GCF_001012775.1 - 17 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_LDCN01000001.1 (Brevibacillus formosus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS,transAT-PKS,T1PKS	1	142,541
Region 1.2	transAT-PKS,NRPS	280,968	357,916
Region 1.3	NRPS,transAT-PKS-like	373,210	433,516
Region 1.4	T3PKS	671,059	712,123
Region 1.5	terpene	815,318	837,216
Region 1.6	NRPS,transAT-PKS,cyclic-lactone-autoinducer	974,027	1,085,394	Low	aurantinin B/aurantinin C/aurantinin D	PKS

NZ_LDCN01000002.1 (Brevibacillus formosus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	terpene-precursor	244,883	265,785
Region 12.2	azole-containing-RiPP	609,734	633,304
Region 12.3	NRPS	708,606	782,324	High	tyrocidine	NRPS:Type I
Region 12.4	opine-like-metallophore	785,073	807,214	High	bacillopaline	other:other
Region 12.5	NRPS	856,279	957,155	High	gramicidin	NRPS:Type I
Region 12.6	NRPS,T1PKS	958,675	997,053	Low	paenilamicin/paenilamicin A2/paenilamicin B1/paenilamicin B2	NRPS:Type I+PKS

NZ_LDCN01000003.1 (Brevibacillus formosus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	lanthipeptide-class-i	799,261	823,785

NZ_LDCN01000005.1 (Brevibacillus formosus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 22.1	NRP-metallophore,NRPS	130,960	191,467	High	ulbactin F/ulbactin G	NRPS:Type I
Region 22.2	RiPP-like	456,122	466,970

NZ_LDCN01000006.1 (Brevibacillus formosus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 23.1	RRE-containing	151,988	173,142

NZ_LDCN01000007.1 (Brevibacillus formosus)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	NI-siderophore	25,610	57,347	High	petrobactin	other:other

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NRPS,transAT-PKS,T1PKS	1	142,541
Region 1.2	transAT-PKS,NRPS	280,968	357,916
Region 1.3	NRPS,transAT-PKS-like	373,210	433,516
Region 1.4	T3PKS	671,059	712,123
Region 1.5	terpene	815,318	837,216
Region 1.6	NRPS,transAT-PKS,cyclic-lactone-autoinducer	974,027	1,085,394	Low	aurantinin B/aurantinin C/aurantinin D	PKS
Region 12.1	terpene-precursor	244,883	265,785
Region 12.2	azole-containing-RiPP	609,734	633,304
Region 12.3	NRPS	708,606	782,324	High	tyrocidine	NRPS:Type I
Region 12.4	opine-like-metallophore	785,073	807,214	High	bacillopaline	other:other
Region 12.5	NRPS	856,279	957,155	High	gramicidin	NRPS:Type I
Region 12.6	NRPS,T1PKS	958,675	997,053	Low	paenilamicin/paenilamicin A2/paenilamicin B1/paenilamicin B2	NRPS:Type I+PKS
Region 20.1	lanthipeptide-class-i	799,261	823,785
Region 22.1	NRP-metallophore,NRPS	130,960	191,467	High	ulbactin F/ulbactin G	NRPS:Type I
Region 22.2	RiPP-like	456,122	466,970
Region 23.1	RRE-containing	151,988	173,142
Region 24.1	NI-siderophore	25,610	57,347	High	petrobactin	other:other

No secondary metabolite regions were found in these records:: NZ_LDCN01000010.1 (Brevibacillus formosus); NZ_LDCN01000011.1 (Brevibacillus formosus); NZ_LDCN01000012.1 (Brevibacillus formosus); NZ_LDCN01000013.1 (Brevibacillus formosus); NZ_LDCN01000014.1 (Brevibacillus formosus); NZ_LDCN01000015.1 (Brevibacillus formosus); NZ_LDCN01000016.1 (Brevibacillus formosus); NZ_LDCN01000017.1 (Brevibacillus formosus); NZ_LDCN01000018.1 (Brevibacillus formosus); NZ_LDCN01000019.1 (Brevibacillus formosus); NZ_LDCN01000020.1 (Brevibacillus formosus); NZ_LDCN01000021.1 (Brevibacillus formosus); NZ_LDCN01000022.1 (Brevibacillus formosus); NZ_LDCN01000023.1 (Brevibacillus formosus); NZ_LDCN01000024.1 (Brevibacillus formosus); NZ_LDCN01000025.1 (Brevibacillus formosus); NZ_LDCN01000026.1 (Brevibacillus formosus); NZ_LDCN01000004.1 (Brevibacillus formosus); NZ_LDCN01000008.1 (Brevibacillus formosus); NZ_LDCN01000009.1 (Brevibacillus formosus)

Compact view

NZ_LDCN01000001.1 - Region 1 - NRPS,T1PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1 - 142,541 nt. (total: 142,541 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

AA984_RS00075: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

AA984_RS00145: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: PPTase acetyltransferase acylase aminotransferase

AA984_RS00110: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AA984_RS00155: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

AA984_RS00175: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

AA984_RS00180: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

AA984_RS00085: thioesterase

smcogs: SMCOG1004: thioesterase

AA984_RS00095: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

AA984_RS00010: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00020: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00025: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AA984_RS00030: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00040: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00045: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00050: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00090: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00105: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00115: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00120: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AA984_RS00125: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00130: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00135: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS00160: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AA984_RS00165: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS00170: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS28815: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	2.11	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.96	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	1.96	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	1.93	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.92	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	1.90	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	1.89	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	1.84	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	1.76	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	1.71	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.71	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 26.79 out of 30.25

