPDA: 130.0
Propionyl-CoA: 113.7
CHC-CoA: 106.7
Malonyl-CoA: 88.7
Isobutyryl-CoA: 69.3
Benzoyl-CoA: 55.6
3-Methylbutyryl-CoA: 47.8
Acetyl-CoA: 44.8
fatty_acid: 39.2
inactive: 21.4

PKS_AT (4074..4342): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.6
inactive: 84.7
Methoxymalonyl-CoA: 65.4
Methylmalonyl-CoA: 52.9
Acetyl-CoA: 27.9
Propionyl-CoA: 27.3
Isobutyryl-CoA: 26.4
Ethylmalonyl-CoA: 24.0
trans-1,2-CPDA: 22.3
fatty_acid: 21.6
Benzoyl-CoA: 20.4
CHC-CoA: 14.1
2-Methylbutyryl-CoA: 11.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (5528..5789): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 202.5
inactive: 91.8
Methoxymalonyl-CoA: 64.0
Methylmalonyl-CoA: 50.7
Acetyl-CoA: 35.3
Isobutyryl-CoA: 30.1
Propionyl-CoA: 24.3
trans-1,2-CPDA: 22.0
Ethylmalonyl-CoA: 22.0
fatty_acid: 19.2
Benzoyl-CoA: 17.0
CHC-CoA: 11.6
2-Methylbutyryl-CoA: 10.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (6975..7237): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.8
inactive: 101.8
Methoxymalonyl-CoA: 70.2
Methylmalonyl-CoA: 54.3
Acetyl-CoA: 38.9
Isobutyryl-CoA: 29.1
Propionyl-CoA: 25.4
Ethylmalonyl-CoA: 18.5
Benzoyl-CoA: 18.0
trans-1,2-CPDA: 17.9
fatty_acid: 16.2
2-Methylbutyryl-CoA: 11.5
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AW272_RS22485: NH2

CAL_domain (46..493): NH2

minowa: NH2

Prediction, score:

NH2: 105.7
Acetyl-CoA: 38.3
fatty_acid: 14.2
AHBA: 13.4
shikimic_acid: -1.1

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
ClgR	Caseinolytic protease gene regulator
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_BBXD01000017.1 - Region 1 - HR-T2PKS,T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 235,182 - 347,642 nt. (total: 112,461 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AW272_RS25820: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW272_RS25840: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AW272_RS25850: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

AW272_RS25975: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AW272_RS26005: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW272_RS26010: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AW272_RS26020: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: PPTase acylase aminotransferase transferase

AW272_RS25825: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

AW272_RS25915: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

AW272_RS25965: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AW272_RS26050: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: dehalogenase esterase hydrolase phosphatase

AW272_RS25830: thioesterase

smcogs: SMCOG1004: thioesterase

AW272_RS25835: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

AW272_RS25950: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AW272_RS25970: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase

AW272_RS25890: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

AW272_RS25810: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW272_RS25815: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS25855: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS25860: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS25865: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW272_RS25870: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS25875: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS25885: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS25895: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS25905: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS25985: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW272_RS26040: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.93	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001641.4	0.89	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001276.3	0.87	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001166.5	0.87	NRPS	HC-toxin	Alternaria jesenskae
BGC0001249.5	0.86	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001240.4	0.86	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001275.3	0.86	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000357.5	0.86	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001244.3	0.86	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001261.3	0.85	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 27.65 out of 29.72

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.76 out of 30.11

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.55 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.65 out of 26.85

Confidence: medium

Additional weak hits (22):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.80 out of 32.74

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.82 out of 22.40

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.51 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.29 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.56 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.08 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.27 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.94 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.56 out of 36.54

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.24 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.52 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.80 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.65 out of 32.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 235181 - 347642:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ccmal) + (Me-ccmal) + (ohmal) + (ohmal) + (ccmal) + (ohmal - ohmal)
Non-colinear ordering:: AW272_RS25875 + AW272_RS25865 + AW272_RS25860 + AW272_RS25810 + AW272_RS25870 + AW272_RS25855

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS25810: mal

PKS_AT (540..843): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 94.7
inactive: 56.7
Methoxymalonyl-CoA: 52.6
Methylmalonyl-CoA: 35.6
Propionyl-CoA: 21.0
Isobutyryl-CoA: 17.9
Benzoyl-CoA: 17.0
fatty_acid: 16.4
Ethylmalonyl-CoA: 15.0
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

AW272_RS25855: mal - mal

PKS_AT (526..833): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 95.0
inactive: 61.7
Methoxymalonyl-CoA: 47.4
Methylmalonyl-CoA: 37.6
Isobutyryl-CoA: 16.5
Propionyl-CoA: 12.6
3-Methylbutyryl-CoA: 12.3
Ethylmalonyl-CoA: 10.7
Acetyl-CoA: 10.2
Benzoyl-CoA: 8.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (2037..2338): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; 2-Rhyd-Malonyl-CoA: 66.7%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 134.4
inactive: 74.3
Methoxymalonyl-CoA: 58.3
Methylmalonyl-CoA: 46.3
Propionyl-CoA: 33.2
Isobutyryl-CoA: 15.2
2-Methylbutyryl-CoA: 14.6
fatty_acid: 14.5
CHC-CoA: 13.5
Acetyl-CoA: 12.4
3-Methylbutyryl-CoA: 8.7
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0

AW272_RS25860: mal

PKS_AT (558..874): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 104.9
inactive: 60.9
Methoxymalonyl-CoA: 45.8
Methylmalonyl-CoA: 41.3
Propionyl-CoA: 25.1
Benzoyl-CoA: 9.5
fatty_acid: 9.3
Isobutyryl-CoA: 9.3
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

