GCF_000826545.1 - 56 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CDME01000002.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lanthipeptide-class-ii,terpene	11,435	40,517
Region 2.2	lassopeptide,NRPS,T1PKS,NRPS-like,NRP-metallophore,betalactone	58,533	240,506	Medium	SSV-2083	ribosomal:RiPP:Lanthipeptide
Region 2.3	t3nrps-iterative	275,533	330,367
Region 2.4	NRPS,T1PKS	384,955	435,673
Region 2.5	aminopolycarboxylic-acid	464,863	478,265	Low	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	other:other
Region 2.6	NRPS,betalactone	521,271	567,246
Region 2.7	NRPS	595,253	688,138
Region 2.8	T1PKS,terpene	695,182	807,860	Low	pladienolide B	PKS
Region 2.9	terpene	828,997	858,980	Low	xiamycin A	terpene:Sesquiterpene
Region 2.10	terpene	1,369,756	1,390,856	Low	2-methylisoborneol	terpene:Monoterpene
Region 2.11	T2PKS,t3nrps-iterative,T1PKS	1,406,687	1,531,072	High	azicemicin B	PKS
Region 2.12	T1PKS,NRPS-like	1,610,853	1,679,428	Low	sporolide A/sporolide B	NRPS:Type I+PKS:Enediyne type I
Region 2.13	NRPS,T1PKS,NRPS-like	1,841,450	1,895,847
Region 2.14	NRPS-like	1,925,240	1,967,618
Region 2.15	RiPP-like	2,086,103	2,096,897
Region 2.16	T3PKS,arylpolyene	2,160,120	2,205,776	Low	virginiamycin S1	NRPS:Type I+PKS
Region 2.17	T1PKS	2,250,462	2,296,995
Region 2.18	terpene-precursor	2,308,368	2,329,288
Region 2.19	terpene	2,385,285	2,404,273	Low	isorenieratene	terpene

NZ_CDME01000004.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	hydrogen-cyanide	119,877	132,472

NZ_CDME01000006.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	lanthipeptide-class-iii	587,627	610,206
Region 6.2	melanin	735,903	746,208

NZ_CDME01000007.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	NRPS,T1PKS	1	52,985	Low	Q6402A	NRPS:Type I

NZ_CDME01000008.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	NAPAA	418,588	452,430	High	ε-Poly-L-lysine	NRPS:Type I
Region 8.2	NRPS-like,lanthipeptide-class-iii	453,085	500,980
Region 8.3	ectoine	562,788	573,162
Region 8.4	HR-T2PKS	749,558	794,363
Region 8.5	terpene	1,067,472	1,089,679	High	geosmin	terpene:Sesquiterpene
Region 8.6	HR-T2PKS,other	1,114,089	1,167,044	Medium	metatricycloene	PKS
Region 8.7	terpene-precursor	1,252,438	1,273,478
Region 8.8	T1PKS,NRPS,phosphonate	1,276,629	1,359,403
Region 8.9	azole-containing-RiPP,thioamitides	1,423,388	1,447,771

NZ_CDME01000010.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	T1PKS,hglE-KS	1	36,584
Region 10.2	ectoine	171,714	182,088
Region 10.3	T1PKS	183,253	226,237
Region 10.4	NRPS,ectoine	263,896	316,837	Low	kosinostatin	NRPS:Type I+PKS
Region 10.5	RiPP-like	340,651	367,078
Region 10.6	terpene-precursor	393,134	414,174	Low	aurachin C/aurachin D/aurachin SS	PKS+terpene

NZ_CDME01000011.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	terpene	705,338	726,786
Region 11.2	ectoine	1,013,610	1,024,005	High	ectoine	other:other
Region 11.3	lassopeptide	1,068,474	1,090,935
Region 11.4	azole-containing-RiPP	1,184,886	1,210,592	Low	streptamidine	ribosomal:unmodified
Region 11.5	other,T2PKS,NRPS,NRP-metallophore	1,308,390	1,428,398	Low	xantholipin	PKS
Region 11.6	T2PKS	1,479,301	1,551,816
Region 11.7	indole	1,600,859	1,621,941
Region 11.8	terpene	1,887,694	1,908,788
Region 11.9	azole-containing-RiPP	1,937,064	1,957,044

NZ_CDME01000012.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	T2PKS	26,680	99,150	Medium	griseusin	PKS

NZ_CDME01000013.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	thioamide-NRP	53,410	124,643	Low	enteromycin	PKS+NRPS:Type I

NZ_CDME01000014.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 14.1	NAPAA	255,132	288,974	High	ε-Poly-L-lysine	NRPS:Type I
Region 14.2	NRPS	501,327	567,540
Region 14.3	lanthipeptide-class-ii	579,984	602,884

NZ_CDME01000015.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 15.1	redox-cofactor	69,612	91,659	Low	lankacidin C	NRPS:Type I+PKS
Region 15.2	melanin	216,018	226,368	Low	grixazone A	terpene
Region 15.3	CDPS	497,428	518,090

NZ_CDME01000016.1 (Kibdelosporangium sp. MJ126-NF4)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	T1PKS,NRPS-like	502,872	556,965	Low	amipurimycin	PKS

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lanthipeptide-class-ii,terpene	11,435	40,517
Region 2.2	lassopeptide,NRPS,T1PKS,NRPS-like,NRP-metallophore,betalactone	58,533	240,506	Medium	SSV-2083	ribosomal:RiPP:Lanthipeptide
Region 2.3	t3nrps-iterative	275,533	330,367
Region 2.4	NRPS,T1PKS	384,955	435,673
Region 2.5	aminopolycarboxylic-acid	464,863	478,265	Low	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	other:other
Region 2.6	NRPS,betalactone	521,271	567,246
Region 2.7	NRPS	595,253	688,138
Region 2.8	T1PKS,terpene	695,182	807,860	Low	pladienolide B	PKS
Region 2.9	terpene	828,997	858,980	Low	xiamycin A	terpene:Sesquiterpene
Region 2.10	terpene	1,369,756	1,390,856	Low	2-methylisoborneol	terpene:Monoterpene
Region 2.11	T2PKS,t3nrps-iterative,T1PKS	1,406,687	1,531,072	High	azicemicin B	PKS
Region 2.12	T1PKS,NRPS-like	1,610,853	1,679,428	Low	sporolide A/sporolide B	NRPS:Type I+PKS:Enediyne type I
Region 2.13	NRPS,T1PKS,NRPS-like	1,841,450	1,895,847
Region 2.14	NRPS-like	1,925,240	1,967,618
Region 2.15	RiPP-like	2,086,103	2,096,897
Region 2.16	T3PKS,arylpolyene	2,160,120	2,205,776	Low	virginiamycin S1	NRPS:Type I+PKS
Region 2.17	T1PKS	2,250,462	2,296,995
Region 2.18	terpene-precursor	2,308,368	2,329,288
Region 2.19	terpene	2,385,285	2,404,273	Low	isorenieratene	terpene
Region 4.1	hydrogen-cyanide	119,877	132,472
Region 6.1	lanthipeptide-class-iii	587,627	610,206
Region 6.2	melanin	735,903	746,208
Region 7.1	NRPS,T1PKS	1	52,985	Low	Q6402A	NRPS:Type I
Region 8.1	NAPAA	418,588	452,430	High	ε-Poly-L-lysine	NRPS:Type I
Region 8.2	NRPS-like,lanthipeptide-class-iii	453,085	500,980
Region 8.3	ectoine	562,788	573,162
Region 8.4	HR-T2PKS	749,558	794,363
Region 8.5	terpene	1,067,472	1,089,679	High	geosmin	terpene:Sesquiterpene
Region 8.6	HR-T2PKS,other	1,114,089	1,167,044	Medium	metatricycloene	PKS
Region 8.7	terpene-precursor	1,252,438	1,273,478
Region 8.8	T1PKS,NRPS,phosphonate	1,276,629	1,359,403
Region 8.9	azole-containing-RiPP,thioamitides	1,423,388	1,447,771
Region 10.1	T1PKS,hglE-KS	1	36,584
Region 10.2	ectoine	171,714	182,088
Region 10.3	T1PKS	183,253	226,237
Region 10.4	NRPS,ectoine	263,896	316,837	Low	kosinostatin	NRPS:Type I+PKS
Region 10.5	RiPP-like	340,651	367,078
Region 10.6	terpene-precursor	393,134	414,174	Low	aurachin C/aurachin D/aurachin SS	PKS+terpene
Region 11.1	terpene	705,338	726,786
Region 11.2	ectoine	1,013,610	1,024,005	High	ectoine	other:other
Region 11.3	lassopeptide	1,068,474	1,090,935
Region 11.4	azole-containing-RiPP	1,184,886	1,210,592	Low	streptamidine	ribosomal:unmodified
Region 11.5	other,T2PKS,NRPS,NRP-metallophore	1,308,390	1,428,398	Low	xantholipin	PKS
Region 11.6	T2PKS	1,479,301	1,551,816
Region 11.7	indole	1,600,859	1,621,941
Region 11.8	terpene	1,887,694	1,908,788
Region 11.9	azole-containing-RiPP	1,937,064	1,957,044
Region 12.1	T2PKS	26,680	99,150	Medium	griseusin	PKS
Region 13.1	thioamide-NRP	53,410	124,643	Low	enteromycin	PKS+NRPS:Type I
Region 14.1	NAPAA	255,132	288,974	High	ε-Poly-L-lysine	NRPS:Type I
Region 14.2	NRPS	501,327	567,540
Region 14.3	lanthipeptide-class-ii	579,984	602,884
Region 15.1	redox-cofactor	69,612	91,659	Low	lankacidin C	NRPS:Type I+PKS
Region 15.2	melanin	216,018	226,368	Low	grixazone A	terpene
Region 15.3	CDPS	497,428	518,090
Region 16.1	T1PKS,NRPS-like	502,872	556,965	Low	amipurimycin	PKS

No secondary metabolite regions were found in these records:: NZ_CDME01000001.1 (Kibdelosporangium sp. MJ126-NF4); NZ_CDME01000003.1 (Kibdelosporangium sp. MJ126-NF4); NZ_CDME01000005.1 (Kibdelosporangium sp. MJ126-NF4); NZ_CDME01000009.1 (Kibdelosporangium sp. MJ126-NF4); NZ_CDME01000017.1 (Kibdelosporangium sp. MJ126-NF4); NZ_CDME01000018.1 (Kibdelosporangium sp. MJ126-NF4); NZ_CDME01000019.1 (Kibdelosporangium sp. MJ126-NF4); NZ_CDME01000020.1 (Kibdelosporangium sp. MJ126-NF4); NZ_CDME01000021.1 (Kibdelosporangium sp. MJ126-NF4)

Compact view

NZ_CDME01000002.1 - Region 1 - lanthipeptide-class-ii,terpene

Download region GenBank file

Download region SVG

Location: 11,435 - 40,517 nt. (total: 29,083 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BN1199_RS00595: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BN1199_RS00670: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase

BN1199_RS00655: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

BN1199_RS00675: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002703.2	0.35	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.34	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000675.5	0.34	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002173.2	0.33	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000677.5	0.33	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002699.2	0.31	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000500.5	0.29	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000516.4	0.29	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0000517.4	0.29	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.29	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000675.5	0.50	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0002699.2	0.46	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0000500.5	0.45	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000516.4	0.44	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0000517.4	0.44	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.44	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BN1199_RS00655

BN1199_RS00660

Leader:

MTNTPEESANAENDQQPQAIGAVDRLRMLPVTAPFGLRAAALAGLVLTAGA

Core:

AAAGAAGVFDDPASAVAVFPICSIEDPH

Core with dehydrations:

AAAGAAGVFDDPADhaAVAVFPICysDhaIEDPH

antiSMASH-DB 4.0 matches for BN1199_RS00660

100.0%

NZ_CDME01000002.1:

Lanthipeptides: BN1199_RS00660_lanthipeptide

1

AAAGAAGVFDDPASAVAVFPICSIEDPH

28

AAAGAAGVFDDPASAVAVFPICSIEDPH

1

AAAGAAGVFDDPASAVAVFPICSIEDPH

28

42.9%

NZ_CP012752.1:

Lanthipeptides: AOZ06_RS24070_lanthipeptide

5

AAGVFDDPASAVA-VFPICSI

24

AGVFDDP+ V+ + PICS+

2

TAGVFDDPSGGVSPICPICSM

22

41.9%

NZ_FNDV01000004.1:

Lanthipeptides: BLR56_RS33870_lanthipeptide

1

AAAGAAGVFDDPASAVAVFP---ICSIEDPH

28

A G +G+FDDPA+ +A +P C E P

2

TAVGFSGIFDDPAN-LASWPTSTTCCPEKPK

31

with 4 more sequence matches

35.7%

NZ_LN850107.1:

Lanthipeptides: BN1701_RS15195_lanthipeptide

9

FDDPASAVAVFP---ICSIEDPH

28

FDDPA+ ++P C EDP

1

FDDPATLSGIWPTSTTCCPEDPK

23

24.6%

NZ_JAMTCR010000003.1:

Lanthipeptides: LV79_RS16640_lanthipeptide

1

AAAGAAGVFDDPASAVAVFP---ICSIEDPH

28

A+A A G FDDPA+ A +P C E P+

27

ASAVAFGAFDDPAAVAANWPGSTTCCPELPN

57

16.7%

NZ_KB896392.1:

Lanthipeptides: allorf_142287_142517_lanthipeptide

4

GAAGVFDDPASAVAVFPICS---IEDPH

28

GA PA AVAV C I P

11

GATRALRSPARAVAVSARCRSAVIRHPR

38

15.3%

NZ_BFCH01000018.1:

Lanthipeptides: allorf_0589559_0589789_lanthipeptide

2

AAGAAGVFDDPASAVAVFPICSIEDP

27

+ G G D PA V P+ + DP

34

SRGPRGNADAPARERRVAPVRTEHDP

59

allorf_0013521_0013739

Leader:

MCAFAGVGRVQRGCNETGEYERGSLSGQ

Core:

AAVFIERSIGEELCEDSGQPSLRCLPWPHSYRPHLFWPRRTVLA

Core with dehydrations:

AAVFIERDhaIGEELCysEDDhaGQPDhaLRCysLPWPHDhaYRPHLFWPRRDhbVLA

antiSMASH-DB 4.0 matches for allorf_0013521_0013739

100.0%

NZ_CDME01000002.1:

Lanthipeptides: allorf_0013521_0013739_lanthipeptide

1

AAVFIERSIGEELCEDSGQPSLRCLPWPHSYRPHLFWPRRTVLA

44

AAVFIERSIGEELCEDSGQPSLRCLPWPHSYRPHLFWPRRTVLA

1

AAVFIERSIGEELCEDSGQPSLRCLPWPHSYRPHLFWPRRTVLA

44

20.5%

NZ_CAKMMP010000011.1:

Lanthipeptides: allorf_219369_219518_lanthipeptide

7

RSIGEELCEDSGQPSL

22

RSI E+LCE + SL

8

RSIREDLCEQTWWVSL

23

15.9%

NZ_FYDR01000007.1:

Lanthipeptides: allorf_203600_203704_lanthipeptide

20

PSLRCLPWPHSYR

32

P +RC WPH+ R

1

PDVRCFRWPHNGR

13

with 2 more sequence matches

15.9%

NZ_WHOM01000070.1:

Lanthipeptides: GCN81_RS25150_lanthipeptide

13

LCEDSGQPSLRC

24

LC DSG L C

8

LCGDSGLSVLTC

19

11.4%

NZ_CP028826.1:

Lanthipeptides: allorf_5298276_5298380_lanthipeptide

21

SLRCLPWPHSYR

32

+RC WPH ++

2

DVRCFCWPHRWQ

13

MIBiG 4.0 matches for allorf_0013521_0013739

11.4%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

13

LCEDSGQPSLRCLP

26

+CE S + C P

9

VCEYSSLSVVLCTP

22

allorf_0021334_0021432

Leader:

MVSTHVHAARRAMCAG

Core:

WPVRRCAARRTPASRA

Core with dehydrations:

WPVRRCysAARRDhbPADhaRA

antiSMASH-DB 4.0 matches for allorf_0021334_0021432

100.0%

NZ_CDME01000002.1:

Lanthipeptides: allorf_0021334_0021432_lanthipeptide

1

WPVRRCAARRTPASRA

16

WPVRRCAARRTPASRA

1

WPVRRCAARRTPASRA

16

26.7%

NZ_LT629701.1:

Lanthipeptides: allorf_1163732_1163851_lanthipeptide

4

RRCAARRTPASRA

16

R C AR PASR+

3

RSCRARHHPASRS

15

allorf_0030628_0030822

Leader:

MVGDQNVPFS

Core:

LFGVFDGAYPQGPDWPLRGDRPLRGARLIRLRGVPARSERPRCRRGVPPKPVAP

Core with dehydrations:

LFGVFDGAYPQGPDWPLRGDRPLRGARLIRLRGVPARDhaERPRCysRRGVPPKPVAP

antiSMASH-DB 4.0 matches for allorf_0030628_0030822

100.0%

NZ_CDME01000002.1:

Lanthipeptides: allorf_0030628_0030822_lanthipeptide

1

LFGVFDGAYPQGPDWPLRGDRPLRGARLIRLRGVPARSERPRCRRGVPPKPVAP

54

LFGVFDGAYPQGPDWPLRGDRPLRGARLIRLRGVPARSERPRCRRGVPPKPVAP

1

LFGVFDGAYPQGPDWPLRGDRPLRGARLIRLRGVPARSERPRCRRGVPPKPVAP

54

20.4%

NZ_CP077652.1:

Lanthipeptides: allorf_2255880_2256005_lanthipeptide

23

LRGARLIRLRGVPARSERPRCR

44

LRGA L R P + E PR R

7

LRGATLCRSPRTPTQPEHPRSR

28

14.8%

NZ_CP070496.1:

Lanthipeptides: allorf_3787129_3787275_lanthipeptide

18

RGDRPLRGARLIRL

31

RGD P+R A +IR+

18

RGDEPIRTAPIIRV

31

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

BN1199_RS00675: T1TS

Domain 1 (9 - 315): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.89 out of 30.11

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.07 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.79 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.50 out of 32.74

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.99 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.72 out of 30.98

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

Lanthipeptides

Terpene

TFBS Finder

Core peptide predictions

BN1199_RS00660 - Class II

Cleavage pHMM score: -5.20

RODEO score: 0

Monoisotopic mass: 2677.3 Da

Molecular weight: 2678.9 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 2696.9 Da N = 1

allorf_0013521_0013739 - Class II

Cleavage pHMM score: -7.30

RODEO score: 0

Monoisotopic mass: 5044.6 Da

Molecular weight: 5047.7 Da

Number of bridges: 2

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 5065.7 Da N = 1; 5083.8 Da N = 2; 5101.8 Da N = 3

allorf_0021334_0021432 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 1833.0 Da

Molecular weight: 1834.1 Da

Number of bridges: 1

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 1852.1 Da N = 1

allorf_0030628_0030822 - Class II

Cleavage pHMM score: -4.30

RODEO score: 0

Monoisotopic mass: 6025.3 Da

Molecular weight: 6029.0 Da

Number of bridges: 1

Additional modifications: OH

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000002.1 - Region 2 - NRP-metallophore,NRPS,NRPS-like,T1PKS,betalactone,lassopeptide

Download region GenBank file

Download region SVG

Location: 58,533 - 240,506 nt. (total: 181,974 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxidoreductase oxygenase

BN1199_RS00975: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

BN1199_RS00995: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS01070: flavodoxin

smcogs: SMCOG1134: flavodoxin

BN1199_RS01100: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS01110: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS01135: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BN1199_RS01180: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS01345: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

BN1199_RS01395: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

BN1199_RS01455: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acetyltransferase acyltransferase aminotransferase methyltransferase

BN1199_RS01075: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

BN1199_RS01140: methyltransferase

smcogs: SMCOG1089: methyltransferase

BN1199_RS01300: aminotransferase

smcogs: SMCOG1019: aminotransferase

BN1199_RS01410: methyltransferase

smcogs: SMCOG1089: methyltransferase

BN1199_RS01465: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BN1199_RS52245: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: amidase esterase hydrolase

BN1199_RS00850: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

BN1199_RS00990: thioesterase

smcogs: SMCOG1004: thioesterase

BN1199_RS01130: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

BN1199_RS01230: amidase

smcogs: SMCOG1105: amidase

BN1199_RS01270: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

BN1199_RS01460: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

BN1199_RS52250: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase hydratase lyase

BN1199_RS00820: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

BN1199_RS00905: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BN1199_RS01020: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

BN1199_RS01185: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

BN1199_RS01430: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BN1199_RS01435: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

BN1199_RS01440: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

BN1199_RS00940: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

BN1199_RS00960: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS00970: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS00980: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS00985: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS01000: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS01005: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS01165: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BN1199_RS01315: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS01320: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS01325: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS01330: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS01335: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS01425: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS01445: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.83	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	1.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	1.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	1.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	1.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	1.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000307.4	1.57	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	1.57	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002053.3	0.72	ribosomal	ulleungdin	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for BN1199_RS55700

BN1199_RS55700

Leader:

MIHDDEIYEVPTLVEVGEFTELTL

Full core:

GIPFGFGCPDYMHMLTPYAC

Putative macrolactam:

antiSMASH-DB 4.0 matches for BN1199_RS55700

100.0%

NZ_CDME01000002.1:

Lassopeptides: BN1199_RS55700_lassopeptide

1

GIPFGFGCPDYMHMLTPYAC

20

GIPFGFGCPDYMHMLTPYAC

1

GIPFGFGCPDYMHMLTPYAC

20

26.1%

NC_017956.1:

Lanthipeptides: allorf_2686312_2686425_lanthipeptide

1

GIPFGFGCPDYMHMLTP

17

G G G Y+H+ +P

4

GQSRGLGSACYIHLRSP

20

13.2%

NZ_CP047945.1:

Lanthipeptides: allorf_0406889_0407083_lanthipeptide

2

IPFGFGC-----PDYMHMLT

16

+PF F C PD H +

15

LPFAFDCRLNQIPDEWHQVA

34

with 1 more sequence matches

12.5%

NZ_JACHIP010000018.1:

Lanthipeptides: allorf_31291_31476_lanthipeptide

3

PFGFGCPDYMHMLT

16

P G GC Y + T

7

PHGSGCRSYQKLST

20

MIBiG 4.0 matches for BN1199_RS55700

20.0%

BGC0000503.5 (cinA):

Lanthipeptide: cinnamycin

3

PFGFGC

8

PF F C

9

PFTFVC

14

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.77 out of 23.79

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.94 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.87 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.05 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.08 out of 26.85

Confidence: medium

Additional weak hits (32):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.36 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.89 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.59 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.50 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.46 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.81 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.19 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.29 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.11 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.87 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.61 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.42 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.22 out of 25.75

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 39.62

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.87 out of 20.01

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.76 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.50 out of 36.53

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.88 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.99 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.72 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.61 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.30 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.30 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.13 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.98 out of 36.53

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.43 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.00 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.77 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

BN1199_RS55700 - Class III: Cleavage pHMM score: 5.60; RODEO score: 20; Monoisotopic mass: 2202.9 Da; Molecular weight: 2204.6 Da; Number of bridges: 1

Predicted core structure(s)

For candidate cluster 4, location 58532 - 124894:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Thr) + (Pro) + (Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 65660 - 124894:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Thr) + (Pro) + (Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 117158 - 240506:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal) + (Leu) + (Ser) + (D-Asn) + (D-Thr - X - X - D-Fo-OH-Orn) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 117158 - 163542:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal) + (Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 126764 - 169815:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal) + (Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 157275 - 226320:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser) + (D-Asn) + (D-Thr - X - X - D-Fo-OH-Orn) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS52245: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (954..1339): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTITSAKLVLGGEVNEYGPTEATVGCSV
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS00960: X

AMP-binding (7..380): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWASFDFAFWEAHFLCGGELNQYGPTEACIDFLT
Nearest Stachelhaus code(s):: Ser DVWHLSLIDK (65% 8Å match); ohdmTyr DPWGLGLIDK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

BN1199_RS00985: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (7..390): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LETHFDFSVWEGNQIFGGEVNMYGITETTVHVTY
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS01000: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (37..434): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWCYADVASLESLLITTGDDDHFGSTEVNVVVAP
Nearest Stachelhaus code(s):: Pro DVQFIAHVVK (53% 8Å match); Leu DALLIGAVVK (35% 8Å match)
Stachelhaus code match:: 70% (weak)