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.58 out of 20.97

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.28 out of 25.88

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.10 out of 26.06

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.79 out of 20.97

Confidence: medium

Additional weak hits (5):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 24.51 out of 36.54

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.75 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.10 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.41 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 142541:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (Thr) + (Gly - Cys) + (ohmal - ohmal) + (ohmal - Gly) + (pk) + (X) + (ohmal - Gly) + (ccmal) + (ccmal) + (ccmal - Gly) + (ccmal) + (ccmal) + (Ser) + (X) + (X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 33613:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (Thr) + (Gly - Cys) + (ohmal - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AA984_RS00010: mal

PKS_AT (535..825): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 58.3%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 97.5
Methoxymalonyl-CoA: 62.2
Methylmalonyl-CoA: 47.7
inactive: 46.8
Propionyl-CoA: 32.7
Isobutyryl-CoA: 16.9
Benzoyl-CoA: 16.4
2-Methylbutyryl-CoA: 15.3
Ethylmalonyl-CoA: 12.0
CHC-CoA: 9.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AA984_RS00025: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (269..669): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHEHFDFSVWEGNQIFGGEINMYGITETTVHTTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS00030: Gly - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (1850..2242): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGITFDIFWLELQTLIGGEYNLYGPTETTIWSTI
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2904..3288): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSMLSGDVSLGGATEASIWSIY
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS00045: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (1705..2127): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWGTFDISVFEGHSMLGGEHNMYGPTETTIWISS
Nearest Stachelhaus code(s):: Gly DIFHMGMIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS00050: pk

PKS_AT (530..719): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 31.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
Malonyl-CoA: -2.0

AA984_RS00090: X

AMP-binding (2189..2596): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YQFTHAIGILDGHSLLGGEVNFLGCSELMVISFF
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

AA984_RS00105: mal - Gly

Search NORINE for peptide: strict or relaxed

PKS_AT (531..817): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 80.5
inactive: 56.7
Methoxymalonyl-CoA: 44.1
Methylmalonyl-CoA: 24.4
Propionyl-CoA: 5.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

AMP-binding (1974..2368): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIFGLELQALCGGEWNMYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS00110: mal

PKS_AT (6..293): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 97.1
inactive: 43.5
Methoxymalonyl-CoA: 18.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

AA984_RS00125: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (2007..2428): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWSTFDISVFEGHSLIGGEYNMYGPTEATIWATC
Nearest Stachelhaus code(s):: Gly DIFHMGMIWK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AA984_RS00160: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (553..963): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSLWEGHFFASGEINLYGPTETTVEVSW
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AA984_RS00165: X

AMP-binding (281..683): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWYAFDLAQKNANCFLGGEVNTYGPTECTDIASY
Nearest Stachelhaus code(s):: Hse DLKNVGSDVK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AA984_RS00170: X - X

AMP-binding (99..501): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWYAFDLAQKNANCFLGGEVNTYGPTECTDIASY
Nearest Stachelhaus code(s):: Hse DLKNVGSDVK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1141..1543): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWYAFDLAQKNANCFLGGEVNTYGPTECTDIASY
Nearest Stachelhaus code(s):: Hse DLKNVGSDVK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator

NZ_LDCN01000001.1 - Region 2 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 280,968 - 357,916 nt. (total: 76,949 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AA984_RS01000: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

AA984_RS01015: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acetyltransferase acylase aminotransferase phosphorylase

AA984_RS01065: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AA984_RS01090: aminotransferase

smcogs: SMCOG1019: aminotransferase

AA984_RS01195: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

AA984_RS01200: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

AA984_RS01215: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: deaminase hydrolase

AA984_RS00960: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

AA984_RS00965: isochorismatase

smcogs: SMCOG1027: isochorismatase

AA984_RS01030: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AA984_RS01040: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Ligases: ligase synthase

AA984_RS01045: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

AA984_RS01060: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS01070: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS01075: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AA984_RS01080: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS01085: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS01095: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS01105: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.89	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.87	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.83	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.81	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.79	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.79	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.76	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

Additional weak hits (8):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.31 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.72 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.49 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.48 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.96 out of 30.22

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.65 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.12 out of 30.98

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 280967 - 357916:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (X) + (X - X) + (X) + (Me-ccmal - Gly) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AA984_RS01065: mal

PKS_AT (6..287): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 108.6
Methoxymalonyl-CoA: 47.2
Methylmalonyl-CoA: 39.6
inactive: 34.4
Propionyl-CoA: 24.2
Acetyl-CoA: 11.7
2-Methylbutyryl-CoA: 10.7
Ethylmalonyl-CoA: 10.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AA984_RS01070: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (2094..2487): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGITFDIFLLEVQLLIGGEYNLYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS01075: X

AMP-binding (276..677): X

nrpys: Ser, Thr, Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTYDSSVWQWDFILGGETNLYGPTETSIGVVY
Nearest Stachelhaus code(s):: Glu DVWHIGSIGK (71% 8Å match); Orn DVWNIGLIHK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AA984_RS01080: X

AMP-binding (275..693): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQAEVAVTGEVNMYGPTEASDDITH
Nearest Stachelhaus code(s):: Dpr DIWEMTADDK (91% 8Å match); Dab DIWELTADDK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AA984_RS01085: X

AMP-binding (44..463): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TWLTFTDSVWEWQFFNGGEANIYGMTESAIYASV
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (59% 8Å match)
Stachelhaus code match:: 60% (weak)