AW272_RS25865: mmal

PKS_AT (565..860): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 184.5
Ethylmalonyl-CoA: 174.6
Methoxymalonyl-CoA: 153.0
trans-1,2-CPDA: 112.2
2-Methylbutyryl-CoA: 102.8
Propionyl-CoA: 94.9
Malonyl-CoA: 84.0
CHC-CoA: 60.6
Benzoyl-CoA: 57.8
Isobutyryl-CoA: 47.0
Acetyl-CoA: 27.2
3-Methylbutyryl-CoA: 24.7
inactive: 23.0
fatty_acid: 20.9

AW272_RS25870: mal

PKS_AT (569..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.7
inactive: 84.4
Methoxymalonyl-CoA: 53.7
Methylmalonyl-CoA: 39.2
Acetyl-CoA: 24.4
Ethylmalonyl-CoA: 24.2
Isobutyryl-CoA: 18.8
Benzoyl-CoA: 16.8
CHC-CoA: 14.3
Propionyl-CoA: 13.2
trans-1,2-CPDA: 11.9
fatty_acid: 9.1
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -1.9

AW272_RS25875: mmal - mmal

PKS_AT (533..830): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 190.6
Ethylmalonyl-CoA: 168.7
Methoxymalonyl-CoA: 156.9
2-Methylbutyryl-CoA: 126.7
trans-1,2-CPDA: 125.1
Propionyl-CoA: 110.5
Malonyl-CoA: 105.0
CHC-CoA: 90.3
Isobutyryl-CoA: 55.5
Benzoyl-CoA: 49.7
Acetyl-CoA: 46.0
3-Methylbutyryl-CoA: 38.9
inactive: 27.0
fatty_acid: 23.2

PKS_AT (1544..1836): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 170.0
Ethylmalonyl-CoA: 166.3
Methoxymalonyl-CoA: 147.2
2-Methylbutyryl-CoA: 113.5
trans-1,2-CPDA: 94.1
Propionyl-CoA: 88.6
Malonyl-CoA: 86.4
CHC-CoA: 71.7
Benzoyl-CoA: 51.2
Isobutyryl-CoA: 48.2
Acetyl-CoA: 32.1
3-Methylbutyryl-CoA: 26.1
inactive: 25.6
fatty_acid: 19.6

AW272_RS25895: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (14..392): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GSVLFDAGLSQTTCANTGGFLMYGLTEA-FRSTY
Nearest Stachelhaus code(s):: Asp DASTATMFRK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AW272_RS25965: mal

PKS_AT (4..278): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 72.0
inactive: 33.5
Methoxymalonyl-CoA: 31.8
Methylmalonyl-CoA: 26.6
fatty_acid: 25.4
Isobutyryl-CoA: 22.3
Benzoyl-CoA: 22.2
Propionyl-CoA: 12.3
Ethylmalonyl-CoA: 11.4
Acetyl-CoA: 10.0
2-Methylbutyryl-CoA: 6.2
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000018.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 116,924 nt. (total: 116,924 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AW272_RS26465: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW272_RS26580: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

AW272_RS26650: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: carbamoyltransferase

AW272_RS26535: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

Hydrolases: deacetylase esterase hydrolase

AW272_RS26530: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

AW272_RS26560: thioesterase

smcogs: SMCOG1004: thioesterase

AW272_RS26600: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

AW272_RS43550: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: racemase

AW272_RS26655: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

AW272_RS26360: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS26540: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS26545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS26550: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS26555: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS26565: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS26570: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS26575: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS26590: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AW272_RS43920: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transporter

AW272_RS26455: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

AW272_RS26625: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	1.03	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	1.02	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	1.02	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001164.3	0.90	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.90	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001135.5	0.87	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.87	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.86	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.85	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001050.5	0.85	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002071.2	0.75	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.74	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.45 out of 29.72

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.54 out of 23.79

Confidence: medium

Additional weak hits (19):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.22 out of 29.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.16 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.26 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.42 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.48 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.71 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.35 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.00 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.84 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.51 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.67 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.68 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.46 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 116924:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Arg - Orn) + (X) + (Val - X) + (Phe - Ser) + (Thr - X - Asn) + (Asn) + (aThr - Asn) + (Me-ccmal) + (ccmal - ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - >35188:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (Me-ccmal)
Non-colinear ordering:: AW272_RS26360 + AW272_RS43920 + AW272_RS43550

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 28701 - 110421:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Arg - Orn) + (X) + (Val - X) + (Phe - Ser) + (Thr - X - Asn) + (Asn) + (aThr - Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 71593 - 116924:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (Arg - Orn) + (X) + (Val - X) + (Phe - Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS26360: mal - mal

PKS_AT (537..810): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.5
inactive: 76.7
Methoxymalonyl-CoA: 72.0
Methylmalonyl-CoA: 61.1
Isobutyryl-CoA: 31.1
fatty_acid: 28.9
Ethylmalonyl-CoA: 27.7
Benzoyl-CoA: 25.6
Acetyl-CoA: 24.2
Propionyl-CoA: 22.8
CHC-CoA: 20.3
trans-1,2-CPDA: 16.8
2-Methylbutyryl-CoA: 8.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (2167..2439): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 178.6
inactive: 73.5
Methoxymalonyl-CoA: 72.3
Methylmalonyl-CoA: 61.4
Isobutyryl-CoA: 34.4
fatty_acid: 32.7
Acetyl-CoA: 28.8
Benzoyl-CoA: 27.2
Ethylmalonyl-CoA: 26.0
Propionyl-CoA: 23.0
CHC-CoA: 19.9
trans-1,2-CPDA: 18.5
2-Methylbutyryl-CoA: 8.4
3-Methylbutyryl-CoA: 0.0

