GCF_001513975.1 - 37 region(s)

Download region SVG

Location: 94,197 - 104,601 nt. (total: 10,405 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: synthase

AQI70_RS00435: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: aminotransferase

AQI70_RS00450: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AQI70_RS00465: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: synthase

AQI70_RS00435: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.69 out of 30.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production

NZ_KQ947984.1 - Region 2 - terpene-precursor

Download region SVG

Location: 914,495 - 935,697 nt. (total: 21,203 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AQI70_RS04120: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

AQI70_RS04130: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

AQI70_RS04135: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

AQI70_RS04150: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AQI70_RS04155: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthetase

AQI70_RS04125: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000667.3	0.42	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000234.5	0.42	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0002218.2	0.41	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002493.3	0.41	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0002609.2	0.41	NRPS, PKS	ochratoxin A	Aspergillus welwitschiae
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000231.5	0.42	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000667.3	0.42	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001605.3	0.42	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000234.5	0.42	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0002218.2	0.41	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002493.3	0.41	NRPS	parabactin	Paracoccus denitrificans PD1222
BGC0002609.2	0.41	NRPS, PKS	ochratoxin A	Aspergillus welwitschiae
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AQI70_RS04125: PT_FPPS_like

Domain 1 (126 - 285): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.33 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.81 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 36.53

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_KQ947984.1 - Region 3 - NRPS,betalactone

Download region SVG

Location: 1,235,779 - 1,266,825 nt. (total: 31,047 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AQI70_RS05465: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

AQI70_RS05490: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: halogenase

AQI70_RS05470: flavin-dependent trp 6 7 halogenase

halogenases: flavin-dependent trp 6 7 halogenase
MITE: MITE0000030Halogenation (identity: 66.10%)
smcogs: SMCOG1119: halogenase

Ligases: ligase synthase

AQI70_RS05455: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

AQI70_RS05500: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS05505: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001562.5	1.87	NRPS	curacomycin	Streptomyces curacoi
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001050.5	0.73	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001562.5	0.98	NRPS	curacomycin	Streptomyces curacoi
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001050.5	0.69	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (4):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.28 out of 32.74

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.01 out of 29.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.58 out of 26.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 1235778 - 1266825:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (Orn - D-Asn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS05500: Orn - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (517..929): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNHAFDTSWEGWDLMLGGEYNFYGPTEATVDTLW
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1598..2000): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWCSFDLTVTTAKAVVGGEVNEYGPTEATVGCVV
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (100% 8Å match); Trp DLTKVGEVGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AQI70_RS05505: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (424..823): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: VDPAFDAGTLESWIMSGGDINGYGPTEGTVFTTL
Nearest Stachelhaus code(s):: Val DALWMGGVFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_KQ947985.1 - Region 1 - lanthipeptide-class-i

Download region SVG

Location: 37,799 - 64,127 nt. (total: 26,329 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

AQI70_RS05655: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

AQI70_RS05660: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000544.4	0.46	ribosomal	planosporicin	Planomonospora alba
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000560.5	0.43	ribosomal	subtilomycin	Bacillus subtilis
BGC0002120.3	0.40	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.38	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000796.3	0.25	saccharide	S-layer glycan	Paenibacillus alvei
BGC0000703.4	0.25	saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000544.4	0.46	ribosomal	planosporicin	Planomonospora alba
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000560.5	0.43	ribosomal	subtilomycin	Bacillus subtilis
BGC0002120.3	0.40	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000529.5	0.38	ribosomal	microbisporicin A2	Microbispora corallina
BGC0000796.3	0.25	saccharide	S-layer glycan	Paenibacillus alvei
BGC0000703.4	0.25	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (16):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.52 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.90 out of 30.22

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.83 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.97 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.96 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.38 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.52 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.42 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.53 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.41 out of 29.38

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.89 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.41 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 28.19

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 115 - 207; Score: 68.6

TFBS definitions

Regulator	Description

NZ_KQ947985.1 - Region 2 - lassopeptide

Download region SVG

Location: 468,261 - 490,616 nt. (total: 22,356 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

AQI70_RS07650: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001552.3	0.52	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001550.3	0.51	ribosomal	citrulassin D	Streptomyces katrae
BGC0001549.3	0.51	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000571.3	0.51	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002150.2	0.51	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.51	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001634.3	0.50	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001551.4	0.49	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0000575.5	0.49	ribosomal	lariatin	Rhodococcus jostii
BGC0001176.4	0.49	ribosomal	streptomonomicin	Streptomonospora alba

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001552.3	0.52	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001550.3	0.51	ribosomal	citrulassin D	Streptomyces katrae
BGC0001549.3	0.51	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000571.3	0.51	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0002150.2	0.51	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.51	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001634.3	0.50	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001551.4	0.49	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0000575.5	0.49	ribosomal	lariatin	Rhodococcus jostii
BGC0001176.4	0.49	ribosomal	streptomonomicin	Streptomonospora alba

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.17 out of 27.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.33 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.84 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.06 out of 31.73

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 4 - 85; Score: 33.6

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A

NZ_KQ947985.1 - Region 3 - CDPS

Download region SVG

Location: 722,873 - 743,616 nt. (total: 20,744 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase phosphate reductase

AQI70_RS08885: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AQI70_RS08905: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001986.3	0.59	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000851.5	0.46	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0002031.3	0.43	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0002571.2	0.39	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002582.3	0.38	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002000.4	0.37	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002535.2	0.36	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001986.3	0.59	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000851.5	0.46	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0002031.3	0.43	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0002571.2	0.39	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002582.3	0.38	NRPS	guanipiperazine A, guanipiperazine B	Streptomyces chrestomyceticus
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002000.4	0.37	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002535.2	0.36	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.03 out of 23.43

Confidence: medium

Additional weak hits (8):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.11 out of 29.51

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.04 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.19 out of 23.43

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.18 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.06 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.83 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein

NZ_KQ947986.1 - Region 1 - T3PKS

Download region SVG

Location: 255,398 - 296,528 nt. (total: 41,131 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

AQI70_RS10890: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AQI70_RS10955: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AQI70_RS10975: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

AQI70_RS11010: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

AQI70_RS11050: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

AQI70_RS11055: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: methyltransferase

AQI70_RS10980: Methylation

MITE: MITE0000155Methylation (identity: 65.50%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Hydrolases: peptidase

AQI70_RS10915: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Ligases: synthase

AQI70_RS10905: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

AQI70_RS10985: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

AQI70_RS11045: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.81	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000948.5	0.53	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001964.2	0.48	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0001647.3	0.46	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0002536.3	0.45	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.81	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000948.5	0.53	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0001962.3	0.50	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001964.2	0.48	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002031.3	0.46	other (other)	kitasetaline	Kitasatospora setae KM-6054
BGC0001647.3	0.46	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0002536.3	0.45	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699
BGC0002332.2	0.45	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (12):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.03 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.60 out of 20.97

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.22 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.34 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.69 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.54 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.69 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KQ947986.1 - Region 2 - terpene

Download region SVG

Location: 303,883 - 330,561 nt. (total: 26,679 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AQI70_RS11180: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

AQI70_RS11215: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

AQI70_RS11145: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AQI70_RS11220: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: dehydratase

AQI70_RS11230: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase synthetase

AQI70_RS11150: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

AQI70_RS11175: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.83	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000651.5	0.49	terpene	KS-505a	Streptomyces argenteolus
BGC0000640.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.83	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000651.5	0.49	terpene	KS-505a	Streptomyces argenteolus
BGC0000640.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC404

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

AQI70_RS11170: T2TS

Domain 1 (24 - 653): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

AQI70_RS11175: PT_FPPS_like

Domain 1 (83 - 377): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

AQI70_RS11185: PT_phytoene_like

Domain 1 (17 - 307): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

AQI70_RS11190: PT_phytoene_like

Domain 1 (16 - 290): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.13 out of 29.72

