GCF_000829715.2 - 34 region(s)

Download region SVG

Location: 78,335 - 88,751 nt. (total: 10,417 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

TU31_RS33260: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase methyltransferase

TU31_RS33245: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

TU31_RS33265: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

TU31_RS33275: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.94	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.72	other (other)	ectoine	Methylomicrobium kenyense
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000857.3	0.64	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.63	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.94	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0000856.3	0.72	other (other)	ectoine	Methylophaga thalassica
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.72	other (other)	ectoine	Methylomicrobium kenyense
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000857.3	0.64	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.63	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000860.3	0.60	other (other)	ectoine	Methylarcula marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (2):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.64 out of 23.43

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.66 out of 27.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
OsdR	Development and stress management regulator

NZ_BBNO01000010.1 - Region 1 - T1PKS,hglE-KS

Download region SVG

Location: 14,705 - 66,885 nt. (total: 52,181 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

TU31_RS31035: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

TU31_RS31065: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

TU31_RS31075: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase glycosyltransferase halogenase kinase

TU31_RS30945: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

TU31_RS31005: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

TU31_RS31045: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

TU31_RS31050: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

TU31_RS31085: halogenase

smcogs: SMCOG1119: halogenase

TU31_RS40355: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

TU31_RS31010: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: mutase

TU31_RS31040: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

TU31_RS31030: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.56	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.54	PKS	FR901512	fungal sp. No.14919
BGC0000041.3	0.52	PKS	oronofacic acid	Pseudomonas syringae
BGC0000056.3	0.36	PKS	esperamicin	Actinomadura verrucosospora
BGC0001162.3	0.32	PKS	1-heptadecene	Moorea producens JHB

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0000041.3	0.60	PKS	oronofacic acid	Pseudomonas syringae
BGC0000056.3	0.50	PKS	esperamicin	Actinomadura verrucosospora
BGC0001162.3	0.47	PKS	1-heptadecene	Moorea producens JHB

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (12):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.71 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.36 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.04 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.79 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.75 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.96 out of 25.75

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.04 out of 39.62

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.60 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.92 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.98 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.57 out of 33.14

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

TU31_RS40355: mal

PKS_AT (648..866): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 0.2
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TU31_RS31030: mal

PKS_AT (1235..1523): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 54.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.0
Methoxymalonyl-CoA: 47.0
Methylmalonyl-CoA: 40.3
Propionyl-CoA: 32.7
inactive: 19.7
trans-1,2-CPDA: 18.5
Ethylmalonyl-CoA: 18.3
fatty_acid: 10.5
CHC-CoA: 8.8
2-Methylbutyryl-CoA: 8.7
Isobutyryl-CoA: 3.9
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000010.1 - Region 2 - terpene

Download region SVG

Location: 177,348 - 203,966 nt. (total: 26,619 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

TU31_RS31690: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

TU31_RS31630: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

TU31_RS31695: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthetase

TU31_RS31650: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.67	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000638.3	0.47	terpene	carotenoid	Pantoea ananatis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.67	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000638.3	0.47	terpene	carotenoid	Pantoea ananatis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

TU31_RS31645: T2TS

Domain 1 (29 - 662): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

TU31_RS31650: PT_FPPS_like

Domain 1 (77 - 371): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

TU31_RS31660: PT_phytoene_like

Domain 1 (17 - 300): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

TU31_RS31665: PT_phytoene_like

Domain 1 (6 - 267): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.08 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.16 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.52 out of 26.12

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.82 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_BBNO01000009.1 - Region 1 - NI-siderophore

Download region SVG

Location: 80,645 - 113,538 nt. (total: 32,894 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

TU31_RS29715: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

TU31_RS29780: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Lyases: decarboxylase

TU31_RS29775: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.77	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.70	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.63	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.59	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002073.3	0.58	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.56	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0002682.2	0.55	other (other)	aerobactin	Vibrio mimicus
BGC0002683.2	0.53	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0002681.3	0.48	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000946.5	0.77	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0001408.5	0.70	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0002527.2	0.63	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0000947.5	0.59	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002073.3	0.58	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0001870.3	0.56	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0002682.2	0.55	other (other)	aerobactin	Vibrio mimicus
BGC0002683.2	0.53	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0002681.3	0.48	other (other)	rhizoferrin	Francisella tularensis subsp. tularensis SCHU S4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

Additional weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.59 out of 26.85

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.55 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.90 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.32 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_BBNO01000008.1 - Region 1 - NRPS,NRPS-like,T1PKS

Download region SVG

Location: 187,659 - 241,479 nt. (total: 53,821 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

TU31_RS27205: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

TU31_RS27250: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

TU31_RS27255: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

TU31_RS27280: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

TU31_RS27305: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

TU31_RS27310: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

TU31_RS27370: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Hydrolases: deacetylase esterase

TU31_RS27325: thioesterase

smcogs: SMCOG1004: thioesterase

TU31_RS27355: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: dehydratase

TU31_RS27275: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

TU31_RS27245: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

TU31_RS27265: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

TU31_RS27290: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

TU31_RS27295: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

TU31_RS27300: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.23	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001251.4	1.05	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	1.05	NRPS	epichloenin A	Epichloe festucae
BGC0001132.4	1.04	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	1.04	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.03	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.02	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	1.00	NRPS	peramine	Epichloe festucae
BGC0001261.3	1.00	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.98	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.45 out of 36.53

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.71 out of 29.72

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.52 out of 24.78

Confidence: medium

Additional weak hits (16):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.54 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.97 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.03 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.58 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.70 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.51 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.19 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.40 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.01 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.96 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.59 out of 27.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.63 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.42 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 187658 - 241479:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 187658 - 230010:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 194403 - 238027:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 198059 - 241479:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

TU31_RS27265: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (204..608): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RHMTFDVTVREWHFVCGGEYNVYGPTEAAVDVTS
Nearest Stachelhaus code(s):: Dab DVWHVGAVDK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

TU31_RS27290: mal

PKS_AT (514..791): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 65.1
Methoxymalonyl-CoA: 43.1
Methylmalonyl-CoA: 36.8
Propionyl-CoA: 16.3
inactive: 13.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TU31_RS27295: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (549..946): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LEASFDASTLEAWLLTGGDTNGYGPTENTTFTTT
Nearest Stachelhaus code(s):: Val DALWLGGTFK (82% 8Å match); bOH-Val DALWLGGTFK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C

NZ_BBNO01000008.1 - Region 2 - RiPP-like

Download region SVG

Location: 425,286 - 436,615 nt. (total: 11,330 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000351.5	0.33	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002579.2	0.31	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000502.5	0.30	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0001496.3	0.30	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0002490.2	0.29	other (other)	yersinopine	Yersinia pestis CO92
BGC0001427.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001426.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001425.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622
BGC0001421.4	0.29	NRPS, PKS	myxochromide B	Myxococcus sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000541.5	0.33	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000351.5	0.33	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002579.2	0.31	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000502.5	0.30	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0001496.3	0.30	ribosomal	actinokineosin	Actinokineospora spheciospongiae
BGC0002490.2	0.29	other (other)	yersinopine	Yersinia pestis CO92
BGC0001427.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001426.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001425.4	0.29	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622
BGC0001421.4	0.29	NRPS, PKS	myxochromide B	Myxococcus sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.07 out of 32.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.67 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_BBNO01000008.1 - Region 3 - butyrolactone

Download region SVG

Location: 485,597 - 496,577 nt. (total: 10,981 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

TU31_RS28410: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

TU31_RS28425: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Hydrolases: hydrolase

TU31_RS28400: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Lyases: hydratase

TU31_RS28430: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.68	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.63	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001302.5	0.38	other (other)	lomofungin	Streptomyces lomondensis
BGC0000996.5	0.36	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001726.4	0.36	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001304.3	0.36	PKS	aflavarin	Aspergillus flavus NRRL3357
BGC0000999.4	0.36	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.68	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.63	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.44	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001302.5	0.38	other (other)	lomofungin	Streptomyces lomondensis
BGC0000996.5	0.36	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001726.4	0.36	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001304.3	0.36	PKS	aflavarin	Aspergillus flavus NRRL3357
BGC0000999.4	0.36	NRPS, PKS	heat-stable antifungal factor	Lysobacter enzymogenes

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.22 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.84 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.44 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

NZ_BBNO01000008.1 - Region 4 - terpene-precursor

Download region SVG

Location: 505,697 - 526,344 nt. (total: 20,648 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

TU31_RS28515: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001579.4	0.46	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001684.3	0.39	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0000522.3	0.39	ribosomal	lacticin Z	Lactococcus lactis
BGC0000503.5	0.39	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002115.3	0.37	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001210.5	0.37	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001920.4	0.37	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.37	ribosomal	MS-271	Streptomyces mirabilis
BGC0000528.5	0.36	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001579.4	0.46	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001684.3	0.39	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0000522.3	0.39	ribosomal	lacticin Z	Lactococcus lactis
BGC0000503.5	0.39	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002115.3	0.37	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001210.5	0.37	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001920.4	0.37	ribosomal	siamycin I	Streptomyces sp.
BGC0001674.5	0.37	ribosomal	MS-271	Streptomyces mirabilis
BGC0000528.5	0.36	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

TU31_RS28515: PT_FPPS_like

Domain 1 (58 - 207): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.36 out of 33.73