AW272_RS43920: mmal

PKS_AT (555..847): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 215.7
Ethylmalonyl-CoA: 212.7
Methoxymalonyl-CoA: 168.5
2-Methylbutyryl-CoA: 143.1
trans-1,2-CPDA: 103.8
Malonyl-CoA: 103.0
Propionyl-CoA: 99.0
CHC-CoA: 89.2
Isobutyryl-CoA: 75.5
Benzoyl-CoA: 58.4
Acetyl-CoA: 42.6
inactive: 33.9
3-Methylbutyryl-CoA: 30.3
fatty_acid: 19.9

AW272_RS26540: aThr - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (494..969): aThr

nrpys: aThr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LVTHFDFSVWEGSQVFGGEVNMYGITETTVHVTA
Nearest Stachelhaus code(s):: aThr DFWSVGMVHK (97% 8Å match); Thr DFWSVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1606..2041): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YTASYDMAVTAVKLLIGGEVNEYGPTEATVACAV
Nearest Stachelhaus code(s):: Asn DMTKVGEVGK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AW272_RS26545: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (486..874): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YHSLFDISVPGPDLVLGGQVNEYGPTEATVGCLR
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AW272_RS26550: Thr - X - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (530..948): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LADHFDFSVWEGNQVFGGEVNMYGITETTVHVTR
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1602..2000): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWGSFDMVVPNVKLLAIGDLNEYGPTEISVANST
Nearest Stachelhaus code(s):: Asn DGTKLGEVGK (56% 8Å match); D-Ala DMPQLGMVWK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (2633..3000): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YDATYDLAVTTGKLVVGGEVNEYGPTEATVACTV
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW272_RS26555: Phe - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (497..886): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: ser (Ser)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: RWTTFDAAGWEAQVFCAGEVNTYGPTECSIDVTA
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1555..1945): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEHNLYGPTELSVDVTA
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AW272_RS26565: Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (441..822): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: REPTFDVSVLEGWLIAGGDMNGYGPTEATIFTTT
Nearest Stachelhaus code(s):: Val DALWIGGTFK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1452..1833): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFVDSLWEGLIVSSGELNLYGSSEA-WDALC
Nearest Stachelhaus code(s):: bAla VDWVVSLADK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AW272_RS26570: X

AMP-binding (485..863): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YAHGFDLSAEEPHLVVGSEVHVYGVTEASMVSTA
Nearest Stachelhaus code(s):: bLys DTEDVGTMVK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

AW272_RS26575: Arg - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (10..372): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAMAVDVFVEQCDLTVGGEVNAYGPTETVITASA
Nearest Stachelhaus code(s):: Arg DAEDIGAITK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1013..1417): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: EAWAFDVCTGERELAVGGELNVYGVTEATVGSTL
Nearest Stachelhaus code(s):: Orn DVGEIGSVDK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AW272_RS26590: mal

PKS_AT (532..817): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 150.9
inactive: 71.3
Methoxymalonyl-CoA: 58.7
Methylmalonyl-CoA: 46.8
Propionyl-CoA: 38.1
Isobutyryl-CoA: 27.2
Benzoyl-CoA: 19.4
fatty_acid: 19.3
2-Methylbutyryl-CoA: 17.8
Ethylmalonyl-CoA: 15.0
Acetyl-CoA: 14.9
CHC-CoA: 12.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000018.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 141,732 - 162,289 nt. (total: 20,558 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

AW272_RS26810: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

AW272_RS26835: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

AW272_RS26790: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000583.5	0.38	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001594.3	0.35	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000668.5	0.34	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001501.5	0.34	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001126.4	0.34	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001612.3	0.34	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903
BGC0001595.3	0.32	other (other)	fischerindole	Fischerella sp. SAG 46.79
BGC0000143.5	0.30	PKS	salinomycin	Streptomyces albus
BGC0000711.5	0.26	saccharide	neomycin	Streptomyces fradiae
BGC0000214.5	0.26	PKS	cosmomycin B	Streptomyces olindensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000583.5	0.38	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001594.3	0.35	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000668.5	0.34	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001501.5	0.34	other (other)	ambiguine P	Fischerella sp. TAU
BGC0001126.4	0.34	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001612.3	0.34	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903
BGC0001595.3	0.32	other (other)	fischerindole	Fischerella sp. SAG 46.79
BGC0000143.5	0.30	PKS	salinomycin	Streptomyces albus
BGC0000711.5	0.26	saccharide	neomycin	Streptomyces fradiae
BGC0000214.5	0.26	PKS	cosmomycin B	Streptomyces olindensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.61 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.75 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.37 out of 25.88

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_BBXD01000018.1 - Region 3 - T1PKS

Download region GenBank file

Download region SVG

Location: 260,924 - 343,617 nt. (total: 82,694 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AW272_RS27305: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

AW272_RS27320: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

AW272_RS27340: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

AW272_RS27400: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

AW272_RS27325: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

AW272_RS27370: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AW272_RS27430: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: lyase

AW272_RS27415: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthase

AW272_RS44470: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS45290: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AW272_RS45730: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.72	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000067.5	0.64	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001051.5	0.61	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.72	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000067.5	0.64	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001051.5	0.61	NRPS, PKS	thuggacin A	Sorangium cellulosum
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (20):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.59 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.13 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.99 out of 30.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.78 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.30 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.19 out of 29.38

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.71 out of 25.31

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.43 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.03 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.35 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.21 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.86 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.93 out of 32.74

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.75 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.51 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 260923 - 343617:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal - ohmal - ccmal - ccmal - ccmal) + (ohmal) + (Me-ohmal - ohmal - ohmal)
Non-colinear ordering:: AW272_RS44470 + AW272_RS45730 + AW272_RS45290

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS44470: mal - mal - mal - mal - mal