Confidence: medium

Additional weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.62 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.27 out of 29.38

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.11 out of 29.51

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_KQ947986.1 - Region 3 - hydrogen-cyanide

Download region SVG

Location: 444,386 - 457,253 nt. (total: 12,868 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

AQI70_RS11720: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

AQI70_RS11730: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: PPTase

AQI70_RS11755: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.38	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001341.4	0.33	NRPS	valinomycin	Rothia nasimurium
BGC0000897.5	0.33	other (other)	dehydrophos	Streptomyces luridus
BGC0001364.3	0.31	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002465.2	0.31	NRPS	amphibactin E, amphibactin H, amphibactin I	Alcanivorax borkumensis SK2
BGC0002494.3	0.31	NRPS	vibriobactin	Vibrio cholerae
BGC0002340.3	0.31	NRPS, other (other)	pyrroloformamide A, pyrroloformamide B, pyrroloformamide D, pyrroloformamide C	Streptomyces sp. CB02980
BGC0000117.5	0.30	PKS	oligomycin	Streptomyces avermitilis
BGC0001052.5	0.28	NRPS, PKS	tirandamycin	Streptomyces sp. 307-9

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.38	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001341.4	0.33	NRPS	valinomycin	Rothia nasimurium
BGC0000897.5	0.33	other (other)	dehydrophos	Streptomyces luridus
BGC0001364.3	0.31	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002465.2	0.31	NRPS	amphibactin E, amphibactin H, amphibactin I	Alcanivorax borkumensis SK2
BGC0002494.3	0.31	NRPS	vibriobactin	Vibrio cholerae
BGC0002340.3	0.31	NRPS, other (other)	pyrroloformamide A, pyrroloformamide B, pyrroloformamide D, pyrroloformamide C	Streptomyces sp. CB02980
BGC0000117.5	0.30	PKS	oligomycin	Streptomyces avermitilis
BGC0001052.5	0.28	NRPS, PKS	tirandamycin	Streptomyces sp. 307-9

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 24.77 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.77 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.90 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.44 out of 21.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.57 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor

NZ_KQ947986.1 - Region 4 - HR-T2PKS

Download region SVG

Location: 828,642 - 871,110 nt. (total: 42,469 nt) Show pHMM detection rules used

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

AQI70_RS13385: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

AQI70_RS13400: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

AQI70_RS13420: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AQI70_RS13450: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

AQI70_RS13415: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

AQI70_RS13375: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

AQI70_RS13390: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: ligase synthase

AQI70_RS13440: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AQI70_RS13465: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

AQI70_RS13460: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002274.2	0.60	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002510.2	0.51	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001928.2	0.51	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001369.3	0.50	PKS	metatricycloene	uncultured bacterium
BGC0001987.2	0.49	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001723.5	0.48	PKS	oviedomycin	Streptomyces antibioticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002274.2	0.60	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002510.2	0.51	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001928.2	0.51	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001369.3	0.50	PKS	metatricycloene	uncultured bacterium
BGC0001987.2	0.49	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0001723.5	0.48	PKS	oviedomycin	Streptomyces antibioticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.68 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.61 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.07 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.54 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

AQI70_RS13415: pk

PKS_AT (7..295): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 34.5
Methylmalonyl-CoA: 30.2
Malonyl-CoA: 15.5
CHC-CoA: 10.6
Propionyl-CoA: 8.2
fatty_acid: 4.7
trans-1,2-CPDA: 0.0
inactive: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

AQI70_RS13465: X

AMP-binding (17..482): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RGSV--LALEQSQITVSGAVECYGMTETAAAATS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description

NZ_KQ947986.1 - Region 5 - NRPS

Download region SVG

Location: 875,141 - 906,880 nt. (total: 31,740 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AQI70_RS13570: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AQI70_RS13595: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: esterase

AQI70_RS13560: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

AQI70_RS13545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS13620: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AQI70_RS13625: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.25 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.45 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 875140 - 906880:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly) + (NMe-X - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS13545: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (9..435): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LQTHFDFSVWEGNQVFGGEVNMYGITETTVHCTY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AQI70_RS13620: X - X

AMP-binding (467..855): X

nrpys: Ile, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTFEVWLWVGGDVDGYGPTETTVFATA
Nearest Stachelhaus code(s):: Ile or aIle DAFWWGGVFK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1897..2291): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDKTFDPMTYEPLLWIGGEVNAFGPTEITCNSTV
Nearest Stachelhaus code(s):: norCMA DPYWWGATFK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

AQI70_RS13625: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (628..1005): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAALELQGLVGGETNLYGPTETAIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description

NZ_KQ947987.1 - Region 1 - NI-siderophore

Download region SVG

Location: 47,391 - 77,310 nt. (total: 29,920 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

AQI70_RS13860: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.48	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.48	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.48	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.48	other (other)	ectoine	Methylophaga thalassica
BGC0000853.3	0.46	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.46	other (ectoine)	ectoine	Streptomyces sp.
BGC0002692.2	0.46	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.45	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.48	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.48	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.48	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.48	other (other)	ectoine	Methylophaga thalassica
BGC0000853.3	0.46	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.46	other (ectoine)	ectoine	Streptomyces sp.
BGC0002692.2	0.46	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0002683.2	0.45	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.37 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.37 out of 23.79

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 26.06 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.62 out of 27.18

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (10):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.87 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.81 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.92 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_KQ947987.1 - Region 2 - aminopolycarboxylic-acid

Download region SVG

Location: 194,142 - 207,579 nt. (total: 13,438 nt) Show pHMM detection rules used

aminopolycarboxylic-acid: (AesA and AesB and AesC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deaminase

AQI70_RS14410: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase

AQI70_RS14415: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

AQI70_RS14420: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.84	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.81	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.69	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002487.3	0.39	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000932.5	0.35	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0000495.5	0.34	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002213.3	0.33	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001790.4	0.33	NRPS	sulfazecin	Pseudomonas acidophila
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.84	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.81	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.69	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000943.5	0.42	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002487.3	0.39	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0000932.5	0.35	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0000495.5	0.34	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0002213.3	0.33	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001790.4	0.33	NRPS	sulfazecin	Pseudomonas acidophila
BGC0002285.2	0.33	ribosomal	aborycin	Streptomyces sp. ZS0098

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.74 out of 36.53

Confidence: medium

Additional weak hits (2):

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.99 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_KQ947987.1 - Region 3 - azole-containing-RiPP

Download region SVG

Location: 227,604 - 255,493 nt. (total: 27,890 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AQI70_RS14555: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

AQI70_RS14595: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: hydrolase

AQI70_RS14565: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	1.00	ribosomal	curacozole	Streptomyces curacoi
BGC0002391.2	0.53	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000798.3	0.47	saccharide	dhurrin	Sorghum bicolor
BGC0002721.2	0.45	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001174.4	0.42	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0002402.2	0.41	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000569.5	0.39	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001962.3	0.39	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	1.00	ribosomal	curacozole	Streptomyces curacoi
BGC0002391.2	0.53	terpene	zealexin B3, zealexin C2	Zea mays
BGC0000798.3	0.47	saccharide	dhurrin	Sorghum bicolor
BGC0002721.2	0.45	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0000677.5	0.44	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001174.4	0.42	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0002402.2	0.41	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000569.5	0.39	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001962.3	0.39	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001605.3	0.39	terpene	gibberellin	Sinorhizobium fredii NGR234

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 29.81 out of 35.63

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 27.43 out of 35.63

Confidence: medium

Additional weak hits (3):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.14 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.39 out of 39.62