BN1199_RS01005: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (450..831): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDAAGWEPFALTGGDVNHYGPTENAVVATA
Nearest Stachelhaus code(s):: Leu DAWFLGHVVK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS01165: mmal

PKS_AT (539..833): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Propionyl-CoA: 66.7%; Ethylmalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 165.4
Ethylmalonyl-CoA: 137.6
Methoxymalonyl-CoA: 127.1
2-Methylbutyryl-CoA: 109.9
Isobutyryl-CoA: 108.5
Malonyl-CoA: 100.5
Propionyl-CoA: 98.4
trans-1,2-CPDA: 87.5
Benzoyl-CoA: 85.0
Acetyl-CoA: 65.6
CHC-CoA: 65.0
3-Methylbutyryl-CoA: 55.4
fatty_acid: 31.9
inactive: 27.9

BN1199_RS01185: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (22..415): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LDNSFDASVLEPFLITGGEVNAYGPTEAACVATA
Nearest Stachelhaus code(s):: Leu DALLIGAVVK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

BN1199_RS01315: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (980..1354): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDLSFDLSVFDANCLLGGDAGLGGTTETAIHSTI
Nearest Stachelhaus code(s):: Ser DLFNLGLIHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS01320: X

AMP-binding (36..435): X

nrpys: Sal

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFPLACPGGALQVGGAQQVFGMAEGLLNYTR
Nearest Stachelhaus code(s):: Sal PLPAQGVLNK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS01325: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (476..852): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: HWSSFDFTVTPGKIVIAGEINEYGPTETTVGCLL
Nearest Stachelhaus code(s):: Asn DFTKVGEVGK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

BN1199_RS01330: Thr - X - X - Fo-OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (449..822): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFSVWEGNQIFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1872..2255): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHLFDGAFDPWDVTVGAEFNMYGPTENTVTATW
Nearest Stachelhaus code(s):: Arg DGEDHGAVTK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2887..3265): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LANSFDAAFDPWDATVGSELNMYGPTECTVDATW
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (62% 8Å match); Lys DADDAGTVDK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3909..4297): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISINELYLWCGGEYHGYGPAEATIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS01335: X

AMP-binding (424..799): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHLFDGA-FDVEAAVGAEFNVYGPTECTVDATW
Nearest Stachelhaus code(s):: Ile DGFFLGVVYK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

BN1199_RS01425: X

AMP-binding (15..430): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NFSA---TTLSSSGVLRGAVVGYGLSEASPNVAQ
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 85; Score: 81.8

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000002.1 - Region 3 - t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 275,533 - 330,367 nt. (total: 54,835 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BN1199_RS01715: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS01725: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BN1199_RS01765: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BN1199_RS01770: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase aminotransferase glycosyltransferase halogenase methyltransferase

BN1199_RS01670: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

BN1199_RS01680: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

BN1199_RS01705: methyltransferase

smcogs: SMCOG1248: methyltransferase

BN1199_RS01720: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

BN1199_RS01730: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

BN1199_RS01775: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

BN1199_RS01830: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

Hydrolases: hydrolase peptidase

BN1199_RS01710: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

BN1199_RS01865: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: decarboxylase

BN1199_RS01755: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

BN1199_RS01665: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

BN1199_RS01675: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS01750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS01785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS01810: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS53820: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002608.2	0.78	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002608.2	0.78	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.99 out of 26.85

Confidence: medium

Additional weak hits (4):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.44 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BN1199_RS01750: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (8..396): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGLYQLPATNTGAQLMYGLTECKRATIM
Nearest Stachelhaus code(s):: Asp DYYPTTMRAK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS01785: X

AMP-binding (103..367): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YYCFFDPSVFDVFSLFAGEENLYGPTELTITCTG
Nearest Stachelhaus code(s):: bMe-Asp DCFFFALITK (71% 8Å match); Ala DCFFFALITK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

BN1199_RS53820: X

AMP-binding (451..836): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTAS---FLYGLQVVVTGACRAWGSTETCMGTLS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CDME01000002.1 - Region 4 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 384,955 - 435,673 nt. (total: 50,719 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase

BN1199_RS02285: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

BN1199_RS02315: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase methyltransferase

BN1199_RS02185: Methylation

MITE: MITE0000085Methylation (identity: 62.50%)
smcogs: SMCOG1042: O-methyltransferase

BN1199_RS02305: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Isomerases: isomerase

BN1199_RS02205: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: synthase

BN1199_RS02250: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

BN1199_RS02240: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.57	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001160.5	0.54	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.54	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002518.3	0.37	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0002171.2	0.33	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.33	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002439.3	0.32	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0001850.4	0.32	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002518.3	0.50	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0002171.2	0.47	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.47	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0002439.3	0.47	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0001850.4	0.47	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (3):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.69 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.06 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.82 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 13, location 384954 - 435673:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - ohmal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS02250: fatty_acid - mal - X

CAL_domain (120..421): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 48.7
NH2: 23.2
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1105..1374): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 110.8
Methoxymalonyl-CoA: 72.2
Methylmalonyl-CoA: 61.5
inactive: 36.2
Ethylmalonyl-CoA: 27.0
Propionyl-CoA: 26.0
CHC-CoA: 14.7
fatty_acid: 13.3
trans-1,2-CPDA: 10.4
Isobutyryl-CoA: 8.9
2-Methylbutyryl-CoA: 8.7
Acetyl-CoA: 4.2
3-Methylbutyryl-CoA: 1.7
Benzoyl-CoA: 0.0

AMP-binding (2283..2665): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDASVRQASSHVGGETNLYGPTETTINATC
Nearest Stachelhaus code(s):: Gln DACSTGVINK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000002.1 - Region 5 - aminopolycarboxylic-acid

Download region GenBank file

Download region SVG

Location: 464,863 - 478,265 nt. (total: 13,403 nt) Show pHMM detection rules used

aminopolycarboxylic-acid: (AesA and AesB and AesC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deaminase

BN1199_RS02505: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase

BN1199_RS02500: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

BN1199_RS02495: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.64	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.57	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.47	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0001294.5	0.41	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000883.5	0.33	other (other)	arginomycin	Streptomyces arginensis
BGC0002095.3	0.28	NRPS	leupeptin Pr, leupeptin Ac	Streptomyces roseus
BGC0000333.5	0.27	NRPS	cyclomarin D	Salinispora arenicola CNS-205
BGC0001457.4	0.27	NRPS	jomthonic acid A, jomthonic acid B, jomthonic acid C	Streptomyces caniferus
BGC0002545.3	0.26	PKS	sungeidine C, sungeidine B, sungeidine D, sungeidine H, sungeidine A, sungeidine E, sungeidine F, sungeidine G	Micromonospora sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.64	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.57	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.47	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0001294.5	0.41	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000883.5	0.33	other (other)	arginomycin	Streptomyces arginensis
BGC0002095.3	0.28	NRPS	leupeptin Pr, leupeptin Ac	Streptomyces roseus
BGC0000333.5	0.27	NRPS	cyclomarin D	Salinispora arenicola CNS-205
BGC0001457.4	0.27	NRPS	jomthonic acid A, jomthonic acid B, jomthonic acid C	Streptomyces caniferus
BGC0002545.3	0.26	PKS	sungeidine C, sungeidine B, sungeidine D, sungeidine H, sungeidine A, sungeidine E, sungeidine F, sungeidine G	Micromonospora sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.90 out of 23.79

Confidence: medium

Additional weak hits (4):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.88 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.87 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.70 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_CDME01000002.1 - Region 6 - NRPS,betalactone

Download region GenBank file

Download region SVG

Location: 521,271 - 567,246 nt. (total: 45,976 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BN1199_RS02830: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase methyltransferase

BN1199_RS02790: aminotransferase

smcogs: SMCOG1019: aminotransferase

BN1199_RS02795: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BN1199_RS02800: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

BN1199_RS02825: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

BN1199_RS02735: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

BN1199_RS02770: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

BN1199_RS02810: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.70	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.65	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.99 out of 29.51

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (11):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.66 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.16 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.72 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.98 out of 27.78

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.91 out of 32.74

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.93 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.49 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.03 out of 30.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 521270 - 567246:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS02810: X - X

AMP-binding (7..397): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAADPSAFETRLISGGDVNGYGPTEATVLALV
Nearest Stachelhaus code(s):: Lys or Arg DPEDIGGVEK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1045..1431): X

nrpys: Phe, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VGHAFDMALYEMVSITGGELNCYGPTEVTVCTTS
Nearest Stachelhaus code(s):: Trp DVSSIGCVCK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000002.1 - Region 7 - NRPS

Download region GenBank file

Download region SVG

Location: 595,253 - 688,138 nt. (total: 92,886 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BN1199_RS03185: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BN1199_RS03290: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

BN1199_RS03300: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase methyltransferase

BN1199_RS03200: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

BN1199_RS03245: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase peptidase

BN1199_RS03160: thioesterase

smcogs: SMCOG1004: thioesterase

BN1199_RS03190: thioesterase

smcogs: SMCOG1004: thioesterase

BN1199_RS03295: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: lyase

BN1199_RS03215: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

BN1199_RS03140: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS03165: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS03175: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS03210: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS03225: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

BN1199_RS03235: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS03250: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS03255: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

BN1199_RS03310: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001128.4	0.78	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.77	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.76	NRPS	enniatin	Fusarium equiseti
BGC0001249.5	0.76	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001128.4	0.78	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.78	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.77	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.77	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.76	NRPS	enniatin	Fusarium equiseti
BGC0001249.5	0.76	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002075.3	0.75	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (15):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.92 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.33 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.97 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.39 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.70 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.55 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.94 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.88 out of 27.04

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.31 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.70 out of 32.74

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.57 out of 32.93

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.79 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.07 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 595252 - 688138:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (fatty_acid - Ala) + (D-X) + (X) + (Pro) + (NMe-Ser) + (Ala - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS03140: X

AMP-binding (517..926): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TGMSYDMSVYEGSSGLGGDHNLAGMTEVSYCTMA
Nearest Stachelhaus code(s):: Pro DMYFAGLICK (38% 8Å match)
Stachelhaus code match:: 70% (weak)

BN1199_RS03165: fatty_acid - Ala

Search NORINE for peptide: strict or relaxed

CAL_domain (34..455): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 37.8
NH2: 33.9
AHBA: 10.7
Acetyl-CoA: 4.8
shikimic_acid: 0.0

AMP-binding (1077..1478): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWRTFDVSVLEWCFHLLGEHNTYGPAETAIEVTH
Nearest Stachelhaus code(s):: Dab DVCETGTIEK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

BN1199_RS03175: X

AMP-binding (468..872): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAVSFDVVLEEPDLVVGGDVEVYGLTEATVTSTT
Nearest Stachelhaus code(s):: Arg DVENVGAVTK (62% 8Å match); Ahp DVENAGVVTK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

BN1199_RS03190: X

AMP-binding (234..634): X

nrpys: Dpr, dnmeProp, Dab

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQVQLSATGEVNAYGATEASDDTTH
Nearest Stachelhaus code(s):: Dpr DIWQSTADDK (82% 8Å match); dnmeProp or Dab DIWQSTADDK (82% 8Å match); Asp DIWQSTADDK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS03210: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (15..417): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHSFDVVMHEGFLIQSGEHNHYGSAEMQDVTTW
Nearest Stachelhaus code(s):: Gua DFHFITHDAK (62% 8Å match); Pro DVQFIAHVVK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

BN1199_RS03235: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (490..888): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWATFDVAVWELHFISSGEHNLYGPAEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS03250: Ala - X

Search NORINE for peptide: strict or relaxed

AMP-binding (467..864): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFESSAVLAGEINAYGPTEASVYSTV
Nearest Stachelhaus code(s):: Ala DVFSVAAVYK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1517..1911): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YALAYDSSFREALAATAGEINMYGPTECTMTSTY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator

NZ_CDME01000002.1 - Region 8 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 695,182 - 807,860 nt. (total: 112,679 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

BN1199_RS03440: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BN1199_RS03465: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

BN1199_RS03490: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BN1199_RS03520: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS03525: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

BN1199_RS03620: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acylase methyltransferase