PKS_AT (548..806): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.5
inactive: 94.9
Methoxymalonyl-CoA: 62.6
Methylmalonyl-CoA: 53.8
Acetyl-CoA: 31.7
Propionyl-CoA: 27.6
Ethylmalonyl-CoA: 23.0
Benzoyl-CoA: 22.5
Isobutyryl-CoA: 20.7
CHC-CoA: 16.6
fatty_acid: 14.4
2-Methylbutyryl-CoA: 13.7
trans-1,2-CPDA: 10.3
3-Methylbutyryl-CoA: 0.0

PKS_AT (2001..2274): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.9
inactive: 89.3
Methoxymalonyl-CoA: 66.8
Methylmalonyl-CoA: 58.5
Isobutyryl-CoA: 36.7
Acetyl-CoA: 34.3
Propionyl-CoA: 32.3
Ethylmalonyl-CoA: 26.4
fatty_acid: 17.1
Benzoyl-CoA: 17.0
2-Methylbutyryl-CoA: 10.3
CHC-CoA: 8.6
trans-1,2-CPDA: 8.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (3458..3728): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.1
inactive: 110.2
Methoxymalonyl-CoA: 67.3
Methylmalonyl-CoA: 61.6
Propionyl-CoA: 29.6
Acetyl-CoA: 27.8
Ethylmalonyl-CoA: 24.8
Isobutyryl-CoA: 23.2
2-Methylbutyryl-CoA: 22.1
fatty_acid: 21.6
Benzoyl-CoA: 20.2
trans-1,2-CPDA: 9.5
CHC-CoA: 9.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (5092..5351): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.7
inactive: 83.7
Methoxymalonyl-CoA: 68.8
Methylmalonyl-CoA: 58.1
Acetyl-CoA: 32.6
Isobutyryl-CoA: 28.7
Propionyl-CoA: 28.5
Ethylmalonyl-CoA: 24.9
Benzoyl-CoA: 21.8
CHC-CoA: 14.2
2-Methylbutyryl-CoA: 13.0
fatty_acid: 12.2
trans-1,2-CPDA: 10.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (6716..6982): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.2
inactive: 97.3
Methoxymalonyl-CoA: 68.6
Methylmalonyl-CoA: 55.3
Propionyl-CoA: 25.4
Ethylmalonyl-CoA: 21.9
Acetyl-CoA: 20.1
Isobutyryl-CoA: 19.7
fatty_acid: 18.4
Benzoyl-CoA: 17.7
2-Methylbutyryl-CoA: 12.2
CHC-CoA: 10.8
trans-1,2-CPDA: 8.8
3-Methylbutyryl-CoA: 0.0

AW272_RS45730: mal

PKS_AT (547..799): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 189.4
inactive: 83.5
Methoxymalonyl-CoA: 68.9
Methylmalonyl-CoA: 56.0
Acetyl-CoA: 33.0
Isobutyryl-CoA: 29.2
Propionyl-CoA: 26.4
Ethylmalonyl-CoA: 23.2
Benzoyl-CoA: 19.9
fatty_acid: 13.3
2-Methylbutyryl-CoA: 10.6
trans-1,2-CPDA: 10.4
CHC-CoA: 9.5
3-Methylbutyryl-CoA: 0.0

AW272_RS45290: mmal - mal - mal

PKS_AT (549..835): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.7
Ethylmalonyl-CoA: 216.4
Methoxymalonyl-CoA: 175.5
2-Methylbutyryl-CoA: 163.8
trans-1,2-CPDA: 138.0
Propionyl-CoA: 120.3
CHC-CoA: 109.1
Malonyl-CoA: 98.1
Isobutyryl-CoA: 83.1
Benzoyl-CoA: 66.2
Acetyl-CoA: 51.3
3-Methylbutyryl-CoA: 48.4
fatty_acid: 44.0
inactive: 27.0

PKS_AT (2021..2283): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 199.7
inactive: 88.9
Methoxymalonyl-CoA: 65.0
Methylmalonyl-CoA: 46.2
Acetyl-CoA: 33.1
Isobutyryl-CoA: 29.6
Propionyl-CoA: 21.0
Benzoyl-CoA: 14.9
trans-1,2-CPDA: 14.3
Ethylmalonyl-CoA: 11.5
fatty_acid: 11.4
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (3474..3744): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 196.6
inactive: 99.0
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 51.2
Propionyl-CoA: 26.3
Acetyl-CoA: 22.8
Ethylmalonyl-CoA: 22.1
trans-1,2-CPDA: 17.3
Isobutyryl-CoA: 17.3
Benzoyl-CoA: 17.3
CHC-CoA: 9.5
2-Methylbutyryl-CoA: 9.4
3-Methylbutyryl-CoA: 0.0
fatty_acid: -1.8

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_BBXD01000019.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 11,627 - 42,688 nt. (total: 31,062 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase protease

AW272_RS27880: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

AW272_RS27955: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: decarboxylase

AW272_RS42555: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000678.5	0.47	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002466.3	0.37	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002138.2	0.37	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0002313.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000903.3	0.34	other (other)	fluorometabolite	Streptomyces cattleya

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.66	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002527.2	0.60	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.60	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000947.5	0.51	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000678.5	0.47	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002466.3	0.37	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0002138.2	0.37	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0002313.3	0.36	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000903.3	0.34	other (other)	fluorometabolite	Streptomyces cattleya

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.03 out of 36.53

Confidence: medium

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.19 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.41 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.39 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.18 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.27 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BBXD01000019.1 - Region 2 - lanthipeptide-class-v