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
NrtR	NAD synthesis repressor
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_KQ947987.1 - Region 4 - RiPP-like

Download region SVG

Location: 329,991 - 341,355 nt. (total: 11,365 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase

AQI70_RS14990: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000351.5	0.33	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0000498.5	0.32	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.32	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0002710.2	0.32	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002579.2	0.31	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0002303.3	0.30	ribosomal	pristinin A3	Streptomyces pristinaespiralis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000351.5	0.33	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002663.2	0.32	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0000498.5	0.32	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.32	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0002710.2	0.32	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23
BGC0001928.2	0.31	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002579.2	0.31	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0002303.3	0.30	ribosomal	pristinin A3	Streptomyces pristinaespiralis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.38 out of 23.79

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.84 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.35 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.02 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism

NZ_KQ947987.1 - Region 5 - butyrolactone,terpene

Download region SVG

Location: 442,830 - 465,811 nt. (total: 22,982 nt) Show pHMM detection rules used

butyrolactone: AfsA
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucanase peptidase protease

AQI70_RS15425: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

AQI70_RS15495: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

AQI70_RS15505: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Lyases: cyclase

AQI70_RS15465: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000850.5	1.17	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000849.4	1.01	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.98	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001181.4	0.63	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0002578.2	0.34	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002260.3	0.28	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0000502.5	0.24	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0000595.3	0.23	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0002663.2	0.22	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0000914.5	0.21	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.86	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000850.5	0.83	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000849.4	0.79	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002578.2	0.50	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002260.3	0.46	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0000595.3	0.42	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000502.5	0.41	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0002663.2	0.40	ribosomal	amyloliquecidin GF610	Bacillus amyloliquefaciens UMAF6639
BGC0000914.5	0.39	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

AQI70_RS15465: T1TS + T1TS

Domain 1 (1 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (332 - 695): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.21 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production

NZ_KQ947987.1 - Region 6 - lanthipeptide-class-iii

Download region SVG

Location: 579,179 - 601,725 nt. (total: 22,547 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Translocases: transporter

AQI70_RS16000: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002337.2	0.56	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000528.5	0.53	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000553.3	0.51	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.62	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002337.2	0.56	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000528.5	0.53	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000553.3	0.51	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AQI70_RS16030

AQI70_RS38545

Leader:

MTVLDLQTLPSPETDALPGGGS

Core:

TQSWVCGSFVSTGCF

Core with dehydrations:

DhbQDhaWVCysGDhaFVDhaDhbGCysF

antiSMASH-DB 4.0 matches for AQI70_RS38545

100.0%

Lanthipeptides: AQI70_RS38545_lanthipeptide

1

TQSWVCGSFVSTGCF

15

TQSWVCGSFVSTGCF

1

TQSWVCGSFVSTGCF

15

60.0%

Lanthipeptides: AQI70_RS38550_lanthipeptide

1

TQSWVCGSFVSTGC

14

TQSWVC S S C

1

TQSWVCASSWSINC

14

33.3%

NZ_CP023702.1:

Lanthipeptides: allorf_5068037_5068231_lanthipeptide

1

TQSWVCGSFVSTG

13

W+ G+FV +G

2

PDGWLSGAFVGSG

14

with 3 more sequence matches

18.9%

NZ_FOJF01000001.1:

Lanthipeptides: BMW86_RS13610_lanthipeptide

1

TQSWVCGSFVSTGC

14

TQ ++C + V TGC

21

TQVYLCPTSVQTGC

34

17.9%

NZ_CP084530.1and 3 others:

NZ_CP084530.1 Lanthipeptides: LDO05_RS02090_lanthipeptideNZ_LT985747.1 Lanthipeptides: C8268_RS00150_lanthipeptideNZ_LT985747.1 Lanthipeptides: C8268_RS00150_lanthipeptide

Lanthipeptides: LDO05_RS02090_lanthipeptide

1

TQSWVCG

7

T SW+CG

6

TSSWICG

12

16.1%

NZ_CP028940.1:

Lanthipeptides: allorf_0615262_0615399_lanthipeptide

4

WVCGSFVSTGCF

15

W CG+ GC+

20

WTCGNMTICGCY

31

AQI70_RS38550

Leader:

MTVLDLQTLPSPETDALPGGGS

Core:

TQSWVCASSWSINC

Core with dehydrations:

DhbQDhaWVCysADhaDhaWDhaINCys

antiSMASH-DB 4.0 matches for AQI70_RS38550

100.0%

Lanthipeptides: AQI70_RS38550_lanthipeptide

1

TQSWVCASSWSINC

14

TQSWVCASSWSINC

1

TQSWVCASSWSINC

14

60.0%

Lanthipeptides: AQI70_RS38545_lanthipeptide

1

TQSWVCASSWSINC

14

TQSWVC S S C

1

TQSWVCGSFVSTGC

14

allorf_592117_592227

Leader:

MSVLDLQTLTVSQRE

Core:

QVPATSSNSYVCFTSYWSNGC

Core with dehydrations:

QVPADhbDhaDhaNDhaYVCysFDhbDhaYWDhaNGCys

antiSMASH-DB 4.0 matches for allorf_592117_592227

100.0%

Lanthipeptides: allorf_592117_592227_lanthipeptide

1

QVPATSSNSYVCFTSYWSNGC

21

QVPATSSNSYVCFTSYWSNGC

1

QVPATSSNSYVCFTSYWSNGC

21

29.0%

NZ_PVMZ01000043.1and 1 other:

NZ_PVMZ01000043.1 Lanthipeptides: CLV67_RS49720_lanthipeptide

Lanthipeptides: CLV67_RS49720_lanthipeptide

2

VPATSSNSYVCFTSY

16

VP TS+ YVC SY

4

VPGTSTIGYVCTYSY

18

23.3%

NZ_CP113914.1:

Lanthipeptides: allorf_1411802_1411978_lanthipeptide

2

VPATSSNSYVCFTSYWSNGC

21

P S + CF++ +NGC

8

TPGCPSGGFACFSTQCTNGC

27

with 3 more sequence matches

20.6%

NZ_KE951497.1:

Lanthipeptides: allorf_8519_8683_lanthipeptide

3

PATSSNSYVCFTSYWSNGC

21

P + CFT+ +NGC

9

PGCPTGGIACFTTQCTNGC

27

19.4%

NZ_QGGR01000002.1:

Lanthipeptides: BC793_RS05490_lanthipeptide

2

VPATSSNSYVCFTSY

16

VP TS+ ++C S+

4

VPGTSTIGWICTVSW

18

17.6%

NZ_JALGRO010000002.1and 1 other:

NZ_SNVW01000005.1 Lanthipeptides: EDF64_RS09155_lanthipeptide

Lanthipeptides: MT346_RS01980_lanthipeptide

3

PATSSNSYVCFTSYWSNGC

21

P + + CFT+ + GC

9

PGCPTGGFACFTAACTGGC

27

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.99 out of 26.85

Confidence: medium

Additional weak hits (1):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.93 out of 32.74

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

AQI70_RS38545 - Class III

Cleavage pHMM score: 4.70

RODEO score: 0

Monoisotopic mass: 1517.7 Da

Molecular weight: 1518.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1536.7 Da N = 1; 1554.7 Da N = 2; 1572.8 Da N = 3

AQI70_RS38550 - Class III

Cleavage pHMM score: 4.70

RODEO score: 0

Monoisotopic mass: 1480.7 Da

Molecular weight: 1481.6 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1499.7 Da N = 1; 1517.7 Da N = 2; 1535.7 Da N = 3

allorf_592117_592227 - Class III

Cleavage pHMM score: -3.30

RODEO score: 0

Monoisotopic mass: 2174.0 Da

Molecular weight: 2175.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2193.3 Da N = 1; 2211.4 Da N = 2; 2229.4 Da N = 3; 2247.4 Da N = 4; 2265.4 Da N = 5