BN1199_RS03450: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BN1199_RS03505: methyltransferase

smcogs: SMCOG1089: methyltransferase

BN1199_RS52340: methyltransferase

smcogs: SMCOG1089: methyltransferase

BN1199_RS52345: methyltransferase

smcogs: SMCOG1089: methyltransferase

BN1199_RS52350: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

BN1199_RS03615: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

BN1199_RS54200: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase synthetase

BN1199_RS03445: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS03500: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BN1199_RS03535: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS03550: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

BN1199_RS03580: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BN1199_RS03590: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

BN1199_RS57870: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS57875: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002554.2	0.56	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0001903.3	0.49	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0001896.4	0.49	other (other)	carbazomycin B	Streptomyces luteoverticillatus
BGC0002162.3	0.48	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.47	terpene	stellatic acid	Aspergillus stellatus
BGC0001201.3	0.46	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001273.3	0.43	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.43	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.42	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001065.5	0.39	PKS	herboxidiene	Streptomyces chromofuscus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.64	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Terpene cluster 1 (699,222 - 719,966):

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Terpene cluster 2 (760,948 - 807,860):

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

BN1199_RS03500: PT_FPPS_like

Domain 1 (54 - 321): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BN1199_RS03510: PT_phytoene_like

Domain 1 (16 - 292): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

BN1199_RS03580: PT_FPPS_like

Domain 1 (57 - 350): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BN1199_RS03615: T1TS

Domain 1 (6 - 314): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.47 out of 26.85

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.03 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 25.31

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (20):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.50 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.99 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.08 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.13 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.13 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.47 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.56 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.45 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.51 out of 31.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.62 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.75 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.69 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.00 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.83 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.30 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 17, location 695181 - 807860:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-mal - pk) + (Me-ccmal - Me-ccmal) + (pk - ohmal - pk) + (Me-redmal - pk - mal)
Non-colinear ordering:: BN1199_RS03445 + BN1199_RS03450 + BN1199_RS57870 + BN1199_RS57875

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 18, location 695181 - 783182:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-mal - pk) + (Me-ccmal - Me-ccmal) + (pk - ohmal - pk) + (Me-redmal - pk - mal)
Non-colinear ordering:: BN1199_RS03445 + BN1199_RS03450 + BN1199_RS57870 + BN1199_RS57875

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS03445: mmal - mmal - pk

PKS_AT (519..802): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 199.6
Ethylmalonyl-CoA: 190.4
Methoxymalonyl-CoA: 162.8
2-Methylbutyryl-CoA: 142.0
trans-1,2-CPDA: 135.3
Propionyl-CoA: 116.9
CHC-CoA: 103.9
Malonyl-CoA: 83.6
Isobutyryl-CoA: 79.6
Benzoyl-CoA: 66.7
3-Methylbutyryl-CoA: 39.0
inactive: 38.4
Acetyl-CoA: 33.8
fatty_acid: 24.3

PKS_AT (1459..1725): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 217.6
Ethylmalonyl-CoA: 213.6
Methoxymalonyl-CoA: 178.6
2-Methylbutyryl-CoA: 160.5
trans-1,2-CPDA: 137.2
CHC-CoA: 126.3
Propionyl-CoA: 125.6
Malonyl-CoA: 106.7
Isobutyryl-CoA: 90.7
Benzoyl-CoA: 83.3
Acetyl-CoA: 53.2
fatty_acid: 42.9
3-Methylbutyryl-CoA: 37.4
inactive: 31.9

PKS_AT (2427..2697): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 214.5
Methylmalonyl-CoA: 213.9
Methoxymalonyl-CoA: 169.9
2-Methylbutyryl-CoA: 163.1
trans-1,2-CPDA: 119.5
Propionyl-CoA: 115.4
CHC-CoA: 102.2
Malonyl-CoA: 95.0
Isobutyryl-CoA: 78.1
Benzoyl-CoA: 74.2
Acetyl-CoA: 39.0
3-Methylbutyryl-CoA: 37.4
fatty_acid: 37.2
inactive: 26.0

BN1199_RS03450: mmal

PKS_AT (556..840): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 217.2
Ethylmalonyl-CoA: 216.2
Methoxymalonyl-CoA: 177.2
2-Methylbutyryl-CoA: 152.0
trans-1,2-CPDA: 128.8
CHC-CoA: 126.5
Propionyl-CoA: 117.5
Malonyl-CoA: 98.1
Isobutyryl-CoA: 79.9
Benzoyl-CoA: 68.4
Acetyl-CoA: 44.4
fatty_acid: 37.6
3-Methylbutyryl-CoA: 33.1
inactive: 20.0

BN1199_RS57870: mmal - pk - mal - pk

PKS_AT (0..259): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 199.5
Ethylmalonyl-CoA: 198.3
Methoxymalonyl-CoA: 162.6
2-Methylbutyryl-CoA: 137.7
trans-1,2-CPDA: 121.5
CHC-CoA: 100.2
Propionyl-CoA: 97.6
Malonyl-CoA: 89.6
Benzoyl-CoA: 66.6
Isobutyryl-CoA: 65.7
Acetyl-CoA: 40.2
fatty_acid: 37.2
3-Methylbutyryl-CoA: 27.6
inactive: 25.9

PKS_AT (1633..1917): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 217.6
Methylmalonyl-CoA: 214.8
Methoxymalonyl-CoA: 171.1
2-Methylbutyryl-CoA: 160.7
trans-1,2-CPDA: 138.5
Propionyl-CoA: 126.2
Malonyl-CoA: 108.3
CHC-CoA: 108.2
Benzoyl-CoA: 86.9
Isobutyryl-CoA: 85.5
Acetyl-CoA: 58.9
fatty_acid: 46.3
inactive: 30.2
3-Methylbutyryl-CoA: 15.3

PKS_AT (2983..3272): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.8
inactive: 115.2
Methoxymalonyl-CoA: 80.8
Methylmalonyl-CoA: 69.7
Propionyl-CoA: 46.9
Benzoyl-CoA: 31.0
Isobutyryl-CoA: 29.5
Acetyl-CoA: 26.8
Ethylmalonyl-CoA: 23.3
2-Methylbutyryl-CoA: 22.5
CHC-CoA: 18.5
trans-1,2-CPDA: 16.8
fatty_acid: 15.1
3-Methylbutyryl-CoA: 0.0

PKS_AT (4388..4671): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 233.1
Methylmalonyl-CoA: 227.0
Methoxymalonyl-CoA: 184.4
2-Methylbutyryl-CoA: 157.2
trans-1,2-CPDA: 142.0
CHC-CoA: 119.2
Propionyl-CoA: 113.8
Malonyl-CoA: 108.0
Isobutyryl-CoA: 88.5
Benzoyl-CoA: 75.0
Acetyl-CoA: 54.3
3-Methylbutyryl-CoA: 34.4
inactive: 32.3
fatty_acid: 29.0

BN1199_RS57875: mmal - pk - mal

PKS_AT (556..837): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.8
Ethylmalonyl-CoA: 191.3
Methoxymalonyl-CoA: 168.6
2-Methylbutyryl-CoA: 139.2
trans-1,2-CPDA: 128.9
Propionyl-CoA: 111.5
CHC-CoA: 110.8
Malonyl-CoA: 109.3
Isobutyryl-CoA: 93.7
Benzoyl-CoA: 82.9
Acetyl-CoA: 66.8
3-Methylbutyryl-CoA: 62.8
fatty_acid: 38.6
inactive: 38.3

PKS_AT (2498..2796): pk

ATSignature: Methoxymalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 79.2%; Methylmalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 172.2
Ethylmalonyl-CoA: 166.6
Methoxymalonyl-CoA: 141.9
2-Methylbutyryl-CoA: 104.5
trans-1,2-CPDA: 92.4
Propionyl-CoA: 91.2
Malonyl-CoA: 89.6
CHC-CoA: 79.2
Isobutyryl-CoA: 71.4
Benzoyl-CoA: 48.5
fatty_acid: 40.7
inactive: 39.6
3-Methylbutyryl-CoA: 37.1
Acetyl-CoA: 31.1

PKS_AT (3498..3784): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 197.8
inactive: 93.9
Methoxymalonyl-CoA: 65.2
Methylmalonyl-CoA: 56.0
Isobutyryl-CoA: 34.6
Acetyl-CoA: 31.2
Propionyl-CoA: 28.5
Ethylmalonyl-CoA: 26.1
Benzoyl-CoA: 19.9
2-Methylbutyryl-CoA: 17.1
trans-1,2-CPDA: 13.8
fatty_acid: 11.8
CHC-CoA: 6.6
3-Methylbutyryl-CoA: 0.0

BN1199_RS03535: X

AMP-binding (38..432): X

nrpys: Phe, Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAVLHNGMHFTASVVSAAAMQGYGLTETTNFSAT
Nearest Stachelhaus code(s):: Sma GLTSVAGNFK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000002.1 - Region 9 - terpene

Download region GenBank file

Download region SVG

Location: 828,997 - 858,980 nt. (total: 29,984 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

BN1199_RS55825: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: kinase

BN1199_RS03810: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Lyases: cyclase dehydratase

BN1199_RS03820: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

BN1199_RS03830: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase synthetase

BN1199_RS03865: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BN1199_RS03875: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.58	terpene	astallatene	Arabidopsis thaliana
BGC0002283.2	0.53	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.53	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.45	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000663.5	0.44	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002591.2	0.43	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0001910.4	0.43	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.58	terpene	astallatene	Arabidopsis thaliana
BGC0002283.2	0.53	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.53	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0000677.5	0.47	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002309.2	0.45	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000663.5	0.44	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002591.2	0.43	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0001910.4	0.43	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001911.3	0.43	terpene	raimonol	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BN1199_RS03830: T1TS

Domain 1 (29 - 332): Type 1 terpene synthase

Subtype: unknown

BN1199_RS03865: PT_FPPS_like

Domain 1 (48 - 337): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (10):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.71 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.56 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.29 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.78 out of 21.55

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.61 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.83 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.54 out of 36.53

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000002.1 - Region 10 - terpene

Download region GenBank file

Download region SVG

Location: 1,369,756 - 1,390,856 nt. (total: 21,101 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BN1199_RS06270: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

BN1199_RS06305: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BN1199_RS06330: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

BN1199_RS06290: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: cyclase

BN1199_RS06285: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.78	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.68	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0002387.2	0.42	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000902.4	0.41	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001484.3	0.41	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001210.5	0.39	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000285.5	0.39	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.78	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000657.5	0.68	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000659.3	0.62	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0002387.2	0.42	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000902.4	0.41	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0001484.3	0.41	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0000519.4	0.41	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001210.5	0.39	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000285.5	0.39	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

BN1199_RS06285: T1TS

Domain 1 (3 - 351): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 27.13 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 30.11

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.55 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.43 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.73 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.54 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.29 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.04 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism

NZ_CDME01000002.1 - Region 11 - T1PKS,T2PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 1,406,687 - 1,531,072 nt. (total: 124,386 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

BN1199_RS06540: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BN1199_RS06560: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS06565: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BN1199_RS06590: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BN1199_RS06610: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS06640: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BN1199_RS06645: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BN1199_RS06730: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BN1199_RS06735: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BN1199_RS06835: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS06840: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

BN1199_RS57145: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BN1199_RS57150: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase methyltransferase transferase

BN1199_RS06630: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BN1199_RS06690: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BN1199_RS06705: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

BN1199_RS06740: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

BN1199_RS06795: methyltransferase

smcogs: SMCOG1089: methyltransferase

BN1199_RS06900: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase esterase

BN1199_RS06885: putative esterase

smcogs: SMCOG1104: putative esterase

BN1199_RS06910: putative esterase

smcogs: SMCOG1104: putative esterase

BN1199_RS06975: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: cyclase decarboxylase hydratase

BN1199_RS06615: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

BN1199_RS06695: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

BN1199_RS06720: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

BN1199_RS06865: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase synthase

BN1199_RS06595: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS06600: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BN1199_RS06715: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS06750: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS06890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS06905: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport transporter

BN1199_RS06820: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

BN1199_RS06920: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000202.5	1.28	PKS	azicemicin B	Kibdelosporangium sp. MJ126-NF4
BGC0000231.5	0.87	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001284.4	0.85	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000234.5	0.66	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.55	PKS	oviedomycin	Streptomyces antibioticus
BGC0001197.5	0.54	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002276.2	0.53	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001251.4	0.52	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.52	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.52	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000202.5	0.98	PKS	azicemicin B	Kibdelosporangium sp. MJ126-NF4
BGC0000231.5	0.83	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000234.5	0.71	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001160.5	0.68	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001161.5	0.66	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001162.3	0.66	PKS	1-heptadecene	Moorea producens JHB