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.58 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.14 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_BBNO01000008.1 - Region 5 - lassopeptide

Download region SVG

Location: 543,837 - 566,449 nt. (total: 22,613 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

TU31_RS28695: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.86	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.84	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.81	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.77	ribosomal	citrulassin A	Streptomyces albulus
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.72	ribosomal	ulleungdin	Streptomyces sp.
BGC0001889.2	0.71	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001507.3	0.67	ribosomal	anantin C	Streptomyces olindensis
BGC0002289.2	0.65	ribosomal	Leepeptin	Streptomyces leeuwenhoekii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.3	0.86	ribosomal	citrulassin D	Streptomyces katrae
BGC0001552.3	0.84	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001549.3	0.84	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001551.4	0.81	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001548.4	0.77	ribosomal	citrulassin A	Streptomyces albulus
BGC0001539.4	0.72	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.72	ribosomal	ulleungdin	Streptomyces sp.
BGC0001889.2	0.71	ribosomal	fusilassin	Thermobifida fusca YX
BGC0001507.3	0.67	ribosomal	anantin C	Streptomyces olindensis
BGC0002289.2	0.65	ribosomal	Leepeptin	Streptomyces leeuwenhoekii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.34 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.50 out of 23.79

Confidence: medium

Additional weak hits (7):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.79 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.67 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.87 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.19 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.26 out of 27.18

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.36 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.04 out of 35.63

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 83; Score: 81.0

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_BBNO01000008.1 - Region 6 - NI-siderophore

Download region SVG

Location: 645,714 - 678,420 nt. (total: 32,707 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

TU31_RS29075: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

TU31_RS29130: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: amidase

TU31_RS29080: amidase

smcogs: SMCOG1105: amidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.52	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.52	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.54	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002683.2	0.52	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.52	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002470.2	0.52	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0002633.2	0.52	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.03 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.60 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (7):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.80 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.63 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.93 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.85 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_BBNO01000007.1 - Region 1 - T2PKS

Download region SVG

Location: 33,179 - 105,733 nt. (total: 72,555 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

TU31_RS22745: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

TU31_RS22795: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

TU31_RS22855: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

TU31_RS22880: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

TU31_RS22890: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

TU31_RS22895: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

TU31_RS22920: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acylase aminotransferase methyltransferase

TU31_RS22860: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

TU31_RS22905: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

TU31_RS22910: aminotransferase

smcogs: SMCOG1019: aminotransferase

TU31_RS22925: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: back translocase hydrolase

TU31_RS22850: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

TU31_RS22930: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

TU31_RS22975: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: cyclase

TU31_RS22885: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

TU31_RS22835: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

TU31_RS22840: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

TU31_RS22870: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000254.5	0.81	PKS	oxytetracycline	Streptomyces rimosus
BGC0000231.5	0.78	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.69	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001197.5	0.60	PKS	frankiamicin	Frankia sp. EAN1pec

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000254.5	0.81	PKS	oxytetracycline	Streptomyces rimosus
BGC0000231.5	0.78	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.69	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001197.5	0.60	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.11 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.10 out of 29.72

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.25 out of 23.43

Confidence: medium

Additional weak hits (12):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.39 out of 20.01

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.17 out of 39.62

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.42 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.21 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.53 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.48 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 21.84

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.80 out of 23.43

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

TU31_RS22870: X

AMP-binding (49..452): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NQTL-SFHLMHIYSLSGGSVQGYGLAETSPSTHF
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TU31_RS22905: mal

PKS_AT (23..312): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 45.0
Methylmalonyl-CoA: 39.6
Methoxymalonyl-CoA: 39.6
Propionyl-CoA: 31.1
Ethylmalonyl-CoA: 14.5
inactive: 13.5
2-Methylbutyryl-CoA: 12.2
CHC-CoA: 8.9
trans-1,2-CPDA: 6.8
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Type II PKS gene cluster prediction details

Cluster section:: 33178 to 105733
Starter unit(s):: malonamyl-CoA (Score: 1788.0; E-value: 0)
propionyl-CoA (Score: 343.0; E-value: 1.03e-120)
Malonyl elongations:: 8|9 (Score: 681.6; E-value: 6.9e-208)
Product class(es):: anthracycline
aureolic acid
tetracycline
Product molecular weight(s):: malonamyl-CoA_8: 440 Da
malonamyl-CoA_9: 482 Da
propionyl-CoA_8: 411 Da
propionyl-CoA_9: 453 Da

TU31_RS22835: KS (Score: 738.7; E-value: 4.1e-225)
TU31_RS22840: CLF 8|9 (Score: 681.6; E-value: 6.9e-208)
TU31_RS22845: ACP (Score: 119.8; E-value: 8.8e-38)
TU31_RS22850: AMID (Score: 1148.6; E-value: 0.0); AMID ELQ83270.1_Oxytetracycline_malonamyl-CoA (Score: 1012.0; E-value: 0.0)
TU31_RS22855: OXY (Score: 191.7; E-value: 5.7e-59)
TU31_RS22860: MET C6|C8 (Score: 539.4; E-value: 6.4e-165)
TU31_RS22870: LIG (Score: 762.9; E-value: 3.1e-232); LIG ELQ83297.1_Oxytetracycline_malonamyl-CoA (Score: 776.0; E-value: 0.0)
TU31_RS22875: CYC C1-C18|C2-C19 (Score: 220.8; E-value: 1.2e-68)
TU31_RS22880: KR C9 (Score: 447.9; E-value: 2.4e-137)
TU31_RS22885: CYC C7-C12 (Score: 433.2; E-value: 9.8e-133)
TU31_RS22890: OXY (Score: 409.7; E-value: 4.1e-125)
TU31_RS22895: KR (Score: 132.3; E-value: 5.5e-41)
TU31_RS22900: CYC C5-C14/C3-C16 (Score: 442.0; E-value: 1.5e-135)
TU31_RS22905: AT (Score: 399.1; E-value: 3.5e-122); AT BAB72049.1_Aklavinone_propionyl-CoA (Score: 343.0; E-value: 1.03e-120)
TU31_RS22910: AMIN (Score: 525.9; E-value: 1.1e-160)
TU31_RS22920: OXY (Score: 481.8; E-value: 5.6e-147)
TU31_RS22925: MET C2O|C2N (Score: 537.2; E-value: 3.5e-164)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000007.1 - Region 2 - lanthipeptide-class-i

Download region SVG

Location: 111,652 - 136,162 nt. (total: 24,511 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

TU31_RS23100: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

TU31_RS23115: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase dehydratase

TU31_RS23075: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

TU31_RS23080: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.54	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.51	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.51	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.50	ribosomal	planosporicin	Planomonospora alba
BGC0001289.5	0.50	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.45	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000540.5	0.43	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.54	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.51	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.51	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.50	ribosomal	planosporicin	Planomonospora alba
BGC0001289.5	0.50	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0001727.3	0.45	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.45	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000540.5	0.43	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.34 out of 20.01

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

Additional weak hits (9):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.98 out of 20.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.40 out of 26.12

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.11 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.39 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.18 out of 36.54

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.69 out of 30.98

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.46 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.30 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 150 - 239; Score: 47.7

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000007.1 - Region 3 - RiPP-like

Download region SVG

Location: 212,327 - 224,261 nt. (total: 11,935 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001157.6	0.37	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001994.4	0.36	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000469.6	0.35	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0002294.3	0.34	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002509.3	0.32	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0000598.5	0.32	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001561.4	0.31	NRPS	curacomycin	Streptomyces curacoi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.42	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001157.6	0.37	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.37	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0001994.4	0.36	other (other)	β-ethynylserine	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000469.6	0.35	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0002294.3	0.34	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002509.3	0.32	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0000598.5	0.32	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0001561.4	0.31	NRPS	curacomycin	Streptomyces curacoi

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.51 out of 27.18

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (1):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000007.1 - Region 4 - butyrolactone

Download region SVG

Location: 444,234 - 455,217 nt. (total: 10,984 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

TU31_RS24520: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: decarboxylase

TU31_RS24540: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.79	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002313.3	0.43	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000866.5	0.42	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0000867.3	0.40	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002161.2	0.38	PKS	scytalone, T3HN	Pestalotiopsis fici W106-1
BGC0002218.2	0.36	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.79	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002313.3	0.43	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000866.5	0.42	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0000867.3	0.40	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002161.2	0.38	PKS	scytalone, T3HN	Pestalotiopsis fici W106-1
BGC0002218.2	0.36	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (2):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.30 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.09 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_BBNO01000007.1 - Region 5 - NRPS,NRPS-like,other

Download region SVG

Location: 516,732 - 574,446 nt. (total: 57,715 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

TU31_RS24820: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

TU31_RS24850: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

TU31_RS24880: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase acyltransferase glycosyltransferase methyltransferase

TU31_RS24895: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

TU31_RS24935: methyltransferase

smcogs: SMCOG1089: methyltransferase

TU31_RS25015: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

TU31_RS25020: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

TU31_RS25025: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Lyases: dehydratase