AA984_RS01095: X

AMP-binding (470..865): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AWHAFDASVVECLVLCTGEYNLYGPTENSISASG
Nearest Stachelhaus code(s):: Hpg DAVHLGLLCK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

AA984_RS01105: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (466..859): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSCKLIVGGELNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_LDCN01000001.1 - Region 3 - NRPS,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 373,210 - 433,516 nt. (total: 60,307 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

AA984_RS01310: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

AA984_RS01345: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

AA984_RS01380: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

AA984_RS01455: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase sulfhydrylase

AA984_RS01305: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

AA984_RS01440: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: protease

AA984_RS01320: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase synthase

AA984_RS01365: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS01370: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.67	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.23 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.06 out of 26.06

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.13 out of 20.97

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.71 out of 26.33

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.02 out of 23.79

Confidence: medium

Additional weak hits (7):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.42 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.83 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.97 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 20.91 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.13 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.03 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 373209 - 433516:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - mal - Orn - D-X) + (Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AA984_RS01365: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (473..866): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LFFAFDASVWEMTLITAGSINAYGPTETTICATT
Nearest Stachelhaus code(s):: Phe DAWTIAAICK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS01370: fatty_acid - Orn - X

Search NORINE for peptide: strict or relaxed

CAL_domain (34..480): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 246.6
NH2: 37.6
Acetyl-CoA: 8.1
shikimic_acid: 0.0
AHBA: 0.0

AMP-binding (3091..3492): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: VTWAFDVFAGDRESILGSDINSYGVTEAAIDSSY
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4137..4537): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTYDSAIWQWDFIIGGETNLYGPTEASIGCIA
Nearest Stachelhaus code(s):: Glu DVWHIGSIGK (62% 8Å match); Orn DVWNIGLIHK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
MogR	Repressor of flagellar motility genes

NZ_LDCN01000001.1 - Region 4 - T3PKS

Download region GenBank file

Download region SVG

Location: 671,059 - 712,123 nt. (total: 41,065 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase methyltransferase

AA984_RS02785: isoprenylcysteine carboxyl methyltransferase

smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

AA984_RS02885: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: peptidase

AA984_RS02830: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Lyases: cyclase dehydratase

AA984_RS02775: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

AA984_RS02825: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

AA984_RS02780: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.62	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000779.3	0.47	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0001962.3	0.46	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0000249.5	0.39	PKS	nogalamycin	Streptomyces nogalater
BGC0001647.3	0.38	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001964.2	0.36	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000763.5	0.36	saccharide	stewartan	Pantoea stewartii subsp. stewartii DC283
BGC0001760.5	0.32	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.62	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.51	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000779.3	0.47	saccharide	lipopolysaccharide	Aeromonas piscicola
BGC0001962.3	0.46	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002332.2	0.42	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0000249.5	0.39	PKS	nogalamycin	Streptomyces nogalater
BGC0001647.3	0.38	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001964.2	0.36	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000763.5	0.36	saccharide	stewartan	Pantoea stewartii subsp. stewartii DC283
BGC0001760.5	0.32	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.86 out of 26.06

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.45 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.11 out of 27.55

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.54 out of 18.46

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.86 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.52 out of 26.06

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.57 out of 23.79

Confidence: medium

Additional weak hits (5):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.02 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.61 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.49 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.46 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.18 out of 26.06

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

NZ_LDCN01000001.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 815,318 - 837,216 nt. (total: 21,899 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

AA984_RS03475: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000663.5	0.30	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001791.4	0.30	NRPS	sunshinamide	Gynuella sunshinyii YC6258
BGC0002675.2	0.28	PKS	prodigiosin	Pseudoalteromonas rubra
BGC0000258.3	0.28	PKS	prodigiosin	Serratia sp.
BGC0002667.2	0.28	ribosomal	estericin A	Clostridium estertheticum
BGC0002386.2	0.27	NRPS, PKS	cyclo(n-Me-L-Leu-L-Val), cyclo(n-Me-L-Leu-L-Leu), cyclo(n-Me-L-Leu-L-Ile)	Sorangium cellulosum So0157-2
BGC0000969.5	0.26	NRPS, PKS	chondramide A	Chondromyces crocatus
BGC0000765.3	0.25	saccharide	exopolysaccharide	Lactobacillus johnsonii
BGC0001591.4	0.25	other (other)	fatty acid enol ester, N-tetradecanoyl tyrosine	uncultured bacterium CSLC2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.47	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000663.5	0.30	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001791.4	0.30	NRPS	sunshinamide	Gynuella sunshinyii YC6258
BGC0002675.2	0.28	PKS	prodigiosin	Pseudoalteromonas rubra
BGC0000258.3	0.28	PKS	prodigiosin	Serratia sp.
BGC0002667.2	0.28	ribosomal	estericin A	Clostridium estertheticum
BGC0002386.2	0.27	NRPS, PKS	cyclo(n-Me-L-Leu-L-Val), cyclo(n-Me-L-Leu-L-Leu), cyclo(n-Me-L-Leu-L-Ile)	Sorangium cellulosum So0157-2
BGC0000969.5	0.26	NRPS, PKS	chondramide A	Chondromyces crocatus
BGC0000765.3	0.25	saccharide	exopolysaccharide	Lactobacillus johnsonii
BGC0001591.4	0.25	other (other)	fatty acid enol ester, N-tetradecanoyl tyrosine	uncultured bacterium CSLC2

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

AA984_RS03425: T2TS

Domain 1 (2 - 628): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

Additional weak hits (4):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.13 out of 29.72

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.78 out of 26.12

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.16 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.19 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
ToxT	Regulator of MSHA biosynthesis