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism

NZ_KQ947987.1 - Region 7 - NI-siderophore,NRPS

Download region SVG

Location: 729,653 - 770,615 nt. (total: 40,963 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AQI70_RS16670: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: aminotransferase

AQI70_RS16615: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

AQI70_RS16695: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

AQI70_RS16685: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS16720: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.65	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.64	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.71	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.99 out of 27.04

Confidence: medium

Additional weak hits (7):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.45 out of 26.85

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.68 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.09 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.13 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.60 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.41 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.63 out of 27.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 729652 - 770615:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 743905 - 770615:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS16685: X

AMP-binding (42..438): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGATFDIATWEALLTSGGEVNLYGPTECTCIATH
Nearest Stachelhaus code(s):: Leu DAYLTGLMNK (62% 8Å match); Ser DMWNTGLVHK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

AQI70_RS16720: Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (464..855): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDQSFDASTYEVFLWTGGEVHVYGPTETTVYATC
Nearest Stachelhaus code(s):: Ile or Val DAYFWGVTFK (88% 8Å match); Val DAYFWGVTFK (85% 8Å match); Ile DAYFWGVTFK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1507..1881): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SGHHTDVAAWEGTLLLTGASGLHGSAETATDTPL
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (32% 8Å match)
Stachelhaus code match:: 70% (weak)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DasR	N-acetylglucosamine dependent repressor

NZ_KQ947988.1 - Region 1 - PKS-like,T1PKS,oligosaccharide

Download region SVG

Location: 52,720 - 106,096 nt. (total: 53,377 nt) Show pHMM detection rules used

oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AQI70_RS16930: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

AQI70_RS17025: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AQI70_RS17170: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Transferases: Methylation acylase glycosyltransferase halogenase methyltransferase transferase

AQI70_RS16945: Methylation

MITE: MITE0000002Methylation (identity: 98.90%)
smcogs: SMCOG1042: O-methyltransferase

AQI70_RS16955: flavin-dependent cycline orsellinic halogenase

halogenases: flavin-dependent cycline orsellinic halogenase
smcogs: SMCOG1119: halogenase

AQI70_RS16975: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

AQI70_RS17010: methyltransferase

smcogs: SMCOG1089: methyltransferase

AQI70_RS17020: Methylation

MITE: MITE0000003Methylation (identity: 98.30%)

AQI70_RS17030: Methylation

MITE: MITE0000001Methylation (identity: 98.30%)
smcogs: SMCOG1089: methyltransferase

AQI70_RS17040: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

AQI70_RS17050: Methylation

MITE: MITE0000004Methylation (identity: 87.40%)

AQI70_RS17065: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

AQI70_RS17070: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: dehydratase

AQI70_RS16940: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AQI70_RS16960: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AQI70_RS17035: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AQI70_RS17055: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AQI70_RS17060: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

AQI70_RS17120: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

AQI70_RS16985: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

AQI70_RS17075: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000026.5	1.75	saccharide	avilamycin A, avilamycin C	Streptomyces viridochromogenes Tue57
BGC0001535.3	0.92	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001276.3	0.85	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.85	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.84	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001275.3	0.84	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.83	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.80	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000037.4	0.80	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0002154.2	0.79	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000026.5	0.84	saccharide	avilamycin A, avilamycin C	Streptomyces viridochromogenes Tue57
BGC0002608.2	0.76	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001535.3	0.68	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000278.3	0.61	PKS	urdamycin	Streptomyces fradiae
BGC0001244.3	0.61	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

Additional weak hits (20):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.67 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.13 out of 36.54

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.30 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.91 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.05 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.33 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.74 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.60 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.88 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.27 out of 25.88

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.34 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.98 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.96 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.68 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.83 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 52719 - 106096:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS17070: pk

PKS_AT (551..843): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 66.7%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 124.1
Methoxymalonyl-CoA: 99.8
Ethylmalonyl-CoA: 98.9
Malonyl-CoA: 94.2
Isobutyryl-CoA: 73.6
Propionyl-CoA: 65.5
2-Methylbutyryl-CoA: 64.5
trans-1,2-CPDA: 64.3
Acetyl-CoA: 44.7
fatty_acid: 30.2
Benzoyl-CoA: 30.0
inactive: 28.9
CHC-CoA: 28.6
3-Methylbutyryl-CoA: 27.3

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_KQ947989.1 - Region 1 - melanin,terpene

Download region SVG

Location: 37,350 - 76,503 nt. (total: 39,154 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AQI70_RS20475: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

AQI70_RS20490: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AQI70_RS20525: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: methyltransferase

AQI70_RS20540: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

AQI70_RS20435: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AQI70_RS20470: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase

AQI70_RS20535: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase synthetase

AQI70_RS20455: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

AQI70_RS20460: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	1.06	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	1.01	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.60	other (other)	melanin	Streptomyces avermitilis
BGC0000908.3	0.58	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.56	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000658.3	0.53	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.52	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000885.3	0.30	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000657.5	0.27	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002397.2	0.25	terpene	astallatene	Arabidopsis thaliana

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000911.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000908.3	0.62	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.61	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.61	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002397.2	0.58	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.54	terpene	boleracene	Brassica oleracea var. oleracea

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

AQI70_RS20455: PT_FPPS_like

Domain 1 (45 - 329): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

AQI70_RS20535: T1TS

Domain 1 (17 - 342): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

Additional weak hits (12):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.84 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.17 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.37 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.25 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.68 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor

NZ_KQ947989.1 - Region 2 - terpene

Download region SVG

Location: 141,967 - 162,974 nt. (total: 21,008 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AQI70_RS20920: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

AQI70_RS20955: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: hydrolase

AQI70_RS20900: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AQI70_RS20945: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase

AQI70_RS20925: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

AQI70_RS20905: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS20910: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS20935: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002391.2	0.51	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002826.2	0.51	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002128.3	0.47	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000798.3	0.46	saccharide	dhurrin	Sorghum bicolor
BGC0002405.2	0.45	saccharide	mid-chain acyl sugars	Solanum lycopersicum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002391.2	0.51	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002826.2	0.51	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002128.3	0.47	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000798.3	0.46	saccharide	dhurrin	Sorghum bicolor
BGC0002405.2	0.45	saccharide	mid-chain acyl sugars	Solanum lycopersicum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AQI70_RS20925: T1TS

Domain 1 (20 - 325): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

Additional weak hits (3):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.52 out of 27.55

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.74 out of 25.31

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.21 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KQ947989.1 - Region 3 - lanthipeptide-class-iii

Download region SVG

Location: 184,376 - 207,132 nt. (total: 22,757 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.58	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.52	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.68	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.59	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.58	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000546.3	0.52	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AQI70_RS21105

AQI70_RS21110

Leader:

MALLDLQTMEADELTGAPSS

Core:

LSVLSCVSAASITLCL

Core with dehydrations:

LDhaVLDhaCysVDhaAADhaIDhbLCysL

antiSMASH-DB 4.0 matches for AQI70_RS21110

88.9%

NC_013929.1and 15 others:

NZ_CP024989.1 Lanthipeptides: CVT30_RS03305_lanthipeptideNZ_CP043956.1 Lanthipeptides: F3K20_RS38375_lanthipeptideNZ_CP080647.1 Lanthipeptides: K1J60_RS02380_lanthipeptideNZ_CP092431.1 Lanthipeptides: L3078_RS41330_lanthipeptideNZ_CP102512.1 Lanthipeptides: JIX56_RS02585_lanthipeptideNZ_CP102513.1 Lanthipeptides: JIX55_RS44520_lanthipeptideNZ_CP119143.1 Lanthipeptides: PYR72_RS09305_lanthipeptideNZ_CP119182.1 Lanthipeptides: IHE65_RS03370_lanthipeptideNZ_JAAVVL010000001.1 Lanthipeptides: GWK25_RS26465_lanthipeptideNZ_JABXWH010000001.1 Lanthipeptides: HW845_RS03030_lanthipeptideNZ_KB911581.1 Lanthipeptides: STRBO_RS0126215_lanthipeptideNZ_KL997427.1 Lanthipeptides: IQ62_RS23420_lanthipeptideNZ_KL997511.1 Lanthipeptides: IQ61_RS23655_lanthipeptideNZ_KQ257863.1 Lanthipeptides: IQ64_RS21545_lanthipeptideNZ_KQ947989.1 Lanthipeptides: AQI70_RS21110_lanthipeptide

Lanthipeptides: SCAB_RS04060_lanthipeptide

1

LSVLSCVSAASITLCL

16

LSVLSCVSAASITLCL

3

LSVLSCVSAASITLCL

18

88.2%

NC_020504.1and 2 others:

NZ_CP114413.1 Lanthipeptides: STRCI_RS37065_lanthipeptideNZ_KQ948993.1 Lanthipeptides: AQJ84_RS21420_lanthipeptide

Lanthipeptides: BN159_RS04910_lanthipeptide

1

LSVLSCVSAASITLCL

16

LS+LSCVSAASITLCL

2

LSLLSCVSAASITLCL

17

82.4%

NZ_AP023440.1and 20 others:

NZ_BCMN01000008.1 Lanthipeptides: AV140_RS18455_lanthipeptideNZ_CP016438.1 Lanthipeptides: SLINC_RS40935_lanthipeptideNZ_CP028834.1 Lanthipeptides: DBP13_RS03385_lanthipeptideNZ_CP032427.1 Lanthipeptides: DWG14_RS04755_lanthipeptideNZ_CP041168.1 Lanthipeptides: FJ654_RS37200_lanthipeptideNZ_CP063808.1 Lanthipeptides: IOD14_RS17380_lanthipeptideNZ_CP089312.1 Lanthipeptides: LUX31_RS01980_lanthipeptideNZ_CP090447.1 Lanthipeptides: LXH13_RS36110_lanthipeptideNZ_CP114283.1 Lanthipeptides: O1Q96_RS29865_lanthipeptideNZ_KB911777.1 Lanthipeptides: H295_RS0107720_lanthipeptideNZ_KE150426.1 Lanthipeptides: HMPREF1211_RS03610_lanthipeptideNZ_KQ948146.1 Lanthipeptides: AQI94_RS13060_lanthipeptideNZ_KQ948176.1 Lanthipeptides: AQI84_RS04025_lanthipeptideNZ_KQ948306.1 Lanthipeptides: AQI96_RS09745_lanthipeptideNZ_KQ948656.1 Lanthipeptides: AQJ46_RS04035_lanthipeptideNZ_KQ948737.1 Lanthipeptides: AQJ54_RS21815_lanthipeptideNZ_LMDL01000023.1 Lanthipeptides: ASD08_RS26930_lanthipeptideNZ_MJAH01000003.1 Lanthipeptides: BFN33_RS10675_lanthipeptideNZ_PZZX01000020.1 Lanthipeptides: C7821_RS36345_lanthipeptideNZ_SLYY01000001.1 Lanthipeptides: EV578_RS04115_lanthipeptide

Lanthipeptides: IGS71_RS03655_lanthipeptide

1

LSVLSCVSAASITLCL

16

LS+LSCVSAAS+TLCL

2

LSLLSCVSAASVTLCL

17

with 42 more sequence matches

Only the first 10 are displayed here.

77.8%

NZ_CP034539.1and 4 others:

NZ_CP117866.1 Lanthipeptides: PBV52_RS01370_lanthipeptideNZ_FNHV01000016.1 Lanthipeptides: BLU79_RS34765_lanthipeptideNZ_JAIHON010000003.1 Lanthipeptides: K4B79_RS07725_lanthipeptideNZ_RQJW01000015.1 Lanthipeptides: EHO50_RS37060_lanthipeptide

Lanthipeptides: EJ357_RS03030_lanthipeptide

1

LSVLSCVSAASITLCL

16

LS+LSCVSAAS+TLCL

3

LSLLSCVSAASLTLCL

18

76.5%

NZ_CM002285.1and 2 others:

NZ_CP047020.1 Lanthipeptides: GQF42_RS39440_lanthipeptideNZ_VISR01000012.1 Lanthipeptides: FB157_RS21700_lanthipeptide

Lanthipeptides: M878_RS54195_lanthipeptide

1

LSVLSCVSAASITLCL

16

+S+LSCVSAASI LCL

2

VSLLSCVSAASILLCL

17

76.5%

NZ_CP016279.1and 1 other:

NZ_KQ948226.1 Lanthipeptides: AQI95_RS36775_lanthipeptide

Lanthipeptides: AVL59_RS17635_lanthipeptide

1

LSVLSCVSAASITLCL

16

LS+LSCVSAAS+ LCL

2

LSLLSCVSAASVLLCL

17

72.2%

NZ_BMUM01000019.1and 1 other:

NZ_JANFDE010000009.1 Lanthipeptides: FHS35_RS28665_lanthipeptide

Lanthipeptides: IE284_RS41515_lanthipeptide

1

LSVLSCVSAASITLCL

16

LS+LSC+SAAS+TLCL

3

LSLLSCISAASVTLCL

18

70.6%

NC_003155.5and 5 others:

NZ_BBYG01000010.1 Lanthipeptides: AOQ37_RS09965_lanthipeptideNZ_KB891997.1 Lanthipeptides: B079_RS0125330_lanthipeptideNZ_KB912966.1 Lanthipeptides: B065_RS0120870_lanthipeptideNZ_MLCE01000039.1 Lanthipeptides: BKI49_RS34310_lanthipeptideNZ_MQUS01000001.1 Lanthipeptides: AV521_RS02305_lanthipeptide

Lanthipeptides: SAVERM_RS38515_lanthipeptide

1

LSVLSCVSAASITLCL

16

+S+LSCVSAAS+ LCL

2

VSLLSCVSAASVLLCL

17

70.6%

NZ_CP011497.1and 4 others:

NZ_CP017248.1 Lanthipeptides: BFF78_RS03720_lanthipeptideNZ_CP034687.1 Lanthipeptides: ELQ87_RS02805_lanthipeptideNZ_CP106795.1 Lanthipeptides: N8I86_RS33235_lanthipeptideNZ_LIWA01000002.1 Lanthipeptides: AMK32_RS11185_lanthipeptide

Lanthipeptides: ABB07_RS02975_lanthipeptide

2

SVLSCVSAASITLCL

16

S+LSCVSAAS+ LCL

3

SLLSCVSAASVLLCL

17

70.6%

NZ_FKJI03000003.1:

Lanthipeptides: A7P67_RS08715_lanthipeptide

1

LSVLSCVSAASITLCL

16

LS+LSCVSA S LCL

2

LSLLSCVSAVSTLLCL

17

68.8%

NZ_KQ948929.1:

Lanthipeptides: AQJ67_RS21030_lanthipeptide

2

SVLSCVSAASITLCL

16

S+L C S ASITLCL

1

SLLLCASQASITLCL

15

66.7%

NZ_CP021978.1and 2 others:

NZ_CP047019.1 Lanthipeptides: A7X85_RS06550_lanthipeptideNZ_KQ257821.1 Lanthipeptides: IQ63_RS17200_lanthipeptide