TU31_RS25030: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

TU31_RS25035: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

TU31_RS24900: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

TU31_RS24905: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

TU31_RS24910: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

TU31_RS24915: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	1.88	NRPS	antipain	Streptomyces sp.
BGC0001249.5	1.22	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	1.13	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	1.10	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	1.09	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	1.09	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001570.5	1.07	NRPS	deimino-antipain	Streptomyces albulus
BGC0002286.3	1.06	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.05	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	1.02	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002051.2	0.85	NRPS	antipain	Streptomyces sp.
BGC0001249.5	0.72	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001570.5	0.68	NRPS	deimino-antipain	Streptomyces albulus
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

Additional weak hits (14):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.40 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.19 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.72 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.17 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.29 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.32 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.62 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.79 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.16 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.30 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.32 out of 27.04

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 516731 - 574446:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 516731 - 558588:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 520568 - 563769:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg) + (X) + (Val)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

TU31_RS24900: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (33..422): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPSFDASTFEGFFIVGGEVNGYGPTEATTFTTT
Nearest Stachelhaus code(s):: Val DAFFIGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TU31_RS24905: X

AMP-binding (37..442): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWYIFDPHLLEAVAIVGGDHNAYGPAEATVVATT
Nearest Stachelhaus code(s):: Phe DPLVVGAVVK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

TU31_RS24910: Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (468..857): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HGAAFDVALEEPNLVLGGELNVYGVTEAAISTTV
Nearest Stachelhaus code(s):: Arg DVENVGVISK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000007.1 - Region 6 - terpene

Download region SVG

Location: 585,169 - 613,584 nt. (total: 28,416 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

TU31_RS25140: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

TU31_RS25155: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

TU31_RS25195: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

TU31_RS25215: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Transferases: methyltransferase

TU31_RS25160: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase

TU31_RS25115: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: synthase synthetase

TU31_RS25130: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

TU31_RS25135: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.83	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.76	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002725.3	0.74	ribosomal	prunipeptin	Streptomyces prunicolor NBRC 13075
BGC0000633.3	0.72	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.71	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000645.3	0.49	terpene	carotenoid	Halobacillus halophilus DSM 2266

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.83	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.76	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002725.3	0.74	ribosomal	prunipeptin	Streptomyces prunicolor NBRC 13075
BGC0000633.3	0.72	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.71	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000645.3	0.49	terpene	carotenoid	Halobacillus halophilus DSM 2266

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

TU31_RS25135: PT_FPPS_like

Domain 1 (79 - 393): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

TU31_RS25145: PT_phytoene_like

Domain 1 (16 - 312): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

TU31_RS25165: Lycopene_cycl

Domain 1 (5 - 383): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (8):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.81 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.63 out of 29.38

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.12 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.37 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000007.1 - Region 7 - hydrogen-cyanide

Download region SVG

Location: 725,978 - 738,918 nt. (total: 12,941 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

TU31_RS25695: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

TU31_RS25705: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

TU31_RS25720: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.32	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001057.4	0.31	NRPS, PKS	zearalenone	Fusarium graminearum
BGC0001739.3	0.31	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0002556.2	0.29	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.
BGC0000274.5	0.27	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0001819.3	0.27	PKS	Venemycin	Streptomyces venezuelae
BGC0000154.4	0.26	PKS	stipitatic acid	Talaromyces stipitatus ATCC 10500
BGC0000595.3	0.26	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000319.5	0.25	NRPS	cephamycin C	Streptomyces clavuligerus ATCC 27064

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002285.2	0.32	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0001057.4	0.31	NRPS, PKS	zearalenone	Fusarium graminearum
BGC0001739.3	0.31	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0002556.2	0.29	other (other)	cervinomycin B3, cervinomycin C1, cervinomycin C2, cervinomycin C3, cervinomycin C4	Streptomyces sp.
BGC0000274.5	0.27	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0001819.3	0.27	PKS	Venemycin	Streptomyces venezuelae
BGC0000154.4	0.26	PKS	stipitatic acid	Talaromyces stipitatus ATCC 10500
BGC0000595.3	0.26	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000319.5	0.25	NRPS	cephamycin C	Streptomyces clavuligerus ATCC 27064

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

Additional weak hits (6):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.30 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.36 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.78 out of 26.85

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000007.1 - Region 8 - terpene

Download region SVG

Location: 790,570 - 813,874 nt. (total: 23,305 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

TU31_RS25940: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

TU31_RS25960: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

TU31_RS25985: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

TU31_RS25990: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0001924.3	0.53	terpene	ascofuranone	Acremonium egyptiacum
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000671.3	0.49	terpene	momilactone B	Oryza sativa Japonica Group
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000669.3	0.49	terpene	marneral	Arabidopsis thaliana
BGC0000674.5	0.48	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001989.3	0.47	other (other)	pulcherrimin	Kluyveromyces lactis
BGC0001910.4	0.46	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0001924.3	0.53	terpene	ascofuranone	Acremonium egyptiacum
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000671.3	0.49	terpene	momilactone B	Oryza sativa Japonica Group
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000669.3	0.49	terpene	marneral	Arabidopsis thaliana
BGC0000674.5	0.48	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064
BGC0001989.3	0.47	other (other)	pulcherrimin	Kluyveromyces lactis
BGC0001910.4	0.46	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.76 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.90 out of 30.12

Confidence: medium

Additional weak hits (3):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.61 out of 30.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.71 out of 25.88

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_BBNO01000007.1 - Region 9 - butyrolactone

Download region SVG

Location: 843,511 - 854,431 nt. (total: 10,921 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

TU31_RS26185: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.51	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.42	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.31	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001458.4	0.30	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0002571.2	0.29	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002657.2	0.25	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0001771.4	0.24	NRPS	scleric acid	Streptomyces sclerotialus
BGC0001083.5	0.23	PKS, terpene	merochlorin A, merochlorin B, deschloro-merochlorin A, deschloro-merochlorin B, isochloro-merochlorin B, dichloro-merochlorin B, merochlorin D, merochlorin C	Streptomyces sp. CNH189

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.76	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.75	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.51	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.42	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000914.5	0.31	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001458.4	0.30	other (aminocoumarin)	salinipostin G, Salinipostin G, Salinipostin A, Salinipostin B, Salinipostin C, Salinipostin D, Salinipostin E, Salinipostin F, Salinipostin H, Salinipostin I, Salinipostin J, Salinipostin K	Salinispora tropica CNB-440
BGC0002571.2	0.29	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0002657.2	0.25	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0001771.4	0.24	NRPS	scleric acid	Streptomyces sclerotialus
BGC0001083.5	0.23	PKS, terpene	merochlorin A, merochlorin B, deschloro-merochlorin A, deschloro-merochlorin B, isochloro-merochlorin B, dichloro-merochlorin B, merochlorin D, merochlorin C	Streptomyces sp. CNH189

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (2):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.99 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_BBNO01000006.1 - Region 1 - NI-siderophore

Download region SVG

Location: 466,961 - 485,565 nt. (total: 18,605 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

TU31_RS22525: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Lyases: decarboxylase

TU31_RS22520: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.91	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.80	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000941.3	0.80	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.72	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.72	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002690.2	0.54	other (other)	FW0622	Verrucosispora sp. FIM060022

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.91	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.80	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000941.3	0.80	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000940.5	0.72	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.72	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002690.2	0.54	other (other)	FW0622	Verrucosispora sp. FIM060022

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.62 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.03 out of 36.53

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.62 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.81 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.24 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.58 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.96 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.96 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.83 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_BBNO01000005.1 - Region 1 - lanthipeptide-class-iii

Download region SVG

Location: 303,304 - 325,922 nt. (total: 22,619 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.53	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.52	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.52	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.52	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000553.3	0.51	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000503.5	0.50	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.53	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.52	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000496.5	0.52	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.52	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000553.3	0.51	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000503.5	0.50	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002700.2	0.49	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002111.3	0.46	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 19.15 out of 20.97

Confidence: strong

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.47 out of 20.01

Confidence: medium

Additional weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.70 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 32.93

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CcpA	Catabolite control protein A
MexT	Global virulence regulator

NZ_BBNO01000005.1 - Region 2 - NRPS

Download region SVG

Location: 409,656 - 454,065 nt. (total: 44,410 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

TU31_RS19695: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase hydrolase

TU31_RS19525: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

TU31_RS19620: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

TU31_RS19530: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

TU31_RS19680: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

TU31_RS19610: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (11):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.50 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.06 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.96 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.84 out of 20.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.83 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.31 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.40 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.91 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 409655 - 454065:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

TU31_RS19610: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (491..895): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSMLSGDISLGGATEASIWSIH
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description

NZ_BBNO01000004.1 - Region 1 - lanthipeptide-class-i

Download region SVG

Location: 331,173 - 357,576 nt. (total: 26,404 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

TU31_RS14820: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

TU31_RS14825: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000544.4	0.46	ribosomal	planosporicin	Planomonospora alba
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0001289.5	0.45	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.41	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.41	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.39	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0000544.4	0.46	ribosomal	planosporicin	Planomonospora alba
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0001289.5	0.45	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.41	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.41	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.39	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for TU31_RS14825

TU31_RS36880

Leader:

MMLSTLEGQPESTGAVAQDPFDLDITVLDAGKTTIELAAS

Core:

DGGCGSTCGTSCVSNAA

Core with dehydrations:

DGGCysGDhaDhbCysGDhbDhaCysVDhaNAA

antiSMASH-DB 4.0 matches for TU31_RS36880

100.0%

NZ_BBNO01000004.1:

Lanthipeptides: TU31_RS36880_lanthipeptide

1

DGGCGSTCGTSCVSNAA

17

DGGCGSTCGTSCVSNAA

1

DGGCGSTCGTSCVSNAA

17

72.2%

NZ_BBUY01000020.1:

Lanthipeptides: AZE13_RS34595_lanthipeptide

1

DGGCGSTCGTSCVSNAA

17

DGGC +TCG +CVSNAA

2

DGGCMATCGNACVSNAA

18

66.7%

NZ_CP023697.1:

Lanthipeptides: CP972_RS03605_lanthipeptide

1

DGGCGSTCGTSCVSNAA

17

DGGCGSTC SCVS+++

2

DGGCGSTCTGSCVSSSS

18

with 144 more sequence matches

Only the first 10 are displayed here.