Download region GenBank file

Download region SVG

Location: 96,205 - 139,339 nt. (total: 43,135 nt) Show pHMM detection rules used

lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AW272_RS28350: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002303.3	0.54	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0000501.3	0.48	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.45	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001148.5	0.43	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001229.4	0.42	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001634.3	0.40	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002303.3	0.54	ribosomal	pristinin A3	Streptomyces pristinaespiralis
BGC0000501.3	0.48	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.45	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001148.5	0.43	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0002150.2	0.42	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.42	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001229.4	0.42	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001634.3	0.40	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000496.5	0.40	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.69 out of 23.43

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.98 out of 27.55

Confidence: medium

Additional weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.78 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.41 out of 25.88

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.81 out of 20.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.22 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.18 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.25 out of 30.98

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
GnfM	Regulator of nitrogen-fixation genes

NZ_BBXD01000019.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 172,873 - 183,694 nt. (total: 10,822 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002152.2	0.35	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001321.3	0.23	terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0001322.3	0.19	terpene	lycosantalonol, β-phellandrene	Solanum lycopersicum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002152.2	0.35	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001321.3	0.23	terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0001322.3	0.19	terpene	lycosantalonol, β-phellandrene	Solanum lycopersicum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.07 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.82 out of 27.04

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.14 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (9):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.17 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.18 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.19 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.25 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.45 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.98 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.04 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.91 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000020.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 57,341 - 101,033 nt. (total: 43,693 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

AW272_RS29630: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AW272_RS29660: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

AW272_RS44560: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase kinase methyltransferase sulfotransferase transketolase

AW272_RS29625: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

AW272_RS29640: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AW272_RS29655: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

AW272_RS29675: transketolase

smcogs: SMCOG1204: transketolase

AW272_RS29680: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

AW272_RS29695: Sulfotransferase domain

extras: Sulfotransfer_5: Sulfotransferase domain

AW272_RS29785: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase

AW272_RS29705: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: lyase

AW272_RS29635: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

AW272_RS29670: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

AW272_RS29710: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001593.5	0.70	NRPS	Ficellomycin	Streptomyces ficellus
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001593.5	0.70	NRPS	Ficellomycin	Streptomyces ficellus
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (17):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.71 out of 20.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.20 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.21 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.20 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.72 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.70 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.71 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.65 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.58 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.16 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.91 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 26.57 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.34 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.44 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.30 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 57340 - 101033:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS29710: X

AMP-binding (437..827): X

nrpys: dn-dohHep

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSTAFDVSVFESDLFVGGEFNGYGPTECTVTMIV
Nearest Stachelhaus code(s):: dn-dohHep DVFDFGGVTK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000023.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 84,305 - 105,801 nt. (total: 21,497 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase

AW272_RS33805: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

AW272_RS33840: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Hydrolases: hydrolase

AW272_RS33785: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: hydratase

AW272_RS33845: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: isomerase

AW272_RS33850: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000913.3	0.50	other (other)	MK-8	Enterobacter cloacae
BGC0001910.4	0.46	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0002402.2	0.45	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.44	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001316.4	0.41	other (other)	linamarin, lotaustralin	Lotus japonicus
BGC0000286.3	0.39	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000913.3	0.50	other (other)	MK-8	Enterobacter cloacae
BGC0001910.4	0.46	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000674.5	0.45	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001911.3	0.45	terpene	raimonol	Streptomyces anulatus
BGC0002402.2	0.45	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001197.5	0.44	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001316.4	0.41	other (other)	linamarin, lotaustralin	Lotus japonicus
BGC0000286.3	0.39	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

AW272_RS33815: T2TS

Domain 1 (3 - 487): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.74 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.10 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.48 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.80 out of 23.43

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.48 out of 25.88

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_BBXD01000024.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 76,961 - 128,572 nt. (total: 51,612 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AW272_RS34955: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

AW272_RS35020: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

AW272_RS35090: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: sulfotransferase

AW272_RS35035: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Ligases: ligase

AW272_RS34995: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS35005: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS35010: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AW272_RS35015: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.70	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001050.5	0.70	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 24.24 out of 29.25

Confidence: medium

Additional weak hits (12):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.76 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.09 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.57 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.55 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.90 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.96 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.93 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.56 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.31 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.29 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.87 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 76960 - 128572:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Gly) + (Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS35005: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (483..860): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQFDFGITVLKIILGGEVNHYGPTEATVGVTT
Nearest Stachelhaus code(s):: Asp DLTKIGHVGK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AW272_RS35010: Gly - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (15..394): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDISGLELQALVGGEINVYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1552..1919): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDISGLELQALVGGEVNVYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
SypG	Regulator of biofilm formation and host colonization
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000026.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 81,779 - 108,151 nt. (total: 26,373 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

AW272_RS36475: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

AW272_RS36480: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.46	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000508.3	0.46	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000544.4	0.44	ribosomal	planosporicin	Planomonospora alba
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000506.4	0.43	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.41	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.56	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.46	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000508.3	0.46	ribosomal	epidermin	Staphylococcus epidermidis
BGC0000544.4	0.44	ribosomal	planosporicin	Planomonospora alba
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000506.4	0.43	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.41	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AW272_RS36475

AW272_RS36470

Leader:

MAAAAPTVLDAPKQQGRLDSAAFELDITVIEQADLGGL

Core:

VRLTDDGCGSTCTACTTG

Core with dehydrations:

VRLDhbDDGCysGDhaDhbCysDhbACysDhbDhbG

antiSMASH-DB 4.0 matches for AW272_RS36470

100.0%

NZ_BBXD01000026.1and 1 other:

NZ_KB913036.1 Lanthipeptides: A39M_RS1000000128430_lanthipeptide

Lanthipeptides: AW272_RS36470_lanthipeptide

1

VRLTDDGCGSTCTACTTG

18

VRLTDDGCGSTCTACTTG

1

VRLTDDGCGSTCTACTTG

18

78.9%

NZ_BBVA01000002.1and 7 others:

NZ_CP030865.1 Lanthipeptides: MicB006_RS27820_lanthipeptideNZ_FMCS01000017.1 Lanthipeptides: GA0070214_RS30700_lanthipeptideNZ_JAGPXW010000015.1 Lanthipeptides: KBX71_RS18490_lanthipeptideNZ_JALJRJ010000030.1 Lanthipeptides: OC439_RS27920_lanthipeptideNZ_LT594324.1 Lanthipeptides: GA0070621_RS04875_lanthipeptideNZ_LT607410.1 Lanthipeptides: GA0074696_RS20405_lanthipeptideNZ_LT607753.1 Lanthipeptides: GA0070614_RS02740_lanthipeptide

Lanthipeptides: A4R25_RS30565_lanthipeptide

2

RLTDDGCGSTCTACTTG

18

LTDDGCGSTCTACTT

1

NLTDDGCGSTCTACTTN

17

78.9%

NZ_BNBY01000025.1and 5 others:

NZ_CP026498.1 Lanthipeptides: C2142_RS04990_lanthipeptideNZ_FZOF01000021.1 Lanthipeptides: CHF15_RS30750_lanthipeptideNZ_JAINUL010000001.1 Lanthipeptides: K7B10_RS07615_lanthipeptideNZ_KK853997.1 Lanthipeptides: KCH_RS39425_lanthipeptideNZ_QQVZ01000001.1 Lanthipeptides: DV517_RS13190_lanthipeptide

Lanthipeptides: IE332_RS31285_lanthipeptide

3

LTDDGCGSTCTACTTG

18

LTDDGCGSTC ACTTG

2

LTDDGCGSTCGACTTG

17

with 163 more sequence matches

Only the first 10 are displayed here.

78.9%

NZ_CP023701.1:

Lanthipeptides: CP968_RS31915_lanthipeptide

2

RLTDDGCGSTCTACTTG

18

LTDDGCGSTC ACTTG

1

NLTDDGCGSTCGACTTG

17

77.8%

NZ_BMSI01000021.1and 1 other:

NZ_JAPTYM010000001.1 Lanthipeptides: O1M07_RS07535_lanthipeptide

Lanthipeptides: IE189_RS36010_lanthipeptide

3

LTDDGCGSTCTACTT

17

LTDDGCGSTC ACTT

1

LTDDGCGSTCGACTT

15

72.2%

NC_021177.1and 1 other:

NZ_BMUG01000006.1 Lanthipeptides: IE264_RS18330_lanthipeptide

Lanthipeptides: SFUL_RS28885_lanthipeptide

3

LTDDGCGSTCTACTT

17

LTDD CGSTC ACTT

1

LTDDNCGSTCGACTT

15

72.2%

NZ_KL997433.1and 1 other:

NZ_KL997433.1 Lanthipeptides: IQ62_RS26155_lanthipeptide

Lanthipeptides: IQ62_RS26155_lanthipeptide

3

LTDDGCGSTC-TACTT

17

LTDDGCGSTC +ACT+

1

LTDDGCGSTCASACTS

16

70.0%

NZ_CP018870.1and 1 other:

NZ_CP030862.1 Lanthipeptides: C0216_RS09890_lanthipeptide

Lanthipeptides: BSL84_RS27525_lanthipeptide

3

LTDDGCGSTCTACTTG

18

LTDD CGSTC ACTTG

3

LTDDNCGSTCGACTTG

18

68.2%

NZ_BCMN01000021.1:

Lanthipeptides: AV140_RS32375_lanthipeptide

1

VRLTDDGCGSTCTACTT

17

V LTDDGCGSTC ACTT

3

VNLTDDGCGSTCGACTT

19

66.7%

NZ_FRBI01000003.1:

Lanthipeptides: BUE44_RS06165_lanthipeptide

3

LTDDGCGSTCTACTTG

18

+T D CGSTC ACTTG

1

ITGDNCGSTCGACTTG

16

65.0%

NZ_AP018365.1:

Lanthipeptides: RVR_RS08440_lanthipeptide

3

LTDDGCGSTCTACTTG

18

LTDD CGSTC ACTT

3

LTDDNCGSTCGACTTN

18

63.6%

NZ_AQRK01000088.1and 27 others:

NZ_BMVQ01000014.1 Lanthipeptides: IE283_RS30975_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS19645_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS08000_lanthipeptideNZ_CP022438.1 Lanthipeptides: CGZ69_RS15030_lanthipeptideNZ_CP022438.1 Lanthipeptides: CGZ69_RS15030_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS04650_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS17265_lanthipeptideNZ_CP023702.1 Lanthipeptides: CP967_RS19640_lanthipeptideNZ_CP033073.1 Lanthipeptides: D9753_RS20300_lanthipeptideNZ_CP063808.1 Lanthipeptides: IOD14_RS42650_lanthipeptideNZ_CP071872.1 Lanthipeptides: J4032_RS33705_lanthipeptideNZ_CP071872.1 Lanthipeptides: J4032_RS33705_lanthipeptideNZ_CP075691.1 Lanthipeptides: KKZ08_RS16460_lanthipeptideNZ_CP082362.1 Lanthipeptides: K4G22_RS18080_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS33095_lanthipeptideNZ_CP101138.1 Lanthipeptides: M6G08_RS35600_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS13565_lanthipeptideNZ_CP117866.1 Lanthipeptides: PBV52_RS22590_lanthipeptideNZ_JAFIQY010000056.1 Lanthipeptides: JXZ78_RS36930_lanthipeptideNZ_JAJDST010000050.1 Lanthipeptides: LJC81_RS33260_lanthipeptideNZ_JAJDST010000050.1 Lanthipeptides: LJC81_RS33260_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0119395_lanthipeptideNZ_KB890926.1 Lanthipeptides: B053_RS0114140_lanthipeptideNZ_KB891987.1 Lanthipeptides: B079_RS0100320_lanthipeptideNZ_KB912961.1 Lanthipeptides: B065_RS0117615_lanthipeptideNZ_KQ947985.1 Lanthipeptides: AQI70_RS05650_lanthipeptideNZ_LIPF01000016.1 Lanthipeptides: AMK11_RS35705_lanthipeptide