Lanthipeptides: CEB94_RS37585_lanthipeptide

1

LSVLSCVSAASITLCL

16

LS+LSC+SAAS+ LCL

3

LSLLSCISAASVLLCL

18

64.7%

NZ_AUKV01000001.1and 33 others:

NZ_BMSE01000001.1 Lanthipeptides: IE153_RS00140_lanthipeptideNZ_BMTM01000009.1 Lanthipeptides: IE213_RS27820_lanthipeptideNZ_BMUK01000002.1 Lanthipeptides: IE276_RS03565_lanthipeptideNZ_BMUO01000001.1 Lanthipeptides: IE232_RS00145_lanthipeptideNZ_BMWC01000009.1 Lanthipeptides: IE255_RS28335_lanthipeptideNZ_BNBR01000001.1 Lanthipeptides: IE308_RS02895_lanthipeptideNZ_CP015098.1 Lanthipeptides: A4E84_RS37870_lanthipeptideNZ_CP023694.1 Lanthipeptides: CP976_RS39235_lanthipeptideNZ_CP026121.1 Lanthipeptides: C1703_RS37710_lanthipeptideNZ_CP029788.1 Lanthipeptides: DMT42_RS35020_lanthipeptideNZ_CP041604.2 Lanthipeptides: FNV64_RS48055_lanthipeptideNZ_CP041610.2 Lanthipeptides: FNV62_RS46395_lanthipeptideNZ_CP041611.1 Lanthipeptides: FNV63_RS47280_lanthipeptideNZ_CP041613.2 Lanthipeptides: FNV68_RS48480_lanthipeptideNZ_CP041650.2 Lanthipeptides: FNV59_RS47040_lanthipeptideNZ_CP049780.1 Lanthipeptides: G7Z13_RS32285_lanthipeptideNZ_CP049838.1 Lanthipeptides: G9272_RS40085_lanthipeptideNZ_CP075896.1 Lanthipeptides: KJK29_RS01685_lanthipeptideNZ_CP094344.1 Lanthipeptides: MQE23_RS40865_lanthipeptideNZ_GG657757.1 Lanthipeptides: SSQG_RS35880_lanthipeptideNZ_JACHCX010000007.1 Lanthipeptides: HDC93_RS16065_lanthipeptideNZ_JACHGV010000013.1 Lanthipeptides: HNR57_RS32395_lanthipeptideNZ_JACHXE010000001.1 Lanthipeptides: FHS41_RS01865_lanthipeptideNZ_JAPJYN010000013.1 Lanthipeptides: OR263_RS25210_lanthipeptideNZ_KB911710.1 Lanthipeptides: H294_RS0120310_lanthipeptideNZ_KQ948484.1 Lanthipeptides: AQJ27_RS46770_lanthipeptideNZ_KQ948484.1 Lanthipeptides: AQJ27_RS46770_lanthipeptideNZ_KZ671983.1 Lanthipeptides: BV882_RS30460_lanthipeptideNZ_LIVZ01000003.1 Lanthipeptides: AMK31_RS09050_lanthipeptideNZ_LMEQ01000023.1 Lanthipeptides: ASD48_RS25330_lanthipeptideNZ_LMIZ01000012.1 Lanthipeptides: ASE41_RS11285_lanthipeptideNZ_LT963352.1 Lanthipeptides: SCNRRL3882_RS38195_lanthipeptideNZ_QFRX01000001.1 Lanthipeptides: DI272_RS05815_lanthipeptide

Lanthipeptides: H305_RS0100085_lanthipeptide

1

LSVLSCVSAASITLCL

16

+S+LSC+SAAS+ LCL

2

VSLLSCISAASVLLCL

17

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.86 out of 20.97

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.78 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

Additional weak hits (15):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 20.97 out of 32.93

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.87 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.42 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.64 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.31 out of 20.97

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.53 out of 32.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.76 out of 26.06

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.07 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.84 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.26 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.88 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.59 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.34 out of 25.88

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

AQI70_RS21110 - Class III

Cleavage pHMM score: 9.10

RODEO score: 0

Monoisotopic mass: 1488.8 Da

Molecular weight: 1489.8 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1507.8 Da N = 1; 1525.9 Da N = 2; 1543.9 Da N = 3

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KQ947989.1 - Region 4 - terpene

Download region SVG

Location: 383,162 - 405,171 nt. (total: 22,010 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

AQI70_RS21940: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

AQI70_RS21950: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

Transferases: methyltransferase

AQI70_RS21965: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

AQI70_RS21945: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001248.3	0.77	terpene	clavaric acid	Hypholoma sublateritium
BGC0002449.2	0.53	other (other)	sarasinoside	uncultured bacterium
BGC0002173.2	0.51	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0001317.3	0.46	terpene	lupeol	Lotus japonicus
BGC0002402.2	0.46	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000249.5	0.43	PKS	nogalamycin	Streptomyces nogalater
BGC0001314.3	0.42	terpene	tirucalla	Arabidopsis thaliana
BGC0000670.4	0.42	terpene	thalianol, thaliandiol, thalianin	Arabidopsis thaliana
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002561.3	0.39	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001248.3	0.77	terpene	clavaric acid	Hypholoma sublateritium
BGC0002449.2	0.53	other (other)	sarasinoside	uncultured bacterium
BGC0002173.2	0.51	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0001317.3	0.46	terpene	lupeol	Lotus japonicus
BGC0002402.2	0.46	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0000249.5	0.43	PKS	nogalamycin	Streptomyces nogalater
BGC0001314.3	0.42	terpene	tirucalla	Arabidopsis thaliana
BGC0000670.4	0.42	terpene	thalianol, thaliandiol, thalianin	Arabidopsis thaliana
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002561.3	0.39	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AQI70_RS21930: T2TS

Domain 1 (26 - 661): Type 2 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.94 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.42 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description

NZ_KQ947989.1 - Region 5 - NRP-metallophore,NRPS

Download region SVG

Location: 455,111 - 522,096 nt. (total: 66,986 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

AQI70_RS22260: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

AQI70_RS22375: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

AQI70_RS22385: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

Transferases: formyltransferase

AQI70_RS22265: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: hydrolase

AQI70_RS22255: isochorismatase

smcogs: SMCOG1027: isochorismatase

AQI70_RS22305: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: isomerase

AQI70_RS22315: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

AQI70_RS22160: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AQI70_RS22275: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS22285: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS22290: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS22320: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS40690: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001351.3	0.78	NRPS	cahuitamycin A, cahuitamycin B, cahuitamycin C	Streptomyces gandocaensis
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.72	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001351.3	0.71	NRPS	cahuitamycin A, cahuitamycin B, cahuitamycin C	Streptomyces gandocaensis
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.64 out of 26.33

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.07 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.07 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.19 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.71 out of 36.53

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 32.38 out of 32.38

Confidence: strong

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 28.54 out of 32.93

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 26.88 out of 32.38

Confidence: medium

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 26.96 out of 32.93

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 27.98 out of 32.38

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (15):

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.26 out of 27.18

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.87 out of 36.53

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.18 out of 32.74

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.33 out of 26.85

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.41 out of 28.14

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.06 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.79 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.08 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.62 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.40 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.71 out of 36.53

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.11 out of 32.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.52 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 455110 - 522096:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (D-OH-Orn) + (Ser - D-Fo-OH-Orn) + (Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS22275: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (562..953): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDLSFDLSVYDGNCLLGGDTGLGGTTETAIHSTL
Nearest Stachelhaus code(s):: Ser DLYNLGLIHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AQI70_RS40690: Ser - Fo-OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (510..920): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1571..1970): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISINELYLWCGGEYHGYGPAEATIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AQI70_RS22285: OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (467..869): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHWFDASWQPWELGVGGEHNLYGPTECTVDSAD
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AQI70_RS22290: X