61.1%

NZ_FZOF01000021.1:

Lanthipeptides: CHF15_RS30750_lanthipeptide

1

DGGCGSTCGTSCVSNAA

17

D GCGSTCG +C + AA

3

DDGCGSTCG-ACTTGAA

18

57.9%

NZ_BBVA01000002.1and 7 others:

NZ_CP030865.1 Lanthipeptides: MicB006_RS27820_lanthipeptideNZ_FMCS01000017.1 Lanthipeptides: GA0070214_RS30700_lanthipeptideNZ_JAGPXW010000015.1 Lanthipeptides: KBX71_RS18490_lanthipeptideNZ_JALJRJ010000030.1 Lanthipeptides: OC439_RS27920_lanthipeptideNZ_LT594324.1 Lanthipeptides: GA0070621_RS04875_lanthipeptideNZ_LT607410.1 Lanthipeptides: GA0074696_RS20405_lanthipeptideNZ_LT607753.1 Lanthipeptides: GA0070614_RS02740_lanthipeptide

Lanthipeptides: A4R25_RS30565_lanthipeptide

1

DGGCGSTCGTSCVSNAA

17

D GCGSTC T+C +N A

4

DDGCGSTC-TACTTNVA

19

55.6%

NC_021177.1and 30 others:

NZ_AP018365.1 Lanthipeptides: RVR_RS08440_lanthipeptideNZ_AQRK01000088.1 Lanthipeptides: YUW_RS13695_lanthipeptideNZ_BMUG01000006.1 Lanthipeptides: IE264_RS18330_lanthipeptideNZ_BMVQ01000014.1 Lanthipeptides: IE283_RS30975_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS19645_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS08000_lanthipeptideNZ_CP022438.1 Lanthipeptides: CGZ69_RS15030_lanthipeptideNZ_CP022438.1 Lanthipeptides: CGZ69_RS15030_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS04650_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS17265_lanthipeptideNZ_CP023702.1 Lanthipeptides: CP967_RS19640_lanthipeptideNZ_CP033073.1 Lanthipeptides: D9753_RS20300_lanthipeptideNZ_CP063808.1 Lanthipeptides: IOD14_RS42650_lanthipeptideNZ_CP071872.1 Lanthipeptides: J4032_RS33705_lanthipeptideNZ_CP071872.1 Lanthipeptides: J4032_RS33705_lanthipeptideNZ_CP075691.1 Lanthipeptides: KKZ08_RS16460_lanthipeptideNZ_CP082362.1 Lanthipeptides: K4G22_RS18080_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS33095_lanthipeptideNZ_CP101138.1 Lanthipeptides: M6G08_RS35600_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS13565_lanthipeptideNZ_CP117866.1 Lanthipeptides: PBV52_RS22590_lanthipeptideNZ_JAFIQY010000056.1 Lanthipeptides: JXZ78_RS36930_lanthipeptideNZ_JAJDST010000050.1 Lanthipeptides: LJC81_RS33260_lanthipeptideNZ_JAJDST010000050.1 Lanthipeptides: LJC81_RS33260_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0119395_lanthipeptideNZ_KB890926.1 Lanthipeptides: B053_RS0114140_lanthipeptideNZ_KB891987.1 Lanthipeptides: B079_RS0100320_lanthipeptideNZ_KB912961.1 Lanthipeptides: B065_RS0117615_lanthipeptideNZ_KQ947985.1 Lanthipeptides: AQI70_RS05650_lanthipeptideNZ_LIPF01000016.1 Lanthipeptides: AMK11_RS35705_lanthipeptide

Lanthipeptides: SFUL_RS28885_lanthipeptide

1

DGGCGSTCGTSCVSNAA

17

D CGSTCG +C +N A

3

DDNCGSTCG-ACTTNVA

18

55.0%

NZ_JAMTCO010000027.1and 1 other:

NZ_RCDD01000001.1 Lanthipeptides: CLV68_RS12320_lanthipeptide

Lanthipeptides: LV75_RS34630_lanthipeptide

1

DGGCGSTCGTSCVSN

15

D GC STC +SCVSN

5

DDGCASTCASSCVSN

19

52.6%

NZ_AP026073.1:

Lanthipeptides: HEK616_RS04840_lanthipeptide

1

DGGCGSTC-GTSCVSN

15

DGGC +TC G +CVS+

2

DGGCAATCGGNACVSS

17

52.4%

NZ_CP009754.1and 3 others:

NZ_CP015588.1 Lanthipeptides: A7J05_RS39740_lanthipeptideNZ_CP116257.1 Lanthipeptides: BJ961_RS11900_lanthipeptideNZ_ML123127.1 Lanthipeptides: EES47_RS19525_lanthipeptide

Lanthipeptides: NI25_RS06460_lanthipeptide

1

DGGCGSTC-GTSCVSNAA

17

DGGCGSTC G +C+S+ +

4

DGGCGSTCGGNACISSGS

21

50.0%

NZ_BCMN01000021.1and 2 others:

NZ_BMSI01000021.1 Lanthipeptides: IE189_RS36010_lanthipeptideNZ_JAPTYM010000001.1 Lanthipeptides: O1M07_RS07535_lanthipeptide

Lanthipeptides: AV140_RS32375_lanthipeptide

1

DGGCGSTCGTSCVSNAA

17

D GCGSTCG +C +N A

7

DDGCGSTCG-ACTTNVA

22

50.0%

NZ_CP044407.1:

Lanthipeptides: F7P10_RS18930_lanthipeptide

1

DGGCGSTCGTSCVSNA

16

D GC STCG +C+SNA

7

DDGCTSTCG-ACISNA

21

50.0%

NZ_KL997433.1and 1 other:

NZ_KL997433.1 Lanthipeptides: IQ62_RS26155_lanthipeptide

Lanthipeptides: IQ62_RS26155_lanthipeptide

1

DGGCGSTCGTSCVS

14

D GCGSTC ++C S

3

DDGCGSTCASACTS

16

47.8%

NZ_CP034550.1:

Lanthipeptides: EKG83_RS09715_lanthipeptide

1

DGGCGSTCGTSCVSNA

16

D GC TC +SCVSNA

8

DDGCDPTCASSCVSNA

23

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

Additional weak hits (3):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.04 out of 29.51

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.59 out of 29.65

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

TU31_RS36880 - Class I

Cleavage pHMM score: -1.80

RODEO score: 16

Monoisotopic mass: 1398.5 Da

Molecular weight: 1399.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 1417.5 Da N = 1; 1435.5 Da N = 2

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 128 - 219; Score: 54.1

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_BBNO01000004.1 - Region 2 - T1PKS

Download region SVG

Location: 666,528 - 712,869 nt. (total: 46,342 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

TU31_RS16175: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

TU31_RS16180: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

TU31_RS16185: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

TU31_RS16195: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

TU31_RS16205: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acetyltransferase

TU31_RS16315: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: esterase hydrolase

TU31_RS16160: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

TU31_RS16280: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

TU31_RS16295: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: ligase synthase

TU31_RS16165: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

TU31_RS16240: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

TU31_RS16245: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

TU31_RS16220: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.65	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.98 out of 20.97

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (24):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.70 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.66 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.19 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.81 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.07 out of 39.62

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.10 out of 31.73

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.72 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.71 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.90 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.86 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.70 out of 36.54

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.82 out of 27.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.48 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.70 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.10 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 666527 - 712869:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

TU31_RS16165: X

AMP-binding (13..422): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWAAFDLTTFDSMAAFGGEYNLYGPTETNACTYY
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (74% 8Å match)
Stachelhaus code match:: 60% (weak)

TU31_RS16240: mmal

PKS_AT (550..844): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 147.0
Ethylmalonyl-CoA: 131.0
Methoxymalonyl-CoA: 121.8
Malonyl-CoA: 96.9
Propionyl-CoA: 83.3
Isobutyryl-CoA: 78.0
2-Methylbutyryl-CoA: 77.3
trans-1,2-CPDA: 75.7
Acetyl-CoA: 54.5
CHC-CoA: 43.1
fatty_acid: 40.7
inactive: 29.3
Benzoyl-CoA: 20.1
3-Methylbutyryl-CoA: 20.1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A

NZ_BBNO01000004.1 - Region 3 - terpene

Download region SVG

Location: 767,795 - 788,856 nt. (total: 21,062 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

TU31_RS16520: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

TU31_RS16545: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase methyltransferase transferase