Lanthipeptides: YUW_RS13695_lanthipeptide

1

VRLTDDGCGSTCTACTT

17

V LTDD CGSTC ACTT

3

VNLTDDNCGSTCGACTT

19

61.9%

NZ_VANP01000007.1:

Lanthipeptides: FED44_RS19980_lanthipeptide

1

VRLTDDGCGSTCT-ACTTG

18

+ +TDDGCG+TC ACTTG

1

ISVTDDGCGTTCPKACTTG

19

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.05 out of 26.85

Confidence: medium

Additional weak hits (7):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.41 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.89 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.06 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 27.04

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.93 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

AW272_RS36470 - Class I

Cleavage pHMM score: -4.30

RODEO score: 18

Monoisotopic mass: 1605.7 Da

Molecular weight: 1606.8 Da

Number of bridges: 2

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 1624.8 Da N = 1; 1642.8 Da N = 2; 1660.9 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 113 - 206; Score: 60.1

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000027.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 49,755 - 70,789 nt. (total: 21,035 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AW272_RS37135: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AW272_RS37145: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Ligases: ligase synthetase

AW272_RS37080: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AW272_RS37105: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000849.4	0.45	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000850.5	0.42	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002578.2	0.40	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000664.5	0.40	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000849.4	0.45	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000850.5	0.42	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002578.2	0.40	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000664.5	0.40	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AW272_RS37105: PT_FPPS_like

Domain 1 (55 - 323): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

Additional weak hits (9):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.52 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.58 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.42 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.02 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.80 out of 27.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.65 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.60 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000027.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 89,387 - 111,540 nt. (total: 22,154 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase hydrolase

AW272_RS37260: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

AW272_RS37335: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase

AW272_RS37305: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000528.5	0.37	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000495.5	0.35	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001484.3	0.34	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0002346.3	0.33	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001561.4	0.33	NRPS	curacomycin	Streptomyces curacoi
BGC0000874.5	0.33	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002805.2	0.32	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0001430.4	0.32	NRPS, PKS	myxochromide S	Stigmatella aurantiaca Sg a15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000528.5	0.37	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000495.5	0.35	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001484.3	0.34	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0002346.3	0.33	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001561.4	0.33	NRPS	curacomycin	Streptomyces curacoi
BGC0000874.5	0.33	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002805.2	0.32	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0001430.4	0.32	NRPS, PKS	myxochromide S	Stigmatella aurantiaca Sg a15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

AW272_RS37305: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (330 - 680): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (10):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.49 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.08 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.44 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.01 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.98 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.73 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.91 out of 21.84

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_BBXD01000030.1 - Region 1 - azole-containing-RiPP,lanthipeptide-class-ii,terpene

Download region GenBank file

Download region SVG

Location: 24,760 - 66,370 nt. (total: 41,611 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

AW272_RS38705: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

AW272_RS38700: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

AW272_RS38775: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002698.2	0.50	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000565.5	0.40	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0001579.4	0.37	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000503.5	0.36	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000528.5	0.36	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001226.4	0.35	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002551.2	0.35	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0000483.5	0.35	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000657.5	0.34	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002485.2	0.34	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.67	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.63	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.61	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002698.2	0.58	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000565.5	0.55	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002551.2	0.54	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0002485.2	0.53	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.51	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0001579.4	0.51	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000480.5	0.49	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AW272_RS38775

allorf_40508_40591

Leader:

MLTSVGLHTARKVDVEAG

Core:

AALVYVTCG

Core with dehydrations:

AALVYVDhbCysG

antiSMASH-DB 4.0 matches for allorf_40508_40591

100.0%

NZ_BBXD01000030.1:

Lanthipeptides: allorf_40508_40591_lanthipeptide

1

AALVYVTCG

9

AALVYVTCG

1

AALVYVTCG

9

allorf_42087_42218

Leader:

MKCPGRRDSIAPA

Core:

GHFSFLPAVSSNCCDVYHAWVVSIDSGDVR

Core with dehydrations:

GHFDhaFLPAVDhaDhaNCysCysDVYHAWVVDhaIDDhaGDVR

antiSMASH-DB 4.0 matches for allorf_42087_42218

100.0%

NZ_BBXD01000030.1:

Lanthipeptides: allorf_42087_42218_lanthipeptide

1

GHFSFLPAVSSNCCDVYHAWVVSIDSGDVR

30

GHFSFLPAVSSNCCDVYHAWVVSIDSGDVR

1

GHFSFLPAVSSNCCDVYHAWVVSIDSGDVR

30

23.3%

NC_013729.1:

Lanthipeptides: allorf_6992297_6992518_lanthipeptide

1

GHFSFLPAVSSNCCDVYH

18

G PAV SNC + +

2

GRRGRPPAVGSNCWNAEN

19

20.5%

NZ_CP072683.1:

Lanthipeptides: J8Z24_RS16690_lanthipeptide

1

GHFSFLPAVSSN-CCDVYHAWV

21

G+ L V SN C D Y+ W

9

GNMQPLSPVGSNYCSDDYNCWT

30

with 3 more sequence matches

20.0%

NZ_CP018779.1:

Lanthipeptides: allorf_0839405_0839551_lanthipeptide

10

SSNCCDVYHAWVVS

23

+S+CCD +H V +

8

ASDCCDPHHGAVAA

21

18.2%

NZ_JABRUZ010000012.1and 1 other:

NZ_JALATF010000002.1 Lanthipeptides: allorf_0054352_0054495_lanthipeptide

Lanthipeptides: allorf_001112_001255_lanthipeptide

8

AVSSNCCDVYHAWVVSID

25

AV ++H W + ID

7

AVYIGSTPIFHCWKIPID

24

15.6%

NZ_BROP01000004.1:

Lanthipeptides: allorf_026829_027011_lanthipeptide

4

SFLPAVSSNCCDV

16

SF P+VSS C +

19

SFRPSVSSRCAEA

31

allorf_42166_42303

Leader:

MMFITHGWCQSILVTSAEKGESKHVTEGG

Core:

EQSRCPLPRQKEFSDG

Core with dehydrations:

EQDhaRCysPLPRQKEFDhaDG

antiSMASH-DB 4.0 matches for allorf_42166_42303

100.0%

NZ_BBXD01000030.1:

Lanthipeptides: allorf_42166_42303_lanthipeptide

1

EQSRCPLPRQKEFSDG

16

EQSRCPLPRQKEFSDG

1

EQSRCPLPRQKEFSDG

16

15.8%

NZ_CP033923.1:

Lanthipeptides: EG343_RS10035_lanthipeptide

7

LPRQKEFSDG

16

+PR K F DG

27

IPRPKGFEDG

36

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

AW272_RS38700: T1TS

Domain 1 (72 - 386): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (24):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.87 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.61 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.81 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.49 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.10 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.37 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.61 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.70 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.80 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.31 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.09 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.49 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.26 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.58 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.47 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.70 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.47 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.83 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.37 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.79 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.36 out of 35.63

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Lanthipeptides

RREFinder

Terpene

TFBS Finder

Azole RiPPs

Core peptide predictions

allorf_40508_40591 - Class II

Cleavage pHMM score: -3.40

RODEO score: 0

Monoisotopic mass: 877.4 Da

Molecular weight: 878.0 Da

Number of bridges: 1

allorf_42087_42218 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 3176.5 Da

Molecular weight: 3178.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3196.5 Da N = 1; 3214.5 Da N = 2; 3232.6 Da N = 3

allorf_42166_42303 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 1839.9 Da

Molecular weight: 1841.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1859.0 Da N = 1

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 5 - 99; Score: 82.7; RRE type: NHLP_CD_RRE; Location: 2 - 96; Score: 78.5; RRE type: Cyanobactin_D_RRE; Location: 5 - 80; Score: 74.9
: RRE type: Goadsporin_CD_RRE; Location: 5 - 99; Score: 82.7; RRE type: NHLP_CD_RRE; Location: 2 - 96; Score: 78.5; RRE type: Cyanobactin_D_RRE; Location: 5 - 80; Score: 74.9

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_BBXD01000031.1 - Region 1 - PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 37,916 - 84,009 nt. (total: 46,094 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AW272_RS39265: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AW272_RS39275: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AW272_RS42895: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: methyltransferase

AW272_RS39325: methyltransferase

smcogs: SMCOG1248: methyltransferase

Ligases: synthase

AW272_RS39215: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AW272_RS39225: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AW272_RS39230: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.57	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.56	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.55	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.55	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.55	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.53	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.53	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0002192.3	0.51	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.66 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.03 out of 30.11

Confidence: medium

Additional weak hits (15):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.88 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.94 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.94 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.55 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.27 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.49 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.50 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.60 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.37 out of 18.57

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.96 out of 24.78

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 37915 - 84009:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 37915 - 80206:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 40226 - 84009:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AW272_RS39230: pk

PKS_AT (530..820): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Methylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 128.3
Ethylmalonyl-CoA: 117.2
Methoxymalonyl-CoA: 99.7
Malonyl-CoA: 96.3
Isobutyryl-CoA: 68.4
2-Methylbutyryl-CoA: 65.0
Propionyl-CoA: 61.9
trans-1,2-CPDA: 55.2
Benzoyl-CoA: 45.6
Acetyl-CoA: 36.6
3-Methylbutyryl-CoA: 34.0
inactive: 32.3
CHC-CoA: 27.7
fatty_acid: 27.2

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_BBXD01000032.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 21,479 - 43,462 nt. (total: 21,984 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AW272_RS39450: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

AW272_RS39485: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

AW272_RS39500: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Transferases: aminotransferase

AW272_RS39430: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase

AW272_RS39440: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase

AW272_RS39510: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.57	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.61	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.57	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

Additional weak hits (10):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.02 out of 30.22

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.09 out of 29.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.82 out of 28.19

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.03 out of 30.12

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBXD01000034.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 24,582 - 44,216 nt. (total: 19,635 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000683.3	0.76	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000528.5	0.36	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.31	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001920.4	0.28	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.28	ribosomal	MS-271	Streptomyces mirabilis
BGC0002015.4	0.26	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002307.3	0.25	ribosomal	humidimycin	Streptomyces humidus
BGC0001650.4	0.25	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0000197.5	0.23	PKS, saccharide	aranciamycin	Streptomyces echinatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000683.3	0.76	terpene	avermitilol	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000528.5	0.36	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.31	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001920.4	0.28	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.28	ribosomal	MS-271	Streptomyces mirabilis
BGC0002015.4	0.26	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002307.3	0.25	ribosomal	humidimycin	Streptomyces humidus
BGC0001650.4	0.25	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0000197.5	0.23	PKS, saccharide	aranciamycin	Streptomyces echinatus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.84 out of 29.72

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.96 out of 23.79

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.38 out of 29.51

Confidence: medium

Additional weak hits (8):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.72 out of 20.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.32 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.97 out of 27.04

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.94 out of 28.14

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.27 out of 32.93

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.89 out of 33.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.56 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.18 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C