NZ_LDCN01000001.1 - Region 6 - NRPS,cyclic-lactone-autoinducer,transAT-PKS

Download region GenBank file

Download region SVG

Location: 974,027 - 1,085,394 nt. (total: 111,368 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

AA984_RS04290: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

AA984_RS04440: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: PPTase acetyltransferase acylase methyltransferase

AA984_RS04240: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

AA984_RS04310: methyltransferase

smcogs: SMCOG1089: methyltransferase

AA984_RS04335: methyltransferase

smcogs: SMCOG1089: methyltransferase

AA984_RS04345: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

AA984_RS04350: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

AA984_RS04300: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

AA984_RS04340: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AA984_RS04425: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Ligases: ligase synthase

AA984_RS04305: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AA984_RS04315: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

AA984_RS04320: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AA984_RS04325: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

AA984_RS04330: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.84	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.72	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.88 out of 26.06

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.64 out of 24.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.38 out of 26.06

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.05 out of 18.16

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.53 out of 29.38

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.10 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 26.44 out of 28.19

Confidence: strong

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.47 out of 20.01

Confidence: medium

Additional weak hits (11):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.88 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.83 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.85 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.66 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.69 out of 29.38

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.19 out of 29.51

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.28 out of 32.93

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.01 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.55 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.51 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 974026 - 1085394:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ccmal) + (mal - ccmal - mal) + (Ala - ohmal - ccmal - ccmal - ohmal - mal) + (mal - ccmal) + (OMe-mal - mal) + (NMe-Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AA984_RS04305: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (523..922): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVTY
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS04320: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (500..909): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TFLTFDVSLSEGNFMVAGEENIYGPTEASIYAAW
Nearest Stachelhaus code(s):: Ala DVSNMAIIYK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS04345: mal - mal

PKS_AT (7..294): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 59.9
inactive: 25.2
Isobutyryl-CoA: 22.0
Methylmalonyl-CoA: 13.2
Methoxymalonyl-CoA: 12.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (334..612): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 106.4
inactive: 36.8
Methoxymalonyl-CoA: 31.2
Methylmalonyl-CoA: 23.4
Propionyl-CoA: 17.8
Isobutyryl-CoA: 8.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
ArgR	Regulator of arginine biosynthesis genes
FuR variant 1	Ferric Uptake Regulator
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_LDCN01000002.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 244,883 - 265,785 nt. (total: 20,903 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

AA984_RS06190: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

AA984_RS06235: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

AA984_RS06245: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000668.5	0.36	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000639.3	0.38	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000665.5	0.37	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000668.5	0.36	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

AA984_RS06235: PT_FPPS_like

Domain 1 (35 - 300): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: DMAPP, IPP → FPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.87 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_LDCN01000002.1 - Region 2 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 609,734 - 633,304 nt. (total: 23,571 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

AA984_RS08040: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002488.3	0.51	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0001638.4	0.51	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002487.3	0.50	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0001174.4	0.44	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000569.5	0.43	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001173.5	0.43	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000410.5	0.42	NRPS	pseudomonine	Pseudomonas fluorescens
BGC0002285.2	0.41	ribosomal	aborycin	Streptomyces sp. ZS0098

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002488.3	0.51	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0001638.4	0.51	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002487.3	0.50	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0001174.4	0.44	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0000569.5	0.43	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001173.5	0.43	ribosomal	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000607.5	0.43	ribosomal	micrococcin P1	Macrococcus caseolyticus
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000410.5	0.42	NRPS	pseudomonine	Pseudomonas fluorescens
BGC0002285.2	0.41	ribosomal	aborycin	Streptomyces sp. ZS0098

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.35 out of 20.97

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.61 out of 29.38

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.00 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.95 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.06 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.71 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.83 out of 36.53

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.12 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.65 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.31 out of 25.88

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Heterocycloanthracin_C_RRE; Location: 1 - 92; Score: 125.6; RRE type: Thiopeptide_F_RRE; Location: 0 - 81; Score: 41.7

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
ZuR variant 1	Zinc-responsive repressor

Core peptide predictions

No core peptides found.

NZ_LDCN01000002.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 708,606 - 782,324 nt. (total: 73,719 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase

AA984_RS08515: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase hydrolase

AA984_RS08520: thioesterase

smcogs: SMCOG1004: thioesterase

AA984_RS08550: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AA984_RS08590: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

AA984_RS08490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS08495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS08500: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000452.5	0.80	NRPS	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000426.5	0.76	NRPS	sevadicin	Paenibacillus larvae
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000452.5	0.80	NRPS	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000426.5	0.76	NRPS	sevadicin	Paenibacillus larvae
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.88 out of 27.78

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 25.78 out of 30.25

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.04 out of 26.06

Confidence: medium

Additional weak hits (6):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.74 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.59 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.34 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.80 out of 31.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.88 out of 27.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.92 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 708605 - 782324:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Phe) + (Pro - Phe - D-Leu) + (Asn - Gln - Tyr - Val - Orn - Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AA984_RS08490: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (37..430): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LFFAFDASVWEMTLITAGSVNAYGPTETSICATI
Nearest Stachelhaus code(s):: Phe DAWTIAAICK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS08495: Pro - Phe - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (472..870): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LFTTFDVCYQESSLITAGEHNHYGPSETHVVTTY
Nearest Stachelhaus code(s):: Pro DVQSIAHVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1512..1906): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SWNLFDAFALTAVCMLGGEINAYGPTESSVIATY
Nearest Stachelhaus code(s):: Phe DALVMGAVIK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2944): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: CWRFFDGFVASAYGSLGGENNEYGPTENSVVSTI
Nearest Stachelhaus code(s):: Leu DGAYTGEVVK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