TU31_RS16530: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

TU31_RS16535: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

TU31_RS16560: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

TU31_RS16555: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

TU31_RS16540: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000706.3	0.45	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000131.5	0.43	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002147.2	0.42	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0000207.5	0.41	PKS	chartreusin	Streptomyces chartreusis
BGC0000003.3	0.39	PKS	AF-toxin	Alternaria alternata
BGC0000234.5	0.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000657.5	0.64	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000706.3	0.45	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000131.5	0.43	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002147.2	0.42	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0000207.5	0.41	PKS	chartreusin	Streptomyces chartreusis
BGC0000003.3	0.39	PKS	AF-toxin	Alternaria alternata
BGC0000234.5	0.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

TU31_RS16555: T1TS

Domain 1 (27 - 347): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.16 out of 26.33

Confidence: medium

Additional weak hits (8):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.60 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.26 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.23 out of 23.43

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.23 out of 36.54

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.89 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
MexT	Global virulence regulator

NZ_BBNO01000003.1 - Region 1 - NRPS,T1PKS,melanin

Download region SVG

Location: 54,992 - 200,665 nt. (total: 145,674 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

TU31_RS09610: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

TU31_RS09655: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

TU31_RS09760: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase acylase

TU31_RS09545: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

TU31_RS09590: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

TU31_RS09600: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

TU31_RS09625: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: amidase esterase

TU31_RS09665: thioesterase

smcogs: SMCOG1004: thioesterase

TU31_RS09680: amidase

smcogs: SMCOG1105: amidase

TU31_RS09720: amidase

smcogs: SMCOG1105: amidase

Lyases: hydratase

TU31_RS09560: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase synthase

TU31_RS09565: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

TU31_RS09605: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

TU31_RS09620: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

TU31_RS09630: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

TU31_RS09640: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

TU31_RS09650: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001477.5	0.86	NRPS, PKS	lydicamycin	Streptomyces sp. ID38640
BGC0001273.3	0.84	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.84	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.83	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.71	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001477.5	0.86	NRPS, PKS	lydicamycin	Streptomyces sp. ID38640
BGC0000910.3	0.79	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000912.3	0.79	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.78	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (25):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.10 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.16 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.57 out of 29.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.04 out of 27.78

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.50 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.72 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.22 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.46 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.15 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.80 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.58 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.16 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.06 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.83 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.60 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.58 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.87 out of 32.74

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.89 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.16 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.85 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 54991 - 200665:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - Me-ccmal) + (ccmal - ccmal - Me-ccmal - ccmal) + (ccmal - Me-ccmal) + (Me-ccmal) + (redmal - Me-ccmal - ccmal) + (ohmal - redmal) + (Me-ccmal - ohmal) + (Gly) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 54991 - 192041:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - Me-ccmal) + (ccmal - ccmal - Me-ccmal - ccmal) + (ccmal - Me-ccmal) + (Me-ccmal) + (redmal - Me-ccmal - ccmal) + (ohmal - redmal) + (Me-ccmal - ohmal) + (Gly) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

TU31_RS09565: X

AMP-binding (10..370): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NRNLHQYGLSMIDACVGAALDSYGSTELGNIAFA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TU31_RS09590: pk

PKS_AT (30..261): pk

ATSignature: (unknown)

No matches above 50%

minowa: trans-1,2-CPDA

Prediction, score:

trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

TU31_RS09600: mal - mmal

PKS_AT (594..891): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.6
inactive: 113.5
Methoxymalonyl-CoA: 49.4
Methylmalonyl-CoA: 44.8
Propionyl-CoA: 38.1
Isobutyryl-CoA: 20.6
Acetyl-CoA: 19.8
Ethylmalonyl-CoA: 13.0
CHC-CoA: 10.7
Benzoyl-CoA: 9.1
2-Methylbutyryl-CoA: 7.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2346..2641): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.3
Ethylmalonyl-CoA: 210.4
Methoxymalonyl-CoA: 179.1
2-Methylbutyryl-CoA: 132.3
trans-1,2-CPDA: 131.1
CHC-CoA: 121.4
Propionyl-CoA: 110.3
Malonyl-CoA: 103.8
Isobutyryl-CoA: 81.2
Benzoyl-CoA: 69.0
Acetyl-CoA: 47.1
3-Methylbutyryl-CoA: 43.2
fatty_acid: 42.1
inactive: 31.8

TU31_RS09605: mal - mal - mmal - mal

PKS_AT (559..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 223.3
inactive: 115.7
Methoxymalonyl-CoA: 61.7
Methylmalonyl-CoA: 54.6
Propionyl-CoA: 44.2
Isobutyryl-CoA: 23.5
Acetyl-CoA: 19.8
2-Methylbutyryl-CoA: 19.5
fatty_acid: 11.7
Ethylmalonyl-CoA: 10.6
Benzoyl-CoA: 7.3
CHC-CoA: 5.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2278..2569): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.1
inactive: 109.2
Methoxymalonyl-CoA: 61.4
Methylmalonyl-CoA: 51.6
Propionyl-CoA: 38.8
Isobutyryl-CoA: 24.7
Acetyl-CoA: 19.1
2-Methylbutyryl-CoA: 15.4
fatty_acid: 8.9
Ethylmalonyl-CoA: 8.6
Benzoyl-CoA: 7.6
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4018..4312): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 213.8
Ethylmalonyl-CoA: 208.1
Methoxymalonyl-CoA: 180.9
2-Methylbutyryl-CoA: 133.0
trans-1,2-CPDA: 129.2
Propionyl-CoA: 111.3
CHC-CoA: 110.2
Malonyl-CoA: 99.8
Isobutyryl-CoA: 79.5
Benzoyl-CoA: 68.7
Acetyl-CoA: 51.8
fatty_acid: 45.9
inactive: 43.6
3-Methylbutyryl-CoA: 40.5

PKS_AT (5775..6070): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.2
inactive: 115.6
Methoxymalonyl-CoA: 55.7
Methylmalonyl-CoA: 52.6
Propionyl-CoA: 38.6
Isobutyryl-CoA: 22.8
Acetyl-CoA: 17.3
Benzoyl-CoA: 10.0
2-Methylbutyryl-CoA: 9.2
fatty_acid: 8.5
trans-1,2-CPDA: 8.1
CHC-CoA: 5.6
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -4.2

TU31_RS09610: mal - mmal

PKS_AT (565..856): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.7
inactive: 109.6
Methoxymalonyl-CoA: 62.7
Methylmalonyl-CoA: 58.3
Propionyl-CoA: 39.1
Isobutyryl-CoA: 24.1
Acetyl-CoA: 16.4
Ethylmalonyl-CoA: 13.5
2-Methylbutyryl-CoA: 12.0
Benzoyl-CoA: 9.4
fatty_acid: 8.1
CHC-CoA: 6.6
trans-1,2-CPDA: 5.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2275..2570): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 213.3
Ethylmalonyl-CoA: 206.0
Methoxymalonyl-CoA: 178.8
2-Methylbutyryl-CoA: 128.0
trans-1,2-CPDA: 127.0
CHC-CoA: 119.8
Propionyl-CoA: 111.4
Malonyl-CoA: 102.5
Isobutyryl-CoA: 77.9
Benzoyl-CoA: 63.2
Acetyl-CoA: 52.5
3-Methylbutyryl-CoA: 45.2
fatty_acid: 42.3
inactive: 41.7

TU31_RS09615: mmal

PKS_AT (576..871): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.5
Ethylmalonyl-CoA: 206.7
Methoxymalonyl-CoA: 177.3
2-Methylbutyryl-CoA: 129.8
trans-1,2-CPDA: 128.1
Propionyl-CoA: 114.3
CHC-CoA: 113.2
Malonyl-CoA: 102.5
Isobutyryl-CoA: 72.5
Benzoyl-CoA: 57.8
Acetyl-CoA: 57.5
inactive: 42.5
fatty_acid: 40.3
3-Methylbutyryl-CoA: 37.8

TU31_RS09620: mal - mmal - mal

PKS_AT (569..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.3
inactive: 110.6
Methoxymalonyl-CoA: 55.5
Methylmalonyl-CoA: 48.5
Propionyl-CoA: 39.3
Isobutyryl-CoA: 22.4
Acetyl-CoA: 21.8
2-Methylbutyryl-CoA: 21.4
Ethylmalonyl-CoA: 15.3
CHC-CoA: 15.3
Benzoyl-CoA: 14.7
fatty_acid: 9.9
trans-1,2-CPDA: 6.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2643..2938): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.8
Ethylmalonyl-CoA: 209.9
Methoxymalonyl-CoA: 180.4
trans-1,2-CPDA: 127.5
2-Methylbutyryl-CoA: 127.3
Propionyl-CoA: 113.2
CHC-CoA: 108.1
Malonyl-CoA: 101.4
Isobutyryl-CoA: 71.6
Benzoyl-CoA: 61.3
Acetyl-CoA: 56.7
fatty_acid: 45.5
3-Methylbutyryl-CoA: 41.3
inactive: 41.1

PKS_AT (4373..4668): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 225.6
inactive: 109.3
Methoxymalonyl-CoA: 58.2
Methylmalonyl-CoA: 53.0
Propionyl-CoA: 37.8
Acetyl-CoA: 18.4
Isobutyryl-CoA: 18.3
fatty_acid: 15.9
Benzoyl-CoA: 8.7
CHC-CoA: 8.2
2-Methylbutyryl-CoA: 7.9
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -4.2