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.62 out of 27.04

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.56 out of 23.43

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.34 out of 30.25

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.71 out of 36.53

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.06 out of 23.79

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.86 out of 28.19

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.02 out of 27.04

Confidence: medium

Additional weak hits (35):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.90 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.21 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.85 out of 26.06

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.22 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.97 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.62 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.88 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.47 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.84 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.30 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.95 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.01 out of 30.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.02 out of 20.97

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.03 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.35 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.07 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.72 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.29 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.96 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.05 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.64 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.84 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.21 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.04 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.60 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.91 out of 23.43

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.18 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 23, location 1406686 - 1531072:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 26, location 1484532 - 1531072:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS06690: mal

PKS_AT (8..295): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 66.7%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 90.7
Methylmalonyl-CoA: 44.3
Methoxymalonyl-CoA: 41.1
Propionyl-CoA: 33.0
inactive: 16.2
Ethylmalonyl-CoA: 16.1
Acetyl-CoA: 15.4
CHC-CoA: 11.8
Isobutyryl-CoA: 11.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BN1199_RS06715: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (8..400): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGMYQLPATNTGAQLMFGLTECKRATIA
Nearest Stachelhaus code(s):: Asp DYYPTTMRAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS06750: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (8..397): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: YHVFFDPSVYDTNSMFCGEENIYGPTEMTVTCTE
Nearest Stachelhaus code(s):: Cys DPYNMCIVTK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS06890: X

AMP-binding (18..384): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VEFANAPFMMSAFLLHGAAYELYASTEAQAGCLI
Nearest Stachelhaus code(s):: 4-ohPpa IAAFLGAAGK (24% 8Å match)
Stachelhaus code match:: 60% (weak)

BN1199_RS06900: mmal

PKS_AT (634..926): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 131.1
Ethylmalonyl-CoA: 105.0
Methoxymalonyl-CoA: 99.7
Malonyl-CoA: 80.9
Propionyl-CoA: 74.6
2-Methylbutyryl-CoA: 68.2
trans-1,2-CPDA: 68.0
Isobutyryl-CoA: 63.9
CHC-CoA: 46.9
fatty_acid: 37.6
Acetyl-CoA: 35.8
Benzoyl-CoA: 32.8
3-Methylbutyryl-CoA: 17.8
inactive: 16.5

BN1199_RS06905: NH2

CAL_domain (46..487): NH2

minowa: NH2

Prediction, score:

NH2: 115.9
Acetyl-CoA: 27.6
fatty_acid: 24.8
AHBA: 13.1
shikimic_acid: 0.0

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 1406686 to 1479163
Starter unit(s):: aziridinyl-CoA (Score: 984.0; E-value: 0)
acetyl-CoA (Score: 73.2; E-value: 3.05e-101)
propionyl-CoA (Score: 73.2; E-value: 3.05e-101)
isobutyryl-CoA (Score: 73.2; E-value: 3.05e-101)
butyryl-CoA (Score: 73.2; E-value: 3.05e-101)
Malonyl elongations:: 8|9 (Score: 698.5; E-value: 5.1e-213)
Product class(es):: angucycline
Product molecular weight(s):: acetyl-CoA_8: 414 Da
acetyl-CoA_9: 456 Da
aziridinyl-CoA_8: 458 Da
aziridinyl-CoA_9: 500 Da
butyryl-CoA_8: 442 Da
butyryl-CoA_9: 484 Da
isobutyryl-CoA_8: 442 Da
isobutyryl-CoA_9: 484 Da
propionyl-CoA_8: 428 Da
propionyl-CoA_9: 470 Da

BN1199_RS06565: OXY (Score: 572.3; E-value: 2.1e-174)
BN1199_RS06590: OXY (Score: 591.8; E-value: 2.5e-180)
BN1199_RS06595: KS (Score: 748.6; E-value: 4e-228)
BN1199_RS06600: CLF 8|9 (Score: 698.5; E-value: 5.1e-213)
BN1199_RS06605: ACP (Score: 131.7; E-value: 1.6e-41)
BN1199_RS06610: KR C9 (Score: 471.8; E-value: 1.2e-144)
BN1199_RS06615: CYC C7-C12 (Score: 491.7; E-value: 1.5e-150)
BN1199_RS06645: OXY (Score: 126.4; E-value: 3.6e-39)
BN1199_RS06690: AT (Score: 368.9; E-value: 5.3e-113); AT AAG30190.1_R1128_acetyl-CoA/propionyl-CoA/isobutyryl-CoA/butyryl-CoA (Score: 293.0; E-value: 3.05e-101)
BN1199_RS06695: CYC C4-C17/C2-C19 (Score: 161.4; E-value: 5e-50)
BN1199_RS06705: MET (Score: 271.3; E-value: 2.7e-83)
BN1199_RS06715: AT (Score: 294.3; E-value: 2.6e-90); AT ADB02855.1_Azicemicin_aziridinyl-CoA (Score: 984.0; E-value: 0.0)
BN1199_RS57145: OXY (Score: 552.2; E-value: 2.6e-168)
BN1199_RS57150: KR C15 (Score: 380.0; E-value: 1.1e-116)

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CatR	H2O2-responsive repressor
ColR	Phenol-responsive regulator
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
ZuR variant 1	Zinc-responsive repressor

NZ_CDME01000002.1 - Region 12 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1,610,853 - 1,679,428 nt. (total: 68,576 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

BN1199_RS07310: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

BN1199_RS07325: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BN1199_RS07395: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BN1199_RS07415: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BN1199_RS07435: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BN1199_RS07440: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS07445: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BN1199_RS07450: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BN1199_RS07460: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

BN1199_RS07465: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: aminotransferase carbamoyltransferase methyltransferase

BN1199_RS07260: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

BN1199_RS07290: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

BN1199_RS07365: methyltransferase

smcogs: SMCOG1089: methyltransferase

BN1199_RS07400: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BN1199_RS52480: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase synthase

BN1199_RS07335: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS07425: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS07430: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

BN1199_RS07470: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.37	PKS	esperamicin	Actinomadura verrucosospora
BGC0001135.5	0.34	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.33	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.33	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000855.3	0.32	other (other)	ectoine	Methylomicrobium kenyense
BGC0002286.3	0.32	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.32	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.32	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.31	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.31	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000056.3	0.69	PKS	esperamicin	Actinomadura verrucosospora
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.64 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.20 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.33 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.88 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.90 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 27, location 1610852 - 1679428:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 29, location 1637670 - 1679428:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS07335: mal

PKS_AT (620..847): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 69.1
Methylmalonyl-CoA: 42.4
Methoxymalonyl-CoA: 36.9
inactive: 30.9
Propionyl-CoA: 23.1
Ethylmalonyl-CoA: 19.5
trans-1,2-CPDA: 17.9
Isobutyryl-CoA: 16.7
fatty_acid: 14.7
2-Methylbutyryl-CoA: 10.2
CHC-CoA: 9.3
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BN1199_RS07425: X

AMP-binding (9..404): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MDSAFSVSVYEVHLLTGGDRSMYGATELSVFVTT
Nearest Stachelhaus code(s):: ohMan NVYHLGMVFK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_CDME01000002.1 - Region 13 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1,841,450 - 1,895,847 nt. (total: 54,398 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BN1199_RS08335: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BN1199_RS08340: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS08360: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BN1199_RS08370: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS08385: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS08400: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS08410: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS08420: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BN1199_RS08430: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: esterase

BN1199_RS08365: thioesterase

smcogs: SMCOG1004: thioesterase

BN1199_RS08405: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

BN1199_RS08375: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS08380: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS08390: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BN1199_RS08415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.16	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	1.14	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	1.12	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	1.10	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	1.10	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	1.06	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	1.06	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	1.05	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	1.04	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	1.04	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (15):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.32 out of 25.88

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.91 out of 32.93

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.47 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.29 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.67 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.77 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.79 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.55 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.14 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.21 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.59 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.99 out of 35.63

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.89 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 30, location 1841449 - 1895847:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 31, location 1841449 - 1884812:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 32, location 1845920 - 1889382:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 33, location 1853414 - 1895847:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Val) + (mal) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS08380: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (547..938): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDASFDASTLEGWLISGGDSNGYGPTENTTFTAT
Nearest Stachelhaus code(s):: Val DALWIGGTFK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS08390: mal

PKS_AT (506..781): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.0
Methoxymalonyl-CoA: 27.2
inactive: 19.8
Methylmalonyl-CoA: 18.3
Propionyl-CoA: 10.5
Isobutyryl-CoA: 8.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

BN1199_RS08415: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (240..629): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGSQVFGGEVNMFGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000002.1 - Region 14 - NRPS-like

Download region GenBank file

Download region SVG

Location: 1,925,240 - 1,967,618 nt. (total: 42,379 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BN1199_RS08650: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BN1199_RS08780: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS08800: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase methyltransferase

BN1199_RS08775: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

BN1199_RS52540: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: ligase

BN1199_RS08710: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

BN1199_RS08680: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002476.2	0.51	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0002115.3	0.46	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001336.5	0.45	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002347.3	0.44	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001075.5	0.44	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001870.3	0.44	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001485.4	0.44	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002476.2	0.51	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0002115.3	0.46	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001336.5	0.45	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0002347.3	0.44	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0001075.5	0.44	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001870.3	0.44	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001485.4	0.44	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (15):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.72 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.66 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.33 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.17 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.45 out of 30.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.59 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.31 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.44 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.25 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.57 out of 36.53

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.59 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.56 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 34, location 1925239 - 1967618:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS08710: X

AMP-binding (98..341): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NSILYGLSV--SHGTQAGGFVMYGQTEATARMAY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_CDME01000002.1 - Region 15 - RiPP-like

Download region GenBank file

Download region SVG

Location: 2,086,103 - 2,096,897 nt. (total: 10,795 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

BN1199_RS09430: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.31	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.29	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000633.3	0.28	terpene	carotenoid	Streptomyces avermitilis
BGC0000842.5	0.26	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000219.4	0.21	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0001435.4	0.20	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000595.3	0.31	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000597.4	0.29	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000633.3	0.28	terpene	carotenoid	Streptomyces avermitilis
BGC0000842.5	0.26	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000219.4	0.21	PKS, saccharide	elloramycin	Streptomyces olivaceus
BGC0001435.4	0.20	NRPS, PKS	ikarugamycin	Streptomyces sp. ZJ306

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.45 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.37 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.56 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CDME01000002.1 - Region 16 - T3PKS,arylpolyene

Download region GenBank file

Download region SVG

Location: 2,160,120 - 2,205,776 nt. (total: 45,657 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

BN1199_RS09780: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS09800: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

BN1199_RS09910: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: kinase

BN1199_RS09755: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Lyases: dehydratase hydratase

BN1199_RS09830: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BN1199_RS09835: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

BN1199_RS09905: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: racemase

BN1199_RS57190: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase

BN1199_RS09810: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

BN1199_RS09825: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

BN1199_RS09840: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS09845: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

BN1199_RS09895: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.54	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001258.3	0.47	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000041.3	0.47	PKS	oronofacic acid	Pseudomonas syringae
BGC0000107.3	0.47	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.47	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001160.5	0.46	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.46	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.46	PKS	FR901512	fungal sp. No.14919
BGC0001310.5	0.43	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001896.4	0.43	other (other)	carbazomycin B	Streptomyces luteoverticillatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001258.3	0.57	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000041.3	0.57	PKS	oronofacic acid	Pseudomonas syringae
BGC0000107.3	0.57	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.57	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0001310.5	0.54	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001896.4	0.54	other (other)	carbazomycin B	Streptomyces luteoverticillatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (15):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.10 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.21 out of 20.01

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.53 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.72 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.70 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.04 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.45 out of 36.54

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.10 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.30 out of 26.85

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.17 out of 29.65

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.30 out of 30.11

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.96 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000002.1 - Region 17 - T1PKS

Download region GenBank file

Download region SVG

Location: 2,250,462 - 2,296,995 nt. (total: 46,534 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BN1199_RS10170: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS10235: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

BN1199_RS10245: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Hydrolases: esterase