AA984_RS08500: Asn - Gln - Tyr - Val - Orn - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (477..870): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSTKLIVGGEFNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1512..1907): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDASVWELQMFCGGEINLYGPTESTIDATY
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2549..2945): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: SWKLFDGFVLSTTCTLGGEANEYGPTESSVVATW
Nearest Stachelhaus code(s):: Tyr DGLTTGEVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3589..3982): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTGFDAMTFEGWLIVGGEWNGYGPTENTTFSTC
Nearest Stachelhaus code(s):: Val DAFWIGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4624..5026): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: VAWAFDVSTGDREAILGADVNSYGVTEACIDSSY
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5670..6067): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: CWRFFDGFVASAYGTLGGENNEYGPTENSVVTTI
Nearest Stachelhaus code(s):: Leu DGAYTGEVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
ColR	Phenol-responsive regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_LDCN01000002.1 - Region 4 - opine-like-metallophore

Download region GenBank file

Download region SVG

Location: 785,073 - 807,214 nt. (total: 22,142 nt) Show pHMM detection rules used

opine-like-metallophore: (CntL and CntM)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002488.3	0.84	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.79	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002489.2	0.52	other (other)	pseudopaline	Pseudomonas aeruginosa PAO1
BGC0002490.2	0.50	other (other)	yersinopine	Yersinia pestis CO92
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000541.5	0.40	ribosomal	paenicidin A	Paenibacillus polymyxa

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002488.3	0.84	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002487.3	0.79	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002489.2	0.52	other (other)	pseudopaline	Pseudomonas aeruginosa PAO1
BGC0002490.2	0.50	other (other)	yersinopine	Yersinia pestis CO92
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000541.5	0.40	ribosomal	paenicidin A	Paenibacillus polymyxa

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

Additional weak hits (2):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.42 out of 29.72

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_LDCN01000002.1 - Region 5 - NRPS

Download region GenBank file

Download region SVG

Location: 856,279 - 957,155 nt. (total: 100,877 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AA984_RS09115: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: back translocase esterase

AA984_RS08980: thioesterase

smcogs: SMCOG1004: thioesterase

AA984_RS09080: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Ligases: ligase

AA984_RS09000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS09015: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AA984_RS31040: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS31045: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000367.5	0.85	NRPS	gramicidin	Brevibacillus brevis NBRC 100599
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002071.2	0.73	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000367.5	0.85	NRPS	gramicidin	Brevibacillus brevis NBRC 100599
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002071.2	0.73	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.48 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.52 out of 25.88

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.57 out of 28.19

Confidence: medium

Additional weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.14 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.74 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.97 out of 25.88

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.39 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.55 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.01 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 856278 - 957155:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Leu - D-Gly) + (Ala - D-Leu - Ala - D-Val) + (Val - D-Val - X - D-Leu - X - D-Leu) + (Trp - D-Leu - Trp - Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AA984_RS09000: Leu - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (207..593): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: FWHSFDGSVLEPFFLTGGDYNLYGPTECTILATV
Nearest Stachelhaus code(s):: Leu DLLHLGLILK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1228..1625): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VAMTFDISVAEGNFLACGEENIYGPTEATIYTSR
Nearest Stachelhaus code(s):: Gly DIANLCIIYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS31040: Ala - Leu - Ala - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (464..861): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QALTFDVSVAEGNFMAAGEENIYGPTEATIYASC
Nearest Stachelhaus code(s):: Ala DVANFAIIYK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1526..1921): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASVWEPFLLTGGDVNQYGPTENTVVATA
Nearest Stachelhaus code(s):: Leu DAWFLGQVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3044..3437): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FWATFDLSVYEVNTNLAGEFNLYGPSEDTTYSTY
Nearest Stachelhaus code(s):: Ala DLYNNALTYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4099..4497): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LETSFDAATFEGWLLVGGDINGYGPTENTTFTCC
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS31045: Val - Val - X - Leu - X - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (467..865): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTSFDAATFEGWLLVGGDINGYGPTENTTFTCC
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1530..1928): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTSFDAATFEGWLLVGGDINGYGPTENTTFTCC
Nearest Stachelhaus code(s):: Val DAFWLGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3057..3446): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MYLCFDVSVAEMMTVIGGEFNCYGPTEATVCTTL
Nearest Stachelhaus code(s):: Trp DVAMVGAVCK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4108..4502): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDASVWEPFLLTGGDVNQYGPTENAVVATA
Nearest Stachelhaus code(s):: Leu DAWFLGQVVK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5631..6020): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LALTFDVSVSEMTMIVGGEFNCYGPTETTVTATL
Nearest Stachelhaus code(s):: Trp DVSAIGCVTK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (6687..7081): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDAAVWEPFLLTGGDVNQYGPTENAVVATA
Nearest Stachelhaus code(s):: Leu DAWFLGQVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS09015: Trp - Leu - Trp - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (470..859): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MALTFDVSVSEMSMIVGGEFNCYGPTEATVCSTM
Nearest Stachelhaus code(s):: Trp DVSSIGCVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1524..1918): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHSFDASVWEPFLLTGGDVNQYGPTENAVVATA
Nearest Stachelhaus code(s):: Leu DAWFLGQVVK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3050..3440): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MAYTFDVSVSEQSMEVGGDYNCYGPTEATVGTVI
Nearest Stachelhaus code(s):: Trp DVSSEGCVGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4104..4495): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FWATFDLSVYEANTNLCGEFNLYGPTEDTVYSTH
Nearest Stachelhaus code(s):: Gly DLYNNCLVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
PsrA	Oleic acid responsive regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_LDCN01000002.1 - Region 6 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 958,675 - 997,053 nt. (total: 38,379 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