TU31_RS09625: mal - mal

PKS_AT (558..851): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.4
inactive: 123.3
Methoxymalonyl-CoA: 56.3
Methylmalonyl-CoA: 43.9
Propionyl-CoA: 35.4
Isobutyryl-CoA: 25.0
Acetyl-CoA: 19.9
Ethylmalonyl-CoA: 14.7
Benzoyl-CoA: 11.4
2-Methylbutyryl-CoA: 9.0
CHC-CoA: 5.1
trans-1,2-CPDA: 2.8
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2059..2358): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.6
inactive: 104.8
Methoxymalonyl-CoA: 61.4
Methylmalonyl-CoA: 46.4
Propionyl-CoA: 27.7
Isobutyryl-CoA: 27.4
Acetyl-CoA: 22.6
Ethylmalonyl-CoA: 12.8
Benzoyl-CoA: 10.8
fatty_acid: 5.9
CHC-CoA: 5.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -2.7

TU31_RS09630: mmal - mal

PKS_AT (573..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 215.8
Ethylmalonyl-CoA: 205.5
Methoxymalonyl-CoA: 176.6
2-Methylbutyryl-CoA: 144.6
Propionyl-CoA: 126.8
trans-1,2-CPDA: 115.8
CHC-CoA: 112.1
Malonyl-CoA: 95.5
Isobutyryl-CoA: 85.4
Benzoyl-CoA: 75.4
fatty_acid: 45.7
3-Methylbutyryl-CoA: 44.7
Acetyl-CoA: 39.2
inactive: 24.0

PKS_AT (2328..2621): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.0
inactive: 110.5
Methoxymalonyl-CoA: 57.7
Methylmalonyl-CoA: 49.0
Propionyl-CoA: 31.6
Acetyl-CoA: 22.2
Isobutyryl-CoA: 14.5
Ethylmalonyl-CoA: 12.8
2-Methylbutyryl-CoA: 12.1
CHC-CoA: 11.1
Benzoyl-CoA: 8.9
fatty_acid: 8.5
trans-1,2-CPDA: 5.0
3-Methylbutyryl-CoA: 0.0

TU31_RS09640: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (458..843): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LHFTFDISALELQALCGGERNVYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TU31_RS09650: mal

PKS_AT (655..955): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.9
inactive: 120.9
Methoxymalonyl-CoA: 70.0
Methylmalonyl-CoA: 51.9
Isobutyryl-CoA: 32.8
Propionyl-CoA: 30.7
Acetyl-CoA: 26.6
Ethylmalonyl-CoA: 23.1
Benzoyl-CoA: 15.4
2-Methylbutyryl-CoA: 10.8
CHC-CoA: 7.5
trans-1,2-CPDA: 5.6
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000003.1 - Region 2 - T2PKS

Download region SVG

Location: 203,163 - 275,678 nt. (total: 72,516 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase synthase

TU31_RS09825: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

TU31_RS09845: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

TU31_RS09875: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

TU31_RS09880: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

TU31_RS09885: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

TU31_RS09910: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

TU31_RS09950: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

TU31_RS10035: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

TU31_RS10060: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: glycosyltransferase methyltransferase

TU31_RS09860: methyltransferase

smcogs: SMCOG1248: methyltransferase

TU31_RS09990: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

TU31_RS10045: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase synthase

TU31_RS10060: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

TU31_RS10105: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase hydratase

TU31_RS09915: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

TU31_RS09980: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

TU31_RS09985: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Isomerases: mutase

TU31_RS09830: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

TU31_RS10085: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

TU31_RS09965: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

TU31_RS09970: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.75	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.75	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.70	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.63	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.55	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001723.5	0.54	PKS	oviedomycin	Streptomyces antibioticus
BGC0001366.5	0.53	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.75	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.75	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.70	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.63	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.55	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001723.5	0.54	PKS	oviedomycin	Streptomyces antibioticus
BGC0001366.5	0.53	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.19 out of 20.47

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.85 out of 20.97

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.71 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.89 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.25 out of 24.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (33):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.98 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.00 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.59 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.57 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.19 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.81 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.17 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.21 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.85 out of 30.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.11 out of 35.63

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.24 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.82 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.35 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.42 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.96 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.31 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.96 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.70 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.63 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.77 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.55 out of 36.53

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.68 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.90 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.85 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

TU31_RS09840: X

AMP-binding (72..305): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MDTFLDPRWVK-FAIWGGTVGGYG---GTMMLGT
Nearest Stachelhaus code(s):: Val DAFFIGGTFK (35% 8Å match); Leu or Ile DALFIGGTFK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

Type II PKS gene cluster prediction details

Cluster section:: 203162 to 275678
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

TU31_RS09875: KR (Score: 183.8; E-value: 1.1e-56)
TU31_RS09880: KR (Score: 155.2; E-value: 5.8e-48)
TU31_RS09905: OXY (Score: 44.4; E-value: 2.7e-14)
TU31_RS09950: OXY (Score: 287.8; E-value: 4.1e-88)
TU31_RS09960: CYC C5-C18 (Score: 213.6; E-value: 1.7e-66)
TU31_RS09965: KS (Score: 717.8; E-value: 8.5e-219)
TU31_RS09970: CLF (Score: 551.1; E-value: 3.3e-168)
TU31_RS09975: ACP (Score: 66.0; E-value: 5.2e-21)
TU31_RS09980: CYC C9-C14 (Score: 243.6; E-value: 1.5e-75)
TU31_RS09985: CYC C4-C21/C2-C23|C2-C19 (Score: 160.2; E-value: 3.2e-50)
TU31_RS09990: MET C6|C8 (Score: 533.9; E-value: 2.9e-163)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000003.1 - Region 3 - RiPP-like,terpene

Download region SVG

Location: 303,877 - 329,293 nt. (total: 25,417 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

TU31_RS10355: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.35	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.34	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.32	ribosomal	microcin L	Escherichia coli
BGC0002698.2	0.32	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002699.2	0.30	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000518.3	0.27	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002306.2	0.27	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000617.5	0.25	ribosomal	coagulin	Bacillus coagulans
BGC0000504.5	0.25	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000484.5	0.25	ribosomal	glycocin F	Lactobacillus plantarum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.57	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.57	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0002699.2	0.52	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002698.2	0.52	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001555.4	0.52	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.50	ribosomal	microcin N	Escherichia coli
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001948.3	0.49	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0000588.5	0.49	ribosomal	microcin L	Escherichia coli
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

TU31_RS10325: PT_phytoene_like

Domain 1 (18 - 307): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

Additional weak hits (12):

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.87 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.17 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.27 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.17 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.83 out of 24.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.99 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000003.1 - Region 4 - NAPAA

Download region SVG

Location: 345,706 - 381,816 nt. (total: 36,111 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

TU31_RS10480: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

TU31_RS10485: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

TU31_RS10500: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

TU31_RS10505: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

TU31_RS10510: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Hydrolases: deaminase

TU31_RS10530: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: hydratase lyase

TU31_RS10580: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

TU31_RS10585: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

TU31_RS10525: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

TU31_RS10535: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

TU31_RS10595: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0002174.2	0.63	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0002174.2	0.63	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 345705 - 381816:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

TU31_RS10535: X

AMP-binding (239..643): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQSQVSVTGEVNAYGLTETSDDTHH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (94% 8Å match); dnmeProp or Dab DIWQSTADDK (82% 8Å match); Asp DIWQSTADDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000003.1 - Region 5 - T3PKS,lanthipeptide-class-iii

BGC0000553.3 (SSGG_RS09925):

Download region SVG

Location: 469,556 - 519,196 nt. (total: 49,641 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

TU31_RS11085: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

TU31_RS11090: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

TU31_RS11185: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: synthase

TU31_RS11080: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	1.11	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.72	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001310.5	0.62	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000513.3	0.55	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.54	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.53	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.45	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.42	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000518.3	0.39	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002698.2	0.38	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.85	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000551.5	0.82	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.69	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.61	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000285.5	0.61	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002127.3	0.60	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for TU31_RS10990

TU31_RS37940

Leader:

MSLLDLQTLETPKAEATEELH

Core:

TGSRASLLLCGDSSLSVTTCN

Core with dehydrations:

DhbGDhaRADhaLLLCysGDDhaDhaLDhaVDhbDhbCysN

antiSMASH-DB 4.0 matches for TU31_RS37940

100.0%

NC_018750.1and 67 others:

NC_018750.1 Lanthipeptides: SVEN_RS32110_lanthipeptideNZ_BBNO01000003.1 Lanthipeptides: TU31_RS37940_lanthipeptideNZ_BMTO01000007.1 Lanthipeptides: IE136_RS15615_lanthipeptideNZ_BMUN01000001.1 Lanthipeptides: IE238_RS00740_lanthipeptideNZ_CP009754.1 Lanthipeptides: NI25_RS05015_lanthipeptideNZ_CP015866.1 Lanthipeptides: Spa2297_RS27800_lanthipeptideNZ_CP017157.1 Lanthipeptides: SL103_RS15895_lanthipeptideNZ_CP019457.1 Lanthipeptides: BXT88_RS03410_lanthipeptideNZ_CP019724.1 Lanthipeptides: B1H29_RS35355_lanthipeptideNZ_CP019779.1 Lanthipeptides: STRMOE7_RS03775_lanthipeptideNZ_CP023691.1 Lanthipeptides: CP981_RS03050_lanthipeptideNZ_CP023700.1 Lanthipeptides: CP969_RS04700_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34970_lanthipeptideNZ_CP029042.1 Lanthipeptides: DDE74_RS03525_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029195.1 Lanthipeptides: DEJ45_RS04995_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029196.1 Lanthipeptides: DEJ44_RS30395_lanthipeptideNZ_CP029541.1 Lanthipeptides: DKG71_RS05245_lanthipeptideNZ_CP034353.1 Lanthipeptides: D1J63_RS04900_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35250_lanthipeptideNZ_CP043317.1 Lanthipeptides: FYC74_RS09720_lanthipeptideNZ_CP046905.1 Lanthipeptides: GPZ77_RS32930_lanthipeptideNZ_CP047140.1 Lanthipeptides: GLX30_RS11420_lanthipeptideNZ_CP050976.1 Lanthipeptides: HEP86_RS04470_lanthipeptideNZ_CP054920.1 Lanthipeptides: HUT15_RS04615_lanthipeptideNZ_CP060825.1 Lanthipeptides: IAG43_RS32355_lanthipeptideNZ_CP074111.1 Lanthipeptides: KE639_RS31630_lanthipeptideNZ_CP084681.1 Lanthipeptides: KI385_RS00885_lanthipeptideNZ_CP085300.1 Lanthipeptides: LJA35_RS05220_lanthipeptideNZ_CP086217.1 Lanthipeptides: LJ741_RS03435_lanthipeptideNZ_CP094676.1 Lanthipeptides: L6J92_RS09690_lanthipeptideNZ_CP098437.1 Lanthipeptides: NCG97_RS34740_lanthipeptideNZ_CP099468.1 Lanthipeptides: NFX46_RS16770_lanthipeptideNZ_CP101137.1 Lanthipeptides: M6G08_RS24535_lanthipeptideNZ_CP102609.1 Lanthipeptides: NUT86_RS03980_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33560_lanthipeptideNZ_CP114202.1 Lanthipeptides: STRLI_RS35870_lanthipeptideNZ_CP114203.1 Lanthipeptides: STRNI_RS37360_lanthipeptideNZ_CP114205.1 Lanthipeptides: STRTU_RS33380_lanthipeptideNZ_JACHJE010000006.1 Lanthipeptides: FHS32_RS15850_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACSCH020000032.1 Lanthipeptides: E0F75_RS38565_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00800_lanthipeptideNZ_JAFEJA010000002.1 Lanthipeptides: JE024_RS34830_lanthipeptideNZ_JAGPYC010000033.1 Lanthipeptides: KBZ00_RS31440_lanthipeptideNZ_JAHLXF010000022.1 Lanthipeptides: KQY13_RS30555_lanthipeptideNZ_JAIHBQ010000001.1 Lanthipeptides: K4902_RS04515_lanthipeptideNZ_JAJJMU010000026.1 Lanthipeptides: LOC25_RS31275_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAJNOJ010000002.1 Lanthipeptides: MBT42_RS06255_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAMGSL010000004.1 Lanthipeptides: M5362_RS09920_lanthipeptideNZ_JAPKNL010000004.1 Lanthipeptides: OSI21_RS07750_lanthipeptideNZ_JH993790.1 Lanthipeptides: STRVIR_RS0131905_lanthipeptideNZ_KN039948.1 Lanthipeptides: FM21_RS29525_lanthipeptideNZ_LIPF01000004.1 Lanthipeptides: AMK11_RS16660_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVV01000002.1 Lanthipeptides: AMK27_RS08700_lanthipeptideNZ_LIVX01000004.1 Lanthipeptides: AMK29_RS15650_lanthipeptideNZ_LIWB01000010.1 Lanthipeptides: AMK33_RS24360_lanthipeptideNZ_MPOH02000012.1 Lanthipeptides: BM536_RS17150_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_NNBP01000011.1 Lanthipeptides: CG747_RS19290_lanthipeptideNZ_RAIF01000032.1 Lanthipeptides: EBH09_RS35480_lanthipeptideNZ_SOPG01000008.1 Lanthipeptides: E0I08_RS17090_lanthipeptide

Lanthipeptides: SVEN_RS32110_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLSVTTCN

1

TGSRASLLLCGDSSLSVTTCN

21

95.2%

NZ_BBOK01000011.1and 23 others:

NZ_BEWD01000001.1 Lanthipeptides: Sru02f_RS01660_lanthipeptideNZ_BMSL01000016.1 Lanthipeptides: IE215_RS23330_lanthipeptideNZ_BMUC01000023.1 Lanthipeptides: IE172_RS32210_lanthipeptideNZ_BMVQ01000005.1 Lanthipeptides: IE283_RS17035_lanthipeptideNZ_BMWI01000025.1 Lanthipeptides: IE253_RS33945_lanthipeptideNZ_CP012382.1 Lanthipeptides: SAM23877_RS30085_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS29010_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS34495_lanthipeptideNZ_CP043959.1 Lanthipeptides: F3L20_RS19105_lanthipeptideNZ_CP045547.1 Lanthipeptides: GEV49_RS05730_lanthipeptideNZ_CP054939.1 Lanthipeptides: HUT14_RS29815_lanthipeptideNZ_CP094918.1 Lanthipeptides: MTR79_RS16715_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS05020_lanthipeptideNZ_JAAIFS010000001.1 Lanthipeptides: GUR47_RS02255_lanthipeptideNZ_KZ195574.1 Lanthipeptides: B9W62_RS05695_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS34110_lanthipeptideNZ_MQUH01000025.1 Lanthipeptides: BSZ07_RS33280_lanthipeptideNZ_RAII01000001.1 Lanthipeptides: EBH12_RS10360_lanthipeptideNZ_RSEG01000006.1 Lanthipeptides: EIA57_RS12710_lanthipeptideNZ_SOAV01000001.1 Lanthipeptides: EV562_RS04520_lanthipeptideNZ_VIUV01000020.1 Lanthipeptides: FB570_RS34060_lanthipeptideNZ_WHZR01000001.1 Lanthipeptides: STPH1_RS04005_lanthipeptideNZ_WXVT01000001.1 Lanthipeptides: STPH2_RS03995_lanthipeptide

Lanthipeptides: APK71_RS25550_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLS+TTCN

1

TGSRASLLLCGDSSLSITTCN

21

95.2%

NZ_BMSV01000002.1and 18 others:

NZ_BMTP01000009.1 Lanthipeptides: IE109_RS18470_lanthipeptideNZ_CP007699.2 Lanthipeptides: T261_RS39185_lanthipeptideNZ_CP020042.1 Lanthipeptides: B4U46_RS32710_lanthipeptideNZ_CP023202.1 Lanthipeptides: SXIN_RS23100_lanthipeptideNZ_CP023692.1 Lanthipeptides: CP980_RS04735_lanthipeptideNZ_CP028158.1 Lanthipeptides: C6361_RS04660_lanthipeptideNZ_CP028159.1 Lanthipeptides: C6W10_RS01185_lanthipeptideNZ_CP034279.1 Lanthipeptides: EIZ62_RS28660_lanthipeptideNZ_CP102332.1 Lanthipeptides: NRO40_RS01140_lanthipeptideNZ_FNHI01000003.1 Lanthipeptides: BLT82_RS06465_lanthipeptideNZ_JADMLH010000003.1 Lanthipeptides: IT780_RS09875_lanthipeptideNZ_JAGGOI010000031.1 Lanthipeptides: J7E87_RS22160_lanthipeptideNZ_JAGPXX010000007.1 Lanthipeptides: KBZ10_RS10785_lanthipeptideNZ_JAPNLM010000003.1 Lanthipeptides: OTB16_RS07305_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIVQ01000005.1 Lanthipeptides: AMK16_RS35205_lanthipeptideNZ_LIYH01000004.1 Lanthipeptides: AMK26_RS17765_lanthipeptideNZ_NBCN01000003.1 Lanthipeptides: BKD26_RS06570_lanthipeptide

Lanthipeptides: IE106_RS06150_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GSRASLLLCGDSSLSVTTCN

1

GSRASLLLCGDSSLSVTTCN

20

with 73 more sequence matches

Only the first 10 are displayed here.