AMP-binding (458..848): X

nrpys: me-bAla

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGSFIDGLTEGTAVSSGEVNLYGCSEAAGDSLI
Nearest Stachelhaus code(s):: me-bAla LDTTVSLGDK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AQI70_RS22320: X

AMP-binding (31..436): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFALACPGGAVQVGGSQQVFGMAEGLLNYTR
Nearest Stachelhaus code(s):: Sal PLPAQGVLNK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
CsoR	Copper-responsive repressor
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator
RicR	Copper-responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_KQ947992.1 - Region 1 - terpene

Download region SVG

Location: 105,176 - 126,261 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AQI70_RS28710: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

AQI70_RS28700: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

AQI70_RS28705: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.86	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000669.3	0.45	terpene	marneral	Arabidopsis thaliana
BGC0001910.4	0.41	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002012.4	0.38	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0002339.3	0.37	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.86	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000669.3	0.45	terpene	marneral	Arabidopsis thaliana
BGC0001910.4	0.41	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.38	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002012.4	0.38	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0002339.3	0.37	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

AQI70_RS28705: T1TS

Domain 1 (4 - 339): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.12 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (6):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.01 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.00 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.49 out of 25.75

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.70 out of 30.12

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.57 out of 36.53

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NrdR	Represses ribonucleotide reductase encoding genes

NZ_KQ947992.1 - Region 2 - terpene-precursor

Download region SVG

Location: 142,745 - 163,893 nt. (total: 21,149 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

AQI70_RS28870: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000677.5	0.38	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.34	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001605.3	0.32	terpene	gibberellin	Sinorhizobium fredii NGR234

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000677.5	0.38	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.34	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001605.3	0.32	terpene	gibberellin	Sinorhizobium fredii NGR234

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AQI70_RS28870: PT_FPPS_like

Domain 1 (91 - 381): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (5):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.43 out of 24.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.85 out of 26.12

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.29 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_KQ947992.1 - Region 3 - NRPS

Download region SVG

Location: 211,679 - 268,358 nt. (total: 56,680 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AQI70_RS29305: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Hydrolases: esterase

AQI70_RS29225: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

AQI70_RS29220: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AQI70_RS29230: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AQI70_RS29235: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS29240: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS29245: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AQI70_RS29255: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.77 out of 27.55

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.48 out of 20.97

Confidence: medium

Additional weak hits (11):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.99 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.09 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.38 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.82 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.46 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.99 out of 29.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.36 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 211678 - 268358:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (D-Pro) + (Val) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS29235: X

AMP-binding (505..890): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNVVFDVAVSDFFLAVGGEVNAYGPSEATVYSTT
Nearest Stachelhaus code(s):: Trp DVSQVGAVAK (65% 8Å match); Leu or Ile DAFFNGAVYK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

AQI70_RS29240: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (445..830): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDAATYEVWLWAGGDVNGYGPTETTVFATA
Nearest Stachelhaus code(s):: Val DAYWWGGVFK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AQI70_RS29245: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (511..896): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LGLGFDISVAELLLAVGAEHNAYGPSECTVAATV
Nearest Stachelhaus code(s):: Leu DAMLAGAVAK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AQI70_RS29255: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (7..458): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGQSWDAFALEGYLIVGGESNGYGPVEGMVFLTV
Nearest Stachelhaus code(s):: Val DALWIGGVFK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
GnfM	Regulator of nitrogen-fixation genes

NZ_KQ947992.1 - Region 4 - T2PKS

Download region SVG

Location: 301,950 - 374,480 nt. (total: 72,531 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AQI70_RS29515: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

AQI70_RS29705: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

AQI70_RS29710: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase

AQI70_RS29585: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: cyclase

AQI70_RS29690: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

AQI70_RS29695: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: synthase

AQI70_RS29675: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AQI70_RS29680: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transporter

AQI70_RS29810: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000215.5	0.79	PKS	curamycin	Streptomyces cyaneus
BGC0000272.3	0.75	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.69	PKS	spore pigment	Streptomyces avermitilis
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001512.5	0.55	PKS	BE-24566B	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000215.5	0.79	PKS	curamycin	Streptomyces cyaneus
BGC0000272.3	0.75	PKS	spore pigment	Streptomyces collinus
BGC0000271.5	0.69	PKS	spore pigment	Streptomyces avermitilis
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001723.5	0.57	PKS	oviedomycin	Streptomyces antibioticus
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001512.5	0.55	PKS	BE-24566B	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (17):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.11 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.93 out of 19.26

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.95 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.12 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.13 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.42 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.06 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.65 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.98 out of 21.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.16 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.79 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.38 out of 29.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.72 out of 27.04

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 301949 to 374480
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

AQI70_RS29670: CYC C5-C18 (Score: 220.0; E-value: 1.8e-68)
AQI70_RS29675: KS (Score: 738.0; E-value: 6.4e-225)
AQI70_RS29680: CLF (Score: 550.2; E-value: 6.3e-168)
AQI70_RS29685: ACP (Score: 77.4; E-value: 1.5e-24)
AQI70_RS29690: CYC C9-C14 (Score: 257.0; E-value: 1.1e-79)
AQI70_RS29695: CYC C4-C21/C2-C23|C2-C19 (Score: 161.7; E-value: 1.1e-50)
AQI70_RS29705: OXY (Score: 285.7; E-value: 1.7e-87)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_KQ947994.1 - Region 1 - NI-siderophore

Download region SVG

Location: 67,536 - 97,308 nt. (total: 29,773 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AQI70_RS31820: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

AQI70_RS31840: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

AQI70_RS31870: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase carboxylase transferase

AQI70_RS31750: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

AQI70_RS31850: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

AQI70_RS31855: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: decarboxylase

AQI70_RS31825: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

AQI70_RS31845: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.86	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.57	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.86	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.63	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.57	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.53 out of 36.53

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 23.43

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.03 out of 27.04

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.71 out of 24.78

Confidence: medium

Additional weak hits (7):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.33 out of 31.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.45 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.23 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.45 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.56 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
LexA variant 2	Repressor of DNA damage response

NZ_KQ947994.1 - Region 2 - melanin

Download region SVG

Location: 193,998 - 204,495 nt. (total: 10,498 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AQI70_RS32355: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

AQI70_RS32365: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: dehydratase

AQI70_RS32360: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.81	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.65	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.44	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000885.3	0.44	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000662.5	0.39	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000910.3	0.81	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000911.3	0.80	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000909.3	0.65	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.44	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000885.3	0.44	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0002218.2	0.39	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0000662.5	0.39	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.94 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.09 out of 23.79

Confidence: medium

Additional weak hits (3):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.18 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.42 out of 20.01

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_KQ947994.1 - Region 3 - NRPS,PKS-like

Download region SVG

Location: 206,514 - 256,951 nt. (total: 50,438 nt) Show pHMM detection rules used

Region on contig edge.