BN1199_RS10215: putative esterase

smcogs: SMCOG1104: putative esterase

Ligases: ligase synthase

BN1199_RS10210: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS10220: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.13 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.34 out of 20.97

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.81 out of 27.55

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.73 out of 29.65

Confidence: medium

Additional weak hits (14):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.78 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.18 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.85 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.60 out of 30.22

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.89 out of 32.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.41 out of 27.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.35 out of 26.85

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.96 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.61 out of 29.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.34 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.88 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.81 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.29 out of 25.88

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.92 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 39, location 2250461 - 2296995:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS10210: mmal

PKS_AT (620..921): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%; Ethylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 102.7
Ethylmalonyl-CoA: 85.7
Methoxymalonyl-CoA: 81.6
Malonyl-CoA: 69.9
trans-1,2-CPDA: 68.2
Propionyl-CoA: 56.5
2-Methylbutyryl-CoA: 54.6
CHC-CoA: 54.3
fatty_acid: 52.3
Isobutyryl-CoA: 46.0
Acetyl-CoA: 41.1
3-Methylbutyryl-CoA: 29.5
Benzoyl-CoA: 22.6
inactive: 15.3

BN1199_RS10220: NH2

CAL_domain (47..503): NH2

minowa: NH2

Prediction, score:

NH2: 77.2
fatty_acid: 26.7
Acetyl-CoA: 19.3
AHBA: 9.3
shikimic_acid: 7.2

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
GnfM	Regulator of nitrogen-fixation genes
LexA variant 1	Repressor of DNA damage response
MexT	Global virulence regulator

NZ_CDME01000002.1 - Region 18 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 2,308,368 - 2,329,288 nt. (total: 20,921 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: halogenase

BN1199_RS10395: halogenase

smcogs: SMCOG1119: halogenase

Ligases: synthetase

BN1199_RS10390: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002245.2	0.41	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000557.5	0.35	ribosomal	streptococcin A-FF22	Streptococcus pyogenes
BGC0000664.5	0.34	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001260.3	0.34	terpene	terpendole E	Tolypocladium album
BGC0000550.3	0.34	ribosomal	salivaricin G32	Streptococcus salivarius
BGC0000527.5	0.34	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001082.4	0.34	terpene	Paxilline, 21,22-diprenylated paxilline	Penicillium paxilli
BGC0000547.5	0.34	ribosomal	salivaricin 9	Streptococcus salivarius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002245.2	0.41	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0002219.2	0.39	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000557.5	0.35	ribosomal	streptococcin A-FF22	Streptococcus pyogenes
BGC0000664.5	0.34	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001260.3	0.34	terpene	terpendole E	Tolypocladium album
BGC0000550.3	0.34	ribosomal	salivaricin G32	Streptococcus salivarius
BGC0000527.5	0.34	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001082.4	0.34	terpene	Paxilline, 21,22-diprenylated paxilline	Penicillium paxilli
BGC0000547.5	0.34	ribosomal	salivaricin 9	Streptococcus salivarius

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BN1199_RS10390: PT_FPPS_like

Domain 1 (20 - 300): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.35 out of 23.79

Confidence: medium

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000002.1 - Region 19 - terpene

Download region GenBank file

Download region SVG

Location: 2,385,285 - 2,404,273 nt. (total: 18,989 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BN1199_RS10695: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

BN1199_RS10725: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Ligases: synthetase

BN1199_RS10720: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.55	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.50	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.48	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.55	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.55	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.52	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.52	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000649.3	0.50	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000644.3	0.48	terpene	carotenoid	Dietzia sp. CQ4
BGC0000648.3	0.48	terpene	carotenoid	Myxococcus xanthus
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.45	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

BN1199_RS10720: PT_FPPS_like

Domain 1 (49 - 336): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

BN1199_RS10740: PT_phytoene_like

Domain 1 (16 - 289): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.71 out of 30.22

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 24.24 out of 29.65

Confidence: medium

Additional weak hits (5):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.75 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.85 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.48 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.94 out of 19.26

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.72 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
LexA variant 1	Repressor of DNA damage response

NZ_CDME01000004.1 - Region 1 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 119,877 - 132,472 nt. (total: 12,596 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

BN1199_RS12760: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

BN1199_RS12770: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001386.5	0.28	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0002671.2	0.20	PKS	kendomycin B	Verrucosispora sp.
BGC0000967.5	0.20	NRPS, PKS	calyculin A, phosphocalyculin A, calyculinamide A, dephosphonocalyculin A	uncultured Candidatus Entotheonella sp.
BGC0002101.3	0.19	PKS	heronamide C, heronamide A, heronamide B	Streptomyces sp. CMB-0406 CBM-0406

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001386.5	0.28	PKS	JBIR-76, JBIR-77	Streptomyces sp. RI-77
BGC0002671.2	0.20	PKS	kendomycin B	Verrucosispora sp.
BGC0000967.5	0.20	NRPS, PKS	calyculin A, phosphocalyculin A, calyculinamide A, dephosphonocalyculin A	uncultured Candidatus Entotheonella sp.
BGC0002101.3	0.19	PKS	heronamide C, heronamide A, heronamide B	Streptomyces sp. CMB-0406 CBM-0406

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 21.40 out of 23.05

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.40 out of 27.55

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.40 out of 27.55

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.23 out of 27.55

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.74 out of 29.72

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
GnfM	Regulator of nitrogen-fixation genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000006.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 587,627 - 610,206 nt. (total: 22,580 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

BN1199_RS17070: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BN1199_RS17120: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acetyltransferase aminotransferase

BN1199_RS17115: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

BN1199_RS17125: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.53	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.52	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.52	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.52	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000513.3	0.51	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000518.3	0.45	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002701.2	0.44	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.53	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.52	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.52	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.52	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000513.3	0.51	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000518.3	0.45	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002701.2	0.44	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.09 out of 26.85

Confidence: medium

Additional weak hits (6):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.56 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.96 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.09 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CDME01000006.1 - Region 2 - melanin

Download region GenBank file

Download region SVG

Location: 735,903 - 746,208 nt. (total: 10,306 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

BN1199_RS17715: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.78	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.59	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000908.3	0.54	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.41	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.41	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001592.5	0.40	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.39	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000521.3	0.39	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.78	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.59	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000908.3	0.54	other (other)	melanin	Streptomyces avermitilis
BGC0000909.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0000662.5	0.41	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000885.3	0.41	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001592.5	0.40	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.39	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000521.3	0.39	ribosomal	lacticin 481	Lactococcus lactis subsp. lactis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

Additional weak hits (3):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.44 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.02 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.62 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_CDME01000007.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 52,985 nt. (total: 52,985 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase aminotransferase

BN1199_RS17930: aminotransferase

smcogs: SMCOG1019: aminotransferase

BN1199_RS17965: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BN1199_RS17985: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

BN1199_RS17970: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

BN1199_RS17950: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS17960: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.93	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.90	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.89	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.85	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.84	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.83	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.83	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.82	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.82	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.80	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.77	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.75	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.72	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 24.25 out of 26.33

Confidence: strong

Additional weak hits (11):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.88 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.13 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.31 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.97 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.04 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.10 out of 25.88

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.73 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 52985:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Thr - NMe-Phe - X - X - D-Hpg) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 47493:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Thr - NMe-Phe - X - X - D-Hpg) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 9484 - 52985:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Thr - NMe-Phe - X - X - D-Hpg) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS17950: X

AMP-binding (471..866): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VGMAFDMSVFEAAAQLAGEGNLYGLTEVSVYSTL
Nearest Stachelhaus code(s):: Ala DLFNNALVYK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

BN1199_RS58050: Thr - Phe - X - X - Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (450..829): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHFHFDFSVWEGNQVFGGETNMYGITETTVHVTR
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1482..1860): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHAFDAALWEATVVVAGEVNGYGPTETTVAAAV
Nearest Stachelhaus code(s):: Phe DAWTFAGVAK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2866..3257): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTAV--LLAGERNVYGPTETTVSATE
Nearest Stachelhaus code(s):: Glu DLTKLAAVTK (74% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (3893..4277): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHAFDASACETMLLTGGELNAYGPTETTVCATL
Nearest Stachelhaus code(s):: Leu DAWLLGAVCK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (4920..5312): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDISDYEVHFLTGGDRHLYGPTEITLCATA
Nearest Stachelhaus code(s):: Hpg DIYHLGLLCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS17960: NH2

CAL_domain (42..482): NH2

minowa: NH2

Prediction, score:

NH2: 140.6
fatty_acid: 29.8
AHBA: 14.1
shikimic_acid: 0.6
Acetyl-CoA: 0.6

BN1199_RS17965: mmal

PKS_AT (614..901): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Malonyl-CoA: 66.7%; Methoxymalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 128.6
Malonyl-CoA: 104.6
Methoxymalonyl-CoA: 101.7
Ethylmalonyl-CoA: 99.4
Isobutyryl-CoA: 72.4
Acetyl-CoA: 51.1
fatty_acid: 48.2
Propionyl-CoA: 45.3
trans-1,2-CPDA: 45.0
2-Methylbutyryl-CoA: 35.4
Benzoyl-CoA: 33.7
inactive: 19.5
CHC-CoA: 19.3
3-Methylbutyryl-CoA: 8.1

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator

NZ_CDME01000008.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 418,588 - 452,430 nt. (total: 33,843 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BN1199_RS21310: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS21315: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS21325: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase

BN1199_RS21320: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: hydratase

BN1199_RS21305: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

BN1199_RS21280: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS21350: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.59	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.23 out of 23.79

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

Additional weak hits (5):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.29 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 25.28 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 418587 - 452430:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS21280: X

AMP-binding (39..410): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

BN1199_RS21350: X

AMP-binding (9..407): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -DHA-------IHMIHGAAVEYYAATEGGGTSIS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000008.1 - Region 2 - NRPS-like,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 453,085 - 500,980 nt. (total: 47,896 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

BN1199_RS21385: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BN1199_RS21390: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BN1199_RS21395: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS21400: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BN1199_RS21405: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS21495: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BN1199_RS21515: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: methyltransferase

BN1199_RS21530: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: lyase

BN1199_RS21475: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

BN1199_RS21465: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.63	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.58	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.56	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.55	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.53	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.43	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002276.2	0.42	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000563.4	0.40	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.38	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000553.3	0.37	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.73	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.62	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000513.3	0.61	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.56	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000563.4	0.52	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000553.3	0.50	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BN1199_RS21540

BN1199_RS56280

Leader:

MSVLDLQGMEAAPQTGGHGG

Core:

GSSNSGHSCPSNLSLTLCDGSSGLSLLICH

Core with dehydrations:

GDhaDhaNDhaGHDhaCysPDhaNLDhaLDhbLCysDGDhaDhaGLDhaLLICysH

antiSMASH-DB 4.0 matches for BN1199_RS56280

100.0%

NZ_CDME01000008.1:

Lanthipeptides: BN1199_RS56280_lanthipeptide

1

GSSNSGHSCPSNLSLTLCDGSSGLSLLICH

30

GSSNSGHSCPSNLSLTLCDGSSGLSLLICH

1

GSSNSGHSCPSNLSLTLCDGSSGLSLLICH

30

93.3%

NZ_CP012752.1:

Lanthipeptides: AOZ06_RS57330_lanthipeptide

1

GSSNSGHSCPSNLSLTLCDGSSGLSLLICH

30

GSSNSGHSCPSNLSLTLC+G SGLSLLICH

1

GSSNSGHSCPSNLSLTLCNGGSGLSLLICH

30

93.3%

NZ_JAAATY010000001.1:

Lanthipeptides: GC106_RS02675_lanthipeptide

1

GSSNSGHSCPSNLSLTLCDGSSGLSLLICH

30

GSSNSGHSCPSNLSLTLC G+SGLSLLICH

1

GSSNSGHSCPSNLSLTLCGGTSGLSLLICH

30

with 81 more sequence matches

Only the first 10 are displayed here.