95.2%

NZ_BMTU01000009.1and 1 other:

NZ_JACHJI010000005.1 Lanthipeptides: FHS37_RS15430_lanthipeptide

Lanthipeptides: IE118_RS22890_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

+GSRASLLLCGDSSLSVTTCN

1

SGSRASLLLCGDSSLSVTTCN

21

95.2%

NZ_BNCA01000002.1and 1 other:

NZ_CP049782.1 Lanthipeptides: G7Z12_RS34445_lanthipeptide

Lanthipeptides: IE314_RS02760_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLSV+TCN

1

TGSRASLLLCGDSSLSVSTCN

21

90.5%

NZ_CP048835.1:

Lanthipeptides: C8250_RS00390_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GSRASLLLCG+SSLSVTTCN

2

GSRASLLLCGNSSLSVTTCN

21

90.5%

NZ_GG657758.1and 1 other:

NZ_JACHEM010000005.1 Lanthipeptides: HNQ79_RS11445_lanthipeptide

Lanthipeptides: SSRG_RS03855_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

+GSRASLLLCGDSSLS+TTCN

1

SGSRASLLLCGDSSLSITTCN

21

90.5%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GS+ASLLLCGDSSLSVTTCN

2

GSQASLLLCGDSSLSVTTCN

21

85.7%

NZ_CP036455.1:

Lanthipeptides: EKD16_RS17975_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GS ASLLLCGDSSLS+TTCN

2

GSEASLLLCGDSSLSLTTCN

21

85.7%

NZ_CP077658.1:

Lanthipeptides: KQY30_RS33045_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

SRASLLLCGDSSLSV TCN

1

ASRASLLLCGDSSLSVVTCN

20

85.7%

NZ_CP092183.1:

Lanthipeptides: COUCH_RS09775_lanthipeptide

4

RASLLLCGDSSLSVTTCN

21

RASLLLCGDSSLSVTTCN

1

RASLLLCGDSSLSVTTCN

18

85.7%

NZ_FOET01000001.1and 2 others:

NZ_FOSG01000005.1 Lanthipeptides: BM237_RS08435_lanthipeptideNZ_PDKQ02000044.1 Lanthipeptides: BFM75_RS16855_lanthipeptide

Lanthipeptides: BMY40_RS02540_lanthipeptide

2

GSRASLLLCGDSSLSVTTCN

21

GS ASLLLCGDSSLSVTTC

2

GSEASLLLCGDSSLSVTTCR

21

83.3%

NZ_CP007574.1and 6 others:

NZ_CP007574.1 Lanthipeptides: DC74_RS36920_lanthipeptideNZ_CP026094.1 Lanthipeptides: SE95_RS37250_lanthipeptideNZ_CP104098.1 Lanthipeptides: N1H47_RS36625_lanthipeptideNZ_CP104098.1 Lanthipeptides: N1H47_RS36625_lanthipeptideNZ_CP119144.1 Lanthipeptides: P0D74_RS03260_lanthipeptideNZ_CP119144.1 Lanthipeptides: P0D74_RS03260_lanthipeptide

Lanthipeptides: DC74_RS36920_lanthipeptide

1

TGSRASLLLCGDSSLSVTTCN

21

TGSRASLLLCGDSSLSVTTC

4

TGSRASLLLCGDSSLSVTTCK

24

MIBiG 4.0 matches for TU31_RS37940

59.1%

Lanthipeptide: SRO15-2212

1

TGSRASLLLCGDSSLSVTTCN

21

TGS+ SLL+C SSLSV C

1

TGSQVSLLVCEYSSLSVVLCT

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.36 out of 20.97

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (6):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.44 out of 25.88

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.46 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.94 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.00 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.10 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.68 out of 24.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

TFBS Finder

Core peptide predictions

TU31_RS37940 - Class III

Cleavage pHMM score: 14.70

RODEO score: 0

Monoisotopic mass: 1940.0 Da

Molecular weight: 1941.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1959.2 Da N = 1; 1977.2 Da N = 2; 1995.2 Da N = 3; 2013.2 Da N = 4; 2031.3 Da N = 5; 2049.3 Da N = 6

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000002.1 - Region 1 - NRPS,lassopeptide

Download region SVG

Location: 122,947 - 195,227 nt. (total: 72,281 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

TU31_RS06070: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

TU31_RS06080: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

TU31_RS06095: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Transferases: halogenase

TU31_RS06075: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

TU31_RS06170: halogenase

smcogs: SMCOG1119: halogenase

Hydrolases: deaminase esterase hydrolase

TU31_RS06100: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

TU31_RS06165: thioesterase

smcogs: SMCOG1004: thioesterase

TU31_RS06175: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

TU31_RS06215: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

TU31_RS06090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

TU31_RS06105: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

TU31_RS06145: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

TU31_RS06150: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

TU31_RS06155: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	1.37	ribosomal	ulleungdin	Streptomyces sp.
BGC0001833.4	0.81	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001539.4	0.81	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001132.4	0.81	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.80	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001507.3	0.80	ribosomal	anantin C	Streptomyces olindensis
BGC0002074.2	0.79	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0002286.3	0.78	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.76	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.88	ribosomal	ulleungdin	Streptomyces sp.
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.74	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.74 out of 27.04

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.41 out of 23.43

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (14):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.36 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.28 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.73 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.21 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.43 out of 32.93

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.72 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.91 out of 33.14

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.09 out of 30.11

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.47 out of 32.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.95 out of 27.55

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 122946 - 195227:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - X - Leu) + (Phe - D-Thr) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

TU31_RS06090: X

AMP-binding (251..655): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQAQASATGEVNAYGLTETSDDTNH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (91% 8Å match); dnmeProp or Dab DIWQSTADDK (82% 8Å match); Asp DIWQSTADDK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

TU31_RS06145: X - X - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (25..424): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWSSFDMTVTSVKAMLGGELNVYGPTEVTVNAAE
Nearest Stachelhaus code(s):: bMe-Asp DLTKMGVVNK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1088..1488): X

nrpys: OH-Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWTSFDLTATGAKAVLGGEINEYGPTETTVGCSE
Nearest Stachelhaus code(s):: OH-Asn DLTKVGEVGK (88% 8Å match); Asn DLTKVGEVGK (79% 8Å match); Trp DLTKVGEVGK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2150..2540): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LSASFDASVIEMLIVTGADINSYGPTESTVAATM
Nearest Stachelhaus code(s):: Leu DALLVGAVAK (74% 8Å match); 3OH-Leu DALLVGAVAK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

TU31_RS06150: Phe - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (468..859): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LTHAFDAAAWEMTLVVAGEVNAYGPTEATVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1524..1939): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TU31_RS06155: X

AMP-binding (1026..1424): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FNQAFDVSVAEWMIITGAEINAYGPTEATCDVSF
Nearest Stachelhaus code(s):: 5-clTrp DVAMAGAVTK (62% 8Å match); Arg DVADVGAIDK (38% 8Å match)
Stachelhaus code match:: 70% (weak)

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 1 - 75; Score: 82.7

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
DasR	N-acetylglucosamine dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000002.1 - Region 2 - terpene

Download region SVG

Location: 297,877 - 320,111 nt. (total: 22,235 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

TU31_RS06675: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: aminotransferase

TU31_RS06730: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase

TU31_RS06660: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

TU31_RS06715: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

TU31_RS06700: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.83	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000255.5	0.43	PKS	pederin	Uncultured bacterium
BGC0002382.3	0.42	ribosomal	grimoviridin	Grimontia marina
BGC0001484.3	0.40	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0000820.5	0.40	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001223.5	0.40	other (other)	hydroxysporine	uncultured bacterium
BGC0000905.5	0.40	other (other)	heme D1	Heliobacillus mobilis
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0002482.2	0.39	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0002514.3	0.39	PKS	julichrome Q6.6	Streptomyces sampsonii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.83	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000255.5	0.43	PKS	pederin	Uncultured bacterium
BGC0002382.3	0.42	ribosomal	grimoviridin	Grimontia marina
BGC0001484.3	0.40	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0000820.5	0.40	other (other)	physostigmine	Streptomyces griseofuscus
BGC0001223.5	0.40	other (other)	hydroxysporine	uncultured bacterium
BGC0000905.5	0.40	other (other)	heme D1	Heliobacillus mobilis
BGC0000906.3	0.40	other (other)	heme D1	Heliophilum fasciatum
BGC0002482.2	0.39	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0002514.3	0.39	PKS	julichrome Q6.6	Streptomyces sampsonii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

TU31_RS06700: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (344 - 708): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.83 out of 23.79

Confidence: medium

Additional weak hits (10):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.36 out of 27.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.54 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.54 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.54 out of 23.43

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.02 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.13 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.60 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism

NZ_BBNO01000001.1 - Region 1 - atropopeptide

Download region SVG

Location: 366,762 - 388,053 nt. (total: 21,292 nt) Show pHMM detection rules used

atropopeptide: atropopeptide_p450

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

TU31_RS01635: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: hydrolase

TU31_RS01600: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002751.2	0.82	ribosomal	Amyxirubin B	Amycolatopsis xylanica
BGC0000605.5	0.35	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0002359.3	0.34	NRPS	dudomycin A	Streptomyces albus subsp. chlorinus
BGC0000934.4	0.34	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0000932.5	0.32	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0002488.3	0.31	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002496.3	0.31	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000877.5	0.30	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001484.3	0.29	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0000875.4	0.28	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002751.2	0.82	ribosomal	Amyxirubin B	Amycolatopsis xylanica
BGC0000605.5	0.35	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0002359.3	0.34	NRPS	dudomycin A	Streptomyces albus subsp. chlorinus
BGC0000934.4	0.34	other (phenazine)	5-acetyl-5,10-dihydrophenazine-1-carboxylic acid, 5-(2-hydroxyacetyl)-5,10-dihydrophenazine-1-carboxylic acid, endophenazine A1, endophenazine F, endophenazine G	Kitasatospora sp. HKI 714
BGC0000932.5	0.32	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0002488.3	0.31	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002496.3	0.31	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000877.5	0.30	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001484.3	0.29	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0000875.4	0.28	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

Additional weak hits (5):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.28 out of 27.55

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.12 out of 30.98

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.01 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.18 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_BBNO01000001.1 - Region 2 - triceptide