AA984_RS09230: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

AA984_RS09250: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acyltransferase

AA984_RS09205: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: hydrolase phosphatase

AA984_RS09225: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

AA984_RS09235: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: ligase

AA984_RS09220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS09255: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.64	NRPS	HC-toxin	Alternaria jesenskae
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.42 out of 26.06

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.05 out of 20.97

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 21.55

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 23.10 out of 27.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.21 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.45 out of 24.78

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 23.83 out of 29.25

Confidence: medium

Additional weak hits (8):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.65 out of 20.01

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.69 out of 32.74

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.70 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.41 out of 30.25

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.30 out of 27.18

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.99 out of 33.14

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.61 out of 32.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.82 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 958674 - 997053:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Gly - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AA984_RS09220: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (461..855): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTITSTKLIVGGELNEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS09255: Gly - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (468..874): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDIFVLEAQALIGGEYNVYGPTETTVWSTV
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1599..1891): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 93.4
inactive: 61.2
Methoxymalonyl-CoA: 58.9
Methylmalonyl-CoA: 35.8
Propionyl-CoA: 28.3
Isobutyryl-CoA: 17.2
Ethylmalonyl-CoA: 13.7
trans-1,2-CPDA: 12.5
Acetyl-CoA: 11.4
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
RpoN	Regulator of nitrogen assimilation and virulence
SypG	Regulator of biofilm formation and host colonization

NZ_LDCN01000003.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 799,261 - 823,785 nt. (total: 24,525 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

AA984_RS12860: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

AA984_RS12865: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.57	ribosomal	penisin	Paenibacillus ehimensis
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0000542.3	0.54	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.54	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000560.5	0.51	ribosomal	subtilomycin	Bacillus subtilis
BGC0000515.4	0.47	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.47	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000556.5	0.46	ribosomal	streptin	Streptococcus pyogenes
BGC0000559.4	0.46	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.57	ribosomal	penisin	Paenibacillus ehimensis
BGC0002640.2	0.56	ribosomal	thalassomonasin A, thalassomonasin B	Thalassomonas actiniarum
BGC0000542.3	0.54	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.54	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000560.5	0.51	ribosomal	subtilomycin	Bacillus subtilis
BGC0000515.4	0.47	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.47	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000556.5	0.46	ribosomal	streptin	Streptococcus pyogenes
BGC0000559.4	0.46	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for AA984_RS12860

AA984_RS31200

Leader:

MFDLDVQVNAVGTNGAEPN

Core:

TIRTALCWVTRVTCKSTCTCVCTAMCTPGCPFSDEK

Core with dehydrations:

DhbIRDhbALCysWVDhbRVDhbCysKDhaDhbCysDhbCysVCysDhbAMCysDhbPGCysPFDhaDEK

antiSMASH-DB 4.0 matches for AA984_RS31200

100.0%

NZ_LDCN01000003.1:

Lanthipeptides: allorf_808935_809114_lanthipeptide

1

TIRTALCWVTRVTCKSTCTCVCTAMCTPGCPFSDEK

36

TIRTALCWVTRVTCKSTCTCVCTAMCTPGCPFSDEK

1

TIRTALCWVTRVTCKSTCTCVCTAMCTPGCPFSDEK

36

66.7%

NZ_FONN01000006.1:

Lanthipeptides: allorf_222520_222687_lanthipeptide

1

TIRTALCWVTRVTCKSTCTCVCTAMCTPGCPF

32

TIRTALCWVT+VTCK++C C T CTPGCPF

1

TIRTALCWVTKVTCKASCGCGFTQYCTPGCPF

32

52.8%

NZ_JAGYPM010000006.1:

Lanthipeptides: KHA94_RS22305_lanthipeptide

1

TIRTALCWVTRVTCKSTCTCVCTAMCTPGC

30

T+RT +CWVT+VTCK++C C T+ CTPGC

1

TVRTTVCWVTKVTCKASCGCNFTSYCTPGC

30

with 32 more sequence matches

Only the first 10 are displayed here.

47.2%

NZ_BNCE01000001.1:

Lanthipeptides: IE320_RS02935_lanthipeptide

10

TRVTCKSTCTCVCTAMCTPGCPFSDEK

36

TRVTC+ T TC CT MCT C S EK

12

TRVTCQVTKTCACTQMCTILC--SPEK

36

47.2%

NZ_JACHJE010000002.1:

Lanthipeptides: FHS32_RS05815_lanthipeptide

10

TRVTCKSTCTCVCTAMCTPGCPFSDEK

36

TRVTC+ T TC CT+MCT C S EK

12

TRVTCQVTKTCACTSMCTILC--SPEK

36

39.0%

NZ_CP017248.1and 1 other:

NZ_CP071839.1 Lanthipeptides: S1361_RS32765_lanthipeptide

Lanthipeptides: BFF78_RS08045_lanthipeptide

10

TRVTCKSTCTCVCTAMCTPG-CP

31

TRVTCK+ CT VCT +CT G CP

14

TRVTCKANCTYVCTTVCTSGICP

36

38.9%

NZ_CAKJTI010000039.1:

Lanthipeptides: LRP84_RS20230_lanthipeptide

12

VTCKSTCTCVCTAMCTPGC

30

+TCKSTCTCVCT+ CT C

9

ITCKSTCTCVCTSYCTISC

27

38.9%

NZ_FOPA01000013.1and 1 other:

NZ_FOPA01000013.1 Lanthipeptides: BM277_RS31090_lanthipeptide

Lanthipeptides: allorf_32353_32508_lanthipeptide

9

VTRVTCKSTCTCVCTAMCTPGC

30

+T +TCK TCTCVCT CT C

6

LTCITCKGTCTCVCTQYCTISC

27

36.1%

NZ_CAKJTI010000039.1:

Lanthipeptides: allorf_04740_04904_lanthipeptide

12

VTCKSTCTCVCTAMCT

27

VTCKSTCTC CT CT

9

VTCKSTCTCACTFNCT

24

36.1%

NZ_CP007574.1:

Lanthipeptides: DC74_RS44240_lanthipeptide

10

TRVTCKSTCTCVCTAMCTPGC

30

T+V C T TCVCT+MCT C

12

TKVGCSVTKTCVCTSMCTIFC

32

33.3%

NZ_FOPA01000013.1:

Lanthipeptides: allorf_32163_32318_lanthipeptide

13

TCKSTCTCVCTAMCT

27

TCKSTCTC CT CT

10

TCKSTCTCACTLNCT

24

32.6%

NZ_JALGBX010000020.1and 1 other:

NZ_JANAVF010000016.1 Lanthipeptides: NLX94_RS30150_lanthipeptide

Lanthipeptides: MTF69_RS28785_lanthipeptide

10

TRVTCKSTCTCVCTAMCT

27

TRVTC+++ TCVCTAMCT

19

TRVTCQASKTCVCTAMCT

36

32.4%

NZ_CM000756.1and 17 others:

NZ_CM000756.1 Lanthipeptides: BTHUR0011_RS14760_lanthipeptideNZ_CM000756.1 Lanthipeptides: BTHUR0011_RS14765_lanthipeptideNZ_CM000756.1 Lanthipeptides: BTHUR0011_RS14760_lanthipeptideNZ_CP031749.1 Lanthipeptides: DPQ26_RS29740_lanthipeptideNZ_CP031749.1 Lanthipeptides: DPQ26_RS29735_lanthipeptideNZ_CP031749.1 Lanthipeptides: DPQ26_RS29730_lanthipeptideNZ_CP031749.1 Lanthipeptides: DPQ26_RS29740_lanthipeptideNZ_CP031749.1 Lanthipeptides: DPQ26_RS29735_lanthipeptideNZ_CP031749.1 Lanthipeptides: DPQ26_RS29730_lanthipeptideNZ_CP036071.1 Lanthipeptides: EXW41_RS26900_lanthipeptideNZ_CP036071.1 Lanthipeptides: EXW41_RS26895_lanthipeptideNZ_CP036071.1 Lanthipeptides: EXW41_RS26900_lanthipeptideNZ_CP036071.1 Lanthipeptides: EXW41_RS26895_lanthipeptideNZ_WBPC01000036.1 Lanthipeptides: F8159_RS22545_lanthipeptideNZ_WBPC01000036.1 Lanthipeptides: F8159_RS22540_lanthipeptideNZ_WBPC01000036.1 Lanthipeptides: F8159_RS22545_lanthipeptideNZ_WBPC01000036.1 Lanthipeptides: F8159_RS22540_lanthipeptide

Lanthipeptides: BTHUR0011_RS14765_lanthipeptide

2

IRTALCWVTRVTCKSTC-TCVCTAMCT

27

I TA+ VT VT +S C T C+ C

10

IVTAISAVTAVTAQSPCPTSACSKSCN

36

MIBiG 4.0 matches for AA984_RS31200

13.9%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

24

AMCTPGC

30

++CTPGC

5

SLCTPGC

11

13.9%

BGC0001155.5 (AGY49587.1):

Thiopeptide: GE2270

17

TCTCVCTAMCT

27

+C CVC C+

1

SCNCVCGFCCS

11

11.1%

BGC0000563.4 (AEA03263.1):

Lanthipeptide: venezuelin

16

STCTCV

21

+TC CV

1

ATCECV

6

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.49 out of 27.04

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.52 out of 26.06

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.70 out of 26.06

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.38 out of 25.88

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.38 out of 25.88

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.38 out of 25.88

Confidence: medium

Additional weak hits (10):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.30 out of 26.06

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.50 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 24.29 out of 32.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.09 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.10 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.85 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.85 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.85 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.88 out of 26.12

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

AA984_RS31200 - Class I

Cleavage pHMM score: 12.50

RODEO score: 24

Monoisotopic mass: 3734.7 Da

Molecular weight: 3737.4 Da

Number of bridges: 7

Alternative weights: (assuming N unmodified Ser/Thr residues); 3755.5 Da N = 1; 3773.5 Da N = 2; 3791.5 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 158 - 252; Score: 49.2

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
PsrA	Oleic acid responsive regulator

NZ_LDCN01000005.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 130,960 - 191,467 nt. (total: 60,508 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: PPTase aminotransferase kinase

AA984_RS17710: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

AA984_RS17750: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

AA984_RS17780: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase hydrolase

AA984_RS17705: thioesterase

smcogs: SMCOG1004: thioesterase

AA984_RS17740: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

AA984_RS17825: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

AA984_RS17715: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

AA984_RS17720: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

AA984_RS17735: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

AA984_RS17805: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002472.2	1.36	NRPS	ulbactin F, ulbactin G	Brevibacillus brevis
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.60	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.59	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.58	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002472.2	0.88	NRPS	ulbactin F, ulbactin G	Brevibacillus brevis
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.31 out of 26.06