90.0%

NZ_FWXV01000003.1:

Lanthipeptides: B9C43_RS55710_lanthipeptide

1

GSSNSGHSCPSNLSLTLCDGSSGLSLLICH

30

GSSNSGHSCPSNLS+TLC G+SGLSLLICH

1

GSSNSGHSCPSNLSVTLCGGTSGLSLLICH

30

80.0%

NZ_KB903814.1:

Lanthipeptides: A3G1_RS40055_lanthipeptide

3

SNSGHSCPSNLSLTLCDGSSGLSLLICH

30

S SGHSCPSNLS+TLC GSSGLS+LICH

1

STSGHSCPSNLSVTLCGGSSGLSVLICH

28

80.0%

NZ_SGWQ01000004.1:

Lanthipeptides: EV193_RS13500_lanthipeptide

3

SNSGHSCPSNLSLTLCDGSSGLSLLICH

30

S SGHSCPSNLS+TLC G+SGLSLLICH

1

SASGHSCPSNLSVTLCGGTSGLSLLICH

28

77.4%

NZ_FNGF01000002.1:

Lanthipeptides: BLS99_RS06065_lanthipeptide

1

GSSNSGHSCPSNLSLTLCDGSSGLSLLICH

30

GSS SGHSCPSNLS TLC G+SGLS+L+CH

2

GSSASGHSCPSNLSATLCGGTSGLSILLCH

31

73.3%

NZ_BNAU01000004.1:

Lanthipeptides: IE290_RS20710_lanthipeptide

3

SNSGHSCPSNLSLTLCDGSSGLSLLICH

30

S SG SCPSNLS+TLC G+SGLS+LICH

1

SASGKSCPSNLSVTLCGGTSGLSVLICH

28

73.3%

NZ_RSEB01000004.1and 1 other:

NZ_WIAO01000001.1 Lanthipeptides: GFD30_RS00960_lanthipeptide

Lanthipeptides: EIW28_RS16895_lanthipeptide

3

SNSGHSCPSNLSLTLCDGSSGLSLLICH

30

S SGHSCPSNLS TLC G+SGLS+L+CH

1

SASGHSCPSNLSATLCGGTSGLSVLLCH

28

70.0%

NZ_CP091196.1:

Lanthipeptides: L1857_RS00175_lanthipeptide

5

SGHSCPSNLSLTLCDGSSGLSLLICH

30

SG SCPSNLS+TLC G+SGLS+LICH

2

SGKSCPSNLSVTLCGGTSGLSVLICH

27

66.7%

NZ_FNAD01000001.1:

Lanthipeptides: BLQ63_RS02575_lanthipeptide

4

NSGHSCPSNLSLTLCDGSSGLSLLICH

30

+SGHSCPSNLS LC G+SGLS+L+CH

1

SSGHSCPSNLSAALCGGTSGLSILLCH

27

66.7%

NZ_JAGFNP010000002.1:

Lanthipeptides: J5V16_RS05050_lanthipeptide

5

SGHSCPSNLSLTLCDGSSGLSLLICH

30

SGHSCPSNLS TLC G+S LS+L+CH

1

SGHSCPSNLSATLCGGTSSLSVLLCH

26

66.7%

NZ_JAPZVR010000008.1:

Lanthipeptides: O2L52_RS16615_lanthipeptide

5

SGHSCPSNLSLTLCDGSSGLSLLICH

30

SGHSCPSNLS TLC G+S LS+L+CH

1

SGHSCPSNLSATLCGGTSSLSILLCH

26

MIBiG 4.0 matches for BN1199_RS56280

16.7%

BGC0000503.5 (cinA):

Lanthipeptide: cinnamycin

7

HSCPSNLSLTLCDGSS

22

SC +CDG++

3

QSCSFGPFTFVCDGNT

18

16.7%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

22

SGLSLLICH

30

S +SLL+C

3

SQVSLLVCE

11

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.13 out of 24.78

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.77 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.05 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 28.19

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.02 out of 27.04

Confidence: medium

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.91 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.31 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.76 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.76 out of 26.85

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.54 out of 30.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.06 out of 25.75

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.73 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.88 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.50 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.01 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Core peptide predictions

BN1199_RS56280 - Class III

Cleavage pHMM score: 6.00

RODEO score: 0

Monoisotopic mass: 2765.3 Da

Molecular weight: 2767.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2785.1 Da N = 1; 2803.1 Da N = 2; 2821.1 Da N = 3; 2839.1 Da N = 4; 2857.1 Da N = 5; 2875.2 Da N = 6; 2893.2 Da N = 7

Predicted core structure(s)

For candidate cluster 2, location 453084 - 500980:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 453084 - 496588:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS21465: X

AMP-binding (80..511): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MGMMHVAGRGTALLVNGADL-------GGRVASF
Nearest Stachelhaus code(s):: Leu DALLVGAVVK (26% 8Å match); Hmp GALLVGITVK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
LexA variant 2	Repressor of DNA damage response
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_CDME01000008.1 - Region 3 - ectoine

Download region GenBank file

Download region SVG

Location: 562,788 - 573,162 nt. (total: 10,375 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BN1199_RS21855: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: ligase

BN1199_RS21830: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii
BGC0001778.5	0.50	other (other)	showdomycin	Streptomyces showdoensis
BGC0000343.5	0.44	NRPS	enterobactin	Pseudomonas sp. J465
BGC0000131.5	0.42	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000312.4	0.41	NRPS	bassianolide	Beauveria bassiana
BGC0000706.3	0.40	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001073.5	0.40	NRPS, PKS	kosinostatin	Micromonospora sp. TP-A0468
BGC0002097.3	0.39	NRPS, PKS, saccharide	kosinostatin	Micromonospora sp. 28ISP2-46

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.59	NRPS	enniatin	Fusarium equiseti
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000852.5	0.50	other (other)	ectoine	Sporosarcina pasteurii
BGC0001778.5	0.50	other (other)	showdomycin	Streptomyces showdoensis
BGC0000343.5	0.44	NRPS	enterobactin	Pseudomonas sp. J465
BGC0000131.5	0.42	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000312.4	0.41	NRPS	bassianolide	Beauveria bassiana
BGC0000706.3	0.40	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001073.5	0.40	NRPS, PKS	kosinostatin	Micromonospora sp. TP-A0468
BGC0002097.3	0.39	NRPS, PKS, saccharide	kosinostatin	Micromonospora sp. 28ISP2-46

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (1):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.39 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
OsdR	Development and stress management regulator

NZ_CDME01000008.1 - Region 4 - HR-T2PKS

Download region GenBank file

Download region SVG

Location: 749,558 - 794,363 nt. (total: 44,806 nt) Show pHMM detection rules used

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BN1199_RS22665: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS22670: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS22680: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS22725: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

BN1199_RS22730: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

BN1199_RS22745: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

BN1199_RS22750: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

BN1199_RS22700: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

BN1199_RS22705: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

BN1199_RS22835: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

BN1199_RS22870: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthase

BN1199_RS22720: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

BN1199_RS22755: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS22760: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS22770: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002043.3	0.55	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000866.5	0.53	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002721.2	0.52	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0002000.4	0.52	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000867.3	0.51	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002510.2	0.50	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0002711.2	0.50	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000236.5	0.49	PKS	kinamycin	Streptomyces murayamaensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002043.3	0.55	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000866.5	0.53	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002721.2	0.52	saccharide	α-hydroxynitrile glucoside, β-hydroxynitrile glucoside, γ-hydroxynitrile glucoside	Hordeum vulgare subsp. vulgare
BGC0002000.4	0.52	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000867.3	0.51	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002510.2	0.50	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0002711.2	0.50	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000236.5	0.49	PKS	kinamycin	Streptomyces murayamaensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 22.76 out of 29.25

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.85 out of 25.88

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.48 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (9):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.83 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.03 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.90 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.21 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.55 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.46 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.38 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.44 out of 28.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
PsrA	Oleic acid responsive regulator
SypG	Regulator of biofilm formation and host colonization
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000008.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 1,067,472 - 1,089,679 nt. (total: 22,208 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BN1199_RS24185: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS24245: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: hydrolase

BN1199_RS24195: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

BN1199_RS24230: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000231.5	0.38	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001868.4	0.38	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0000631.5	0.38	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000507.5	0.37	ribosomal	epicidin	Staphylococcus epidermidis
BGC0001485.4	0.36	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000671.3	0.36	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002045.3	0.35	PKS	persiamycin A	Streptomonospora sp. PA3
BGC0001895.4	0.35	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000888.5	0.35	other (other)	bacilysin	Bacillus sp. CS93

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.80	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000231.5	0.38	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001868.4	0.38	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0000631.5	0.38	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000507.5	0.37	ribosomal	epicidin	Staphylococcus epidermidis
BGC0001485.4	0.36	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000671.3	0.36	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002045.3	0.35	PKS	persiamycin A	Streptomonospora sp. PA3
BGC0001895.4	0.35	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000888.5	0.35	other (other)	bacilysin	Bacillus sp. CS93

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

BN1199_RS24230: T1TS + T1TS

Domain 1 (1 - 329): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (330 - 704): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

Additional weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 26.85

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.99 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.74 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.56 out of 26.85

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.01 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.48 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000008.1 - Region 6 - HR-T2PKS,other

Download region GenBank file

Download region SVG

Location: 1,114,089 - 1,167,044 nt. (total: 52,956 nt) Show pHMM detection rules used

HR-T2PKS: (hr-t2pks-ksa and (t2fas or APE_KS2 or ketoacyl-synt))
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

BN1199_RS24430: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BN1199_RS24435: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS24460: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS24490: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS24575: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: acetyltransferase acylase acyltransferase methyltransferase

BN1199_RS24395: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

BN1199_RS24455: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BN1199_RS24505: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

BN1199_RS24510: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

BN1199_RS24495: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: lyase

BN1199_RS52990: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthase

BN1199_RS24480: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

BN1199_RS24530: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.50	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001369.3	0.42	PKS	metatricycloene	uncultured bacterium
BGC0002510.2	0.37	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001928.2	0.37	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001197.5	0.37	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001374.5	0.36	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000248.5	0.35	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737
BGC0000885.3	0.34	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001605.3	0.34	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000254.5	0.34	PKS	oxytetracycline	Streptomyces rimosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001369.3	0.56	PKS	metatricycloene	uncultured bacterium
BGC0002510.2	0.51	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001928.2	0.51	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001374.5	0.50	other (other)	thienodolin	Streptomyces albogriseolus
BGC0001197.5	0.50	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0000248.5	0.49	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737
BGC0000885.3	0.48	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001605.3	0.48	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000254.5	0.48	PKS	oxytetracycline	Streptomyces rimosus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.60 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.92 out of 29.65

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.30 out of 24.78

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.34 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.77 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BN1199_RS24455: mal

PKS_AT (4..291): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 56.5
Methoxymalonyl-CoA: 34.2
Methylmalonyl-CoA: 30.0
Isobutyryl-CoA: 21.7
inactive: 19.9
Propionyl-CoA: 17.3
CHC-CoA: 16.3
fatty_acid: 12.1
Benzoyl-CoA: 10.2
trans-1,2-CPDA: 8.3
Ethylmalonyl-CoA: 5.5
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000008.1 - Region 7 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1,252,438 - 1,273,478 nt. (total: 21,041 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BN1199_RS25105: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: sulfotransferase

BN1199_RS25110: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Hydrolases: back translocase dehalogenase

BN1199_RS25035: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BN1199_RS25085: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Ligases: synthase synthetase

BN1199_RS25060: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

BN1199_RS25070: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000665.5	0.48	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002591.2	0.45	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000666.5	0.45	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000663.5	0.44	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000668.5	0.42	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0000665.5	0.48	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000657.5	0.46	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0002591.2	0.45	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000666.5	0.45	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0000663.5	0.44	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000668.5	0.42	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BN1199_RS25070: PT_FPPS_like

Domain 1 (57 - 341): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.63 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.50 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.37 out of 18.57

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_CDME01000008.1 - Region 8 - NRPS,T1PKS,phosphonate

Download region GenBank file

Download region SVG

Location: 1,276,629 - 1,359,403 nt. (total: 82,775 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
phosphonate: (phosphonates and minimum(1, [2-Hacid_dh_C, Aldedh, Aminotran_1_2, Aminotran_5, AurF, CTP_transf_like, DUF4992, Fe-ADH, HMGL-like, Metallophos_2, NTP_transf_3, NTP_transf_5, PALP, PEP_mutase, TPP_enzyme_C, TPP_enzyme_N, phosphonates]) and not (phosphonatesHydrolase or phosphonatesMeIsocitrateLyase))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

BN1199_RS25240: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS25390: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

BN1199_RS25400: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Transferases: acylase aminotransferase