PKS-like: (t2pks2 or ksIII)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AQI70_RS32400: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AQI70_RS32425: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

AQI70_RS32440: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

AQI70_RS32460: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: esterase hydrolase

AQI70_RS32405: isochorismatase

smcogs: SMCOG1027: isochorismatase

AQI70_RS32535: thioesterase

smcogs: SMCOG1004: thioesterase

AQI70_RS32580: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Isomerases: isomerase

AQI70_RS32385: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

AQI70_RS32410: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

AQI70_RS32435: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AQI70_RS32465: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

AQI70_RS32515: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

AQI70_RS32585: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AQI70_RS32590: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001561.4	1.36	NRPS	curacomycin	Streptomyces curacoi
BGC0001249.5	0.41	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.36	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.35	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001569.4	0.35	NRPS	dechlorocuracomycin	Streptomyces noursei ATCC 11455
BGC0001135.5	0.34	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.34	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.34	NRPS	peramine	Epichloe festucae
BGC0001641.4	0.33	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.33	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001561.4	0.98	NRPS	curacomycin	Streptomyces curacoi
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.22 out of 20.97

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.88 out of 20.97

Confidence: medium

Additional weak hits (9):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.51 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.91 out of 32.74

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.46 out of 39.62

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.39 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.26 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.41 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.67 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.74 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.68 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 206513 - 256951:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 231283 - 256951:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS32445: X

AMP-binding (91..318): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHSIGPHMVGAQMLMWVGTCSGFGNTMTLGHVSE
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AQI70_RS32585: X - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (23..415): X

nrpys: 6-clTrp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHAFDVSIADQMIATGGEFNAYGPTEATVTATM
Nearest Stachelhaus code(s):: 6-clTrp DVAMAGAVTK (97% 8Å match); 5-clTrp DVAMAGAVTK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1087..1485): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: VHTAFDAATFEGWLLAGGDINGYGPTETTTFAAA
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_KQ947996.1 - Region 1 - NRPS,T1PKS

Download region SVG

Location: 14,700 - 98,112 nt. (total: 83,413 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase reductase

AQI70_RS33640: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

AQI70_RS33665: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

AQI70_RS33685: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

AQI70_RS33725: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

AQI70_RS33770: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AQI70_RS33775: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AQI70_RS33860: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

AQI70_RS33890: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: hydrolase

AQI70_RS33830: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

AQI70_RS33820: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

AQI70_RS33730: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AQI70_RS33810: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS33815: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transporter

AQI70_RS33710: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002277.2	0.61	NRPS	atromentin	Suillus grevillei
BGC0001163.3	0.47	PKS	1-heptadecene	Moorea producens 3L
BGC0001161.5	0.47	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001276.3	0.45	PKS	6-methylsalicyclic acid	Aspergillus terreus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001160.5	0.67	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.82 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.17 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.89 out of 27.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.53 out of 30.25

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.96 out of 36.53

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.14 out of 36.54

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.83 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.88 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.17 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.40 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.97 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.42 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 14699 - 98112:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - ohmal - X) + (Me-ccmal - Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS33730: fatty_acid - mal - X

CAL_domain (152..455): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 57.3
NH2: 51.2
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1233..1521): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Ethylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 141.0
Methylmalonyl-CoA: 80.7
Methoxymalonyl-CoA: 79.5
Ethylmalonyl-CoA: 51.1
inactive: 48.8
Propionyl-CoA: 48.7
Isobutyryl-CoA: 33.9
CHC-CoA: 30.0
2-Methylbutyryl-CoA: 29.3
fatty_acid: 21.8
Acetyl-CoA: 17.8
trans-1,2-CPDA: 12.6
Benzoyl-CoA: 9.3
3-Methylbutyryl-CoA: 4.7

AMP-binding (2639..3053): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWSAFDASVRQASSHVGGESNLYGPTEATINATC
Nearest Stachelhaus code(s):: Gln DACSTGVINK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AQI70_RS33810: NH2

CAL_domain (37..484): NH2

minowa: NH2

Prediction, score:

NH2: 175.1
AHBA: 10.6
fatty_acid: 4.2
shikimic_acid: 0.1
Acetyl-CoA: -3.8

AQI70_RS33815: mmal - mmal

PKS_AT (642..933): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 205.4
Ethylmalonyl-CoA: 191.7
Methoxymalonyl-CoA: 171.3
2-Methylbutyryl-CoA: 142.8
trans-1,2-CPDA: 130.2
Propionyl-CoA: 105.2
Malonyl-CoA: 101.0
CHC-CoA: 91.1
Isobutyryl-CoA: 76.6
Benzoyl-CoA: 69.3
Acetyl-CoA: 50.7
3-Methylbutyryl-CoA: 36.3
inactive: 30.6
fatty_acid: 21.4

PKS_AT (2368..2664): mmal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 66.7%; Methylmalonyl-CoA: 66.7%; Propionyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 140.8
Methoxymalonyl-CoA: 136.9
Ethylmalonyl-CoA: 129.4
Malonyl-CoA: 94.2
trans-1,2-CPDA: 85.4
2-Methylbutyryl-CoA: 83.2
Propionyl-CoA: 61.0
Isobutyryl-CoA: 57.7
3-Methylbutyryl-CoA: 50.3
CHC-CoA: 50.1
Benzoyl-CoA: 36.7
fatty_acid: 26.6
Acetyl-CoA: 18.8
inactive: 17.2

TFBS definitions

Regulator	Description

NZ_KQ947999.1 - Region 1 - NRPS

Download region SVG

Location: 16,957 - 60,799 nt. (total: 43,843 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AQI70_RS35725: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Hydrolases: glucanase

AQI70_RS35645: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Lyases: hydratase lyase

AQI70_RS35660: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

AQI70_RS35730: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

AQI70_RS35705: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS35715: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.65	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.99 out of 29.72

Confidence: medium

Additional weak hits (8):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.70 out of 23.43

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.70 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.52 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.73 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.99 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 16956 - 60799:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS35705: X

AMP-binding (12..401): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LASTVDSTMHDMEIITGGSANGYGPTEASVAATW
Nearest Stachelhaus code(s):: Lys DVFESGGVAK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AQI70_RS35715: X

AMP-binding (472..865): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGAGFDVAVLEAKLVVGGDTASYGPTECTVLATV
Nearest Stachelhaus code(s):: Glu DVLKVGAVNK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_KQ948000.1 - Region 1 - lanthipeptide-class-iii

Download region SVG

Location: 2,010 - 24,649 nt. (total: 22,640 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

AQI70_RS36130: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.62	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.57	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.57	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.57	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002391.2	0.52	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000553.3	0.50	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.62	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.57	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.57	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.57	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0002391.2	0.52	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0000553.3	0.50	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.91 out of 27.04

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.52 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.98 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.71 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.11 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.90 out of 24.78

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KQ948001.1 - Region 1 - terpene-precursor

Download region SVG

Location: 17,276 - 33,200 nt. (total: 15,925 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

AQI70_RS38200: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	0.30	ribosomal	curacozole	Streptomyces curacoi
BGC0001735.5	0.27	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000213.4	0.21	PKS	colabomycin E	Streptomyces aureus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002013.4	0.30	ribosomal	curacozole	Streptomyces curacoi
BGC0001735.5	0.27	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0000213.4	0.21	PKS	colabomycin E	Streptomyces aureus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

AQI70_RS38200: PT_FPPS_like

Domain 1 (754 - 1,036): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 28.54 out of 32.93

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.64 out of 26.33

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 32.38 out of 32.38

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (6):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.50 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.22 out of 26.06

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.11 out of 32.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.13 out of 23.43

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.87 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
CsoR	Copper-responsive repressor
RicR	Copper-responsive regulator

NZ_KQ948006.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 7,236 nt. (total: 7,236 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

AQI70_RS36730: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.67	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 7236:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - Leu)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

AQI70_RS36730: Leu - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (627..1015): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GGLTFDVSVFETSTVFAGEVNAYGQSETFYATTF
Nearest Stachelhaus code(s):: Leu DVFSVAAYAK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1667..2055): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: GALTFDVSLFETSTVLAGEINAYGQSESFYASAF
Nearest Stachelhaus code(s):: Leu DVFSVAAYAK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

NZ_KQ948009.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 3,838 nt. (total: 3,838 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

AQI70_RS36780: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AQI70_RS36785: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.59	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

AQI70_RS36780: X

AMP-binding (428..821): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LVPAFDASVLETLILVGAEVNGYGPTEATIGATF
Nearest Stachelhaus code(s):: Leu DAILLGGIAK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)