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.19 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 25.31

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.81 out of 29.38

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.29 out of 27.78

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.78 out of 27.04

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.83 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.95 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.06 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.46 out of 28.19

Confidence: medium

Additional weak hits (17):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.45 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 26.69 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.97 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.03 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 24.87 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.02 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.47 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.42 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 25.85 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.12 out of 29.38

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.87 out of 25.88

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.05 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 22.66 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.16 out of 29.38

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 20.57 out of 30.12

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.10 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.73 out of 28.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 130959 - 191467:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-Cys - Me-Cys) + (Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

AA984_RS17715: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (30..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NATLFPLCCPGGGLQVGGSQQVFGMAEGLICCTS
Nearest Stachelhaus code(s):: Sal TLPAQGVICK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

AA984_RS17720: Cys - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (567..965): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TEISFDLSVYDGNSMLSGDVAMGGATEASIWSNF
Nearest Stachelhaus code(s):: Cys DLYNMSMIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2029..2433): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLLSGDIGLGGATEASIWSNL
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AA984_RS17735: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (538..933): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDMAFDLSVYDANSLLSGDVSLGGATEASIWSNY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
DasR	N-acetylglucosamine dependent repressor
FuR variant 1	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_LDCN01000005.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 456,122 - 466,970 nt. (total: 10,849 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

AA984_RS19015: aminotransferase

smcogs: SMCOG1019: aminotransferase

AA984_RS19025: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001184.4	0.39	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000285.5	0.34	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000721.4	0.29	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000395.5	0.29	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis
BGC0001964.2	0.28	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000993.4	0.26	NRPS, PKS	FR901228	Chromobacterium violaceum
BGC0001230.5	0.26	NRPS, PKS	salinamide A, salinamide B, salinamide C, salinamide D, salinamide E, salinamide F, desmethylsalinamide C, desmethylsalinamide E	Streptomyces sp. CNB091
BGC0000388.5	0.26	NRPS	mannopeptimycin	Streptomyces hygroscopicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001184.4	0.39	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000285.5	0.34	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000306.5	0.31	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0000721.4	0.29	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000395.5	0.29	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis
BGC0001964.2	0.28	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000993.4	0.26	NRPS, PKS	FR901228	Chromobacterium violaceum
BGC0001230.5	0.26	NRPS, PKS	salinamide A, salinamide B, salinamide C, salinamide D, salinamide E, salinamide F, desmethylsalinamide C, desmethylsalinamide E	Streptomyces sp. CNB091
BGC0000388.5	0.26	NRPS	mannopeptimycin	Streptomyces hygroscopicus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 28.43 out of 29.38

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.57 out of 18.57

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.34 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.25 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.13 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.26 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.03 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.47 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.27 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.53 out of 28.19

Confidence: medium

Additional weak hits (6):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.38 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.88 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.39 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.38 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.64 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.73 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_LDCN01000006.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 151,988 - 173,142 nt. (total: 21,155 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002317.2	0.48	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0000585.5	0.39	ribosomal	microcin C7	Escherichia coli
BGC0000546.3	0.37	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000547.5	0.36	ribosomal	salivaricin 9	Streptococcus salivarius
BGC0001787.3	0.36	ribosomal	suicin 3908	Streptococcus suis
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000626.3	0.36	ribosomal	thuricin	Bacillus thuringiensis
BGC0000498.5	0.35	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.35	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000527.5	0.35	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002317.2	0.48	ribosomal	herbicolin O, mcceh252, pantocin A	Pantoea agglomerans
BGC0000585.5	0.39	ribosomal	microcin C7	Escherichia coli
BGC0000546.3	0.37	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000547.5	0.36	ribosomal	salivaricin 9	Streptococcus salivarius
BGC0001787.3	0.36	ribosomal	suicin 3908	Streptococcus suis
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000626.3	0.36	ribosomal	thuricin	Bacillus thuringiensis
BGC0000498.5	0.35	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.35	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000527.5	0.35	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.41 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.12 out of 20.97

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.52 out of 20.97

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.82 out of 27.55

Confidence: medium

Additional weak hits (2):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.93 out of 30.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 35.63

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 2 - 90; Score: 51.1

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism

NZ_LDCN01000007.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 25,610 - 57,347 nt. (total: 31,738 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

AA984_RS21100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.80	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000295.5	0.50	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001499.5	0.48	other (other)	aerobactin	Pantoea ananatis
BGC0002694.2	0.48	other (other)	roseobactin	Phaeobacter inhibens 2.10
BGC0001713.5	0.47	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002471.3	0.45	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002633.2	0.45	other (other)	schizokinen	Leptolyngbya sp. PCC 7376

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.4	0.80	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002692.2	0.50	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000295.5	0.50	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001499.5	0.48	other (other)	aerobactin	Pantoea ananatis
BGC0002694.2	0.48	other (other)	roseobactin	Phaeobacter inhibens 2.10
BGC0001713.5	0.47	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002471.3	0.45	other (other)	baumannoferrin A, baumannoferrin B	Acinetobacter baumannii AYE
BGC0002633.2	0.45	other (other)	schizokinen	Leptolyngbya sp. PCC 7376

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.85 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.11 out of 28.19

Confidence: medium

Additional weak hits (7):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.07 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.36 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.73 out of 30.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.90 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.80 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.57 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.70 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
ZuR variant 1	Zinc-responsive repressor