BN1199_RS25250: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

BN1199_RS25405: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase synthase

BN1199_RS25255: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS25260: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS25265: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS25275: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS25280: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS53035: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.84	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.76	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.74	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.70	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

Additional weak hits (23):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.90 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.16 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.37 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.08 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.51 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.97 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.78 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.46 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.67 out of 20.97

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.16 out of 36.53

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.31 out of 23.43

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.84 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.90 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.14 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.27 out of 26.85

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.33 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 1276628 - 1359403:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Cys - Cys) + (X) + (Me-mal) + (NH2)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 1276628 - 1340773:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Cys - Cys) + (X) + (Me-mal) + (NH2)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS25250: mal

PKS_AT (522..788): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 144.7
inactive: 72.8
Methylmalonyl-CoA: 58.5
Methoxymalonyl-CoA: 57.7
Isobutyryl-CoA: 41.3
Propionyl-CoA: 38.4
Ethylmalonyl-CoA: 30.2
Benzoyl-CoA: 18.5
2-Methylbutyryl-CoA: 18.0
CHC-CoA: 17.0
Acetyl-CoA: 15.8
fatty_acid: 14.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

BN1199_RS25260: Cys - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (165..565): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: THVSFDLSVWDGMGILGGDVSLGGNTEASILSCT
Nearest Stachelhaus code(s):: Leu DLLHLGLILK (35% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1234..1626): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: CETTHDMSVFDGNSFLGGDVSVGGPTETTLWNIW
Nearest Stachelhaus code(s):: Cys DMFNFGVLWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS25265: X

AMP-binding (491..889): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISVNELYIWCGGEYHGYGPAETTVGVSC
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

BN1199_RS53035: mal

PKS_AT (524..791): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 89.3
inactive: 59.3
Methoxymalonyl-CoA: 52.2
Methylmalonyl-CoA: 42.3
Ethylmalonyl-CoA: 22.8
fatty_acid: 18.7
Propionyl-CoA: 16.3
2-Methylbutyryl-CoA: 10.8
Isobutyryl-CoA: 9.0
Benzoyl-CoA: 7.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

BN1199_RS25275: NH2

CAL_domain (662..1074): NH2

minowa: NH2

Prediction, score:

NH2: 30.9
fatty_acid: 29.5
Acetyl-CoA: 0.7
shikimic_acid: 0.0
AHBA: 0.0

BN1199_RS25280: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (6..389): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FWATFDLSVFEANTNLAGEYNLYGPSEDTTYSTW
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000008.1 - Region 9 - azole-containing-RiPP,thioamitides

Download region GenBank file

Download region SVG

Location: 1,423,388 - 1,447,771 nt. (total: 24,384 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BN1199_RS25720: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

BN1199_RS25730: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS53060: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.46	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002631.2	0.42	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000844.5	0.35	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.33	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001475.4	0.30	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002103.2	0.30	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001485.4	0.30	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002560.3	0.27	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0002120.3	0.27	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000483.5	0.26	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.56	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.47	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001475.4	0.45	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001485.4	0.45	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0002560.3	0.42	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0002120.3	0.42	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000688.4	0.42	terpene	copalyl diphosphate	Diaporthe amygdali

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (3):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.73 out of 26.85

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.43 out of 36.54

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.00 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_CDME01000010.1 - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 1 - 36,584 nt. (total: 36,584 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BN1199_RS26505: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

BN1199_RS26585: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BN1199_RS26595: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase glycosyltransferase

BN1199_RS26495: aminotransferase

smcogs: SMCOG1019: aminotransferase

BN1199_RS26530: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

BN1199_RS26525: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: decarboxylase

BN1199_RS26555: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: synthase

BN1199_RS26510: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS26515: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.56	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata
BGC0000041.3	0.49	PKS	oronofacic acid	Pseudomonas syringae
BGC0000863.3	0.40	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002648.2	0.38	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.38	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000862.3	0.35	other (other)	eicosapentaenoic acid	Shewanella pneumatophori

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0000041.3	0.58	PKS	oronofacic acid	Pseudomonas syringae
BGC0000863.3	0.52	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12
BGC0002648.2	0.51	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.51	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0000862.3	0.49	other (other)	eicosapentaenoic acid	Shewanella pneumatophori

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.74 out of 20.97

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.33 out of 24.78

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.67 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.67 out of 30.11

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.04 out of 23.43

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (9):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.17 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.88 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.89 out of 39.62

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.89 out of 20.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.94 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.56 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.62 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.09 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 36584:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)
Non-colinear ordering:: BN1199_RS26515 + BN1199_RS26520

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS26510: mal

PKS_AT (1166..1450): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 80.5
Methoxymalonyl-CoA: 37.3
Methylmalonyl-CoA: 32.8
inactive: 32.0
Propionyl-CoA: 21.5
Ethylmalonyl-CoA: 15.1
CHC-CoA: 8.9
Isobutyryl-CoA: 5.8
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -1.8

BN1199_RS26515: mmal

PKS_AT (588..797): mmal

ATSignature: (unknown)

No matches above 50%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 6.6
Malonyl-CoA: 3.3
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
LexA variant 2	Repressor of DNA damage response

NZ_CDME01000010.1 - Region 2 - ectoine

Download region GenBank file

Download region SVG

Location: 171,714 - 182,088 nt. (total: 10,375 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BN1199_RS27220: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Ligases: ligase

BN1199_RS27235: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.61	other (other)	showdomycin	Streptomyces showdoensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000131.5	0.48	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000860.3	0.44	other (other)	ectoine	Methylarcula marina
BGC0002020.3	0.44	NRPS, saccharide	photolose, oligosaccharide 1 (GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 2 (GlcNAc-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 3 (GlcNAc-β(1-4)-GlcNAc-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 4 (GlcN-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 5 (6-phosphoGlcN-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc)	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002690.2	0.41	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0000258.3	0.40	PKS	prodigiosin	Serratia sp.
BGC0002749.2	0.40	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0002412.2	0.40	NRPS	holomycin	Photobacterium galatheae
BGC0002620.2	0.39	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.61	other (other)	showdomycin	Streptomyces showdoensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000131.5	0.48	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000860.3	0.44	other (other)	ectoine	Methylarcula marina
BGC0002020.3	0.44	NRPS, saccharide	photolose, oligosaccharide 1 (GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 2 (GlcNAc-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 3 (GlcNAc-β(1-4)-GlcNAc-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 4 (GlcN-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc), oligosaccharide 5 (6-phosphoGlcN-β(1-4)-GlcNAc-β(1-4)-1,6-anhydro-β-GlcNAc)	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002690.2	0.41	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0000258.3	0.40	PKS	prodigiosin	Serratia sp.
BGC0002749.2	0.40	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0002412.2	0.40	NRPS	holomycin	Photobacterium galatheae
BGC0002620.2	0.39	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.54 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 26.85

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.55 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NZ_CDME01000010.1 - Region 3 - T1PKS

Download region GenBank file

Download region SVG

Location: 183,253 - 226,237 nt. (total: 42,985 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase reductase

BN1199_RS27280: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

BN1199_RS27305: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

BN1199_RS27315: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

BN1199_RS27405: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: hydrolase

BN1199_RS27425: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

BN1199_RS27345: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.36 out of 36.53

Confidence: medium

Additional weak hits (7):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.22 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 25.75

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.29 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.02 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.21 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.36 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 183252 - 226237:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS27345: mmal

PKS_AT (547..842): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Propionyl-CoA: 70.8%; Methoxymalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 139.7
Methoxymalonyl-CoA: 114.1
Ethylmalonyl-CoA: 113.1
Isobutyryl-CoA: 83.3
2-Methylbutyryl-CoA: 80.5
Propionyl-CoA: 78.4
Malonyl-CoA: 77.1
trans-1,2-CPDA: 60.5
CHC-CoA: 60.4
Benzoyl-CoA: 55.5
Acetyl-CoA: 43.8
3-Methylbutyryl-CoA: 32.9
inactive: 22.9
fatty_acid: 22.1

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
HypR	L-hydroxyproline utilization repressor

NZ_CDME01000010.1 - Region 4 - NRPS,ectoine

Download region GenBank file

Download region SVG

Location: 263,896 - 316,837 nt. (total: 52,942 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BN1199_RS27615: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BN1199_RS27720: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS27730: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase carboxylase

BN1199_RS27650: aminotransferase

smcogs: SMCOG1019: aminotransferase

BN1199_RS27700: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: amidase

BN1199_RS27705: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase

BN1199_RS27640: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS27675: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.45	other (other)	showdomycin	Streptomyces showdoensis
BGC0002075.3	0.43	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.41	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.41	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.40	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.39	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.39	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.39	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.38	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.37	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.36 out of 23.43

Confidence: medium

Additional weak hits (6):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.25 out of 31.73

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.32 out of 23.43

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.58 out of 27.04

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 263895 - 316837:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - X - X - Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS27640: X

AMP-binding (4..378): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLCLLDTQAISTGDYNLYGCTETNDSFLH
Nearest Stachelhaus code(s):: Ala DILQITLVYK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

BN1199_RS27675: X - X - X - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (10..400): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MEHVFDVSMADMDLIVGGEVHVYGPTESTVVATM
Nearest Stachelhaus code(s):: Trp DVASVGAVVK (68% 8Å match); Lys DAEDIGSVVK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1495..1877): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VAHVFDVSMADMDLVVGGEMHVYGPTEATVVATM
Nearest Stachelhaus code(s):: Trp DVASVGAVVK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2512..2885): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTYEVYFWTGGDVHSYGPTETTFASSY
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (76% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (3516..3891): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTVTKAIVAGEVNSYGPTEITVSCME
Nearest Stachelhaus code(s):: OH-Asp or OMe-Asp DLTKIGAVNK (74% 8Å match); Glu DLVKVASVNK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000010.1 - Region 5 - RiPP-like

Download region GenBank file

Download region SVG

Location: 340,651 - 367,078 nt. (total: 26,428 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BN1199_RS27890: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.47	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000583.5	0.46	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000565.5	0.45	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002584.2	0.45	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000483.5	0.44	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000477.3	0.43	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002635.2	0.43	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000945.3	0.43	other (other)	vibriobactin	Vibrio cholerae O1 biovar El Tor str. N16961
BGC0002311.3	0.43	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000563.4	0.43	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.47	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000583.5	0.46	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000565.5	0.45	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002584.2	0.45	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000483.5	0.44	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000477.3	0.43	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002635.2	0.43	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000945.3	0.43	other (other)	vibriobactin	Vibrio cholerae O1 biovar El Tor str. N16961
BGC0002311.3	0.43	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000563.4	0.43	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

Additional weak hits (8):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.12 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.84 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.77 out of 31.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.19 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.28 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 23.39 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.48 out of 29.65

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 9 - 106; Score: 60.3; RRE type: NHLP_CD_RRE; Location: 9 - 102; Score: 42.3; RRE type: Cyanobactin_D_RRE; Location: 10 - 83; Score: 38.0

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000010.1 - Region 6 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 393,134 - 414,174 nt. (total: 21,041 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BN1199_RS28090: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: transferase

BN1199_RS28155: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: lyase

BN1199_RS28150: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthase synthetase

BN1199_RS28120: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

BN1199_RS28125: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002458.3	0.46	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0000663.5	0.45	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001817.5	0.44	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0001594.3	0.43	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000668.5	0.42	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0002645.3	0.41	other (other)	fluopsin C	Pseudomonas aeruginosa PAO1
BGC0002591.2	0.41	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0002458.3	0.46	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0000663.5	0.45	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001817.5	0.44	other (other)	vancosamine	Streptomyces sp. WAC2288
BGC0001594.3	0.43	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000668.5	0.42	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0002645.3	0.41	other (other)	fluopsin C	Pseudomonas aeruginosa PAO1
BGC0002591.2	0.41	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

BN1199_RS28120: PT_FPPS_like

Domain 1 (50 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

Additional weak hits (2):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.44 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.21 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000011.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 705,338 - 726,786 nt. (total: 21,449 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

BN1199_RS31760: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: synthase

BN1199_RS31740: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000285.5	0.42	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002346.3	0.39	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.37	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0001157.6	0.36	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.36	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001910.4	0.35	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000285.5	0.42	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0000528.5	0.40	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002346.3	0.39	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.37	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0001157.6	0.36	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.36	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001910.4	0.35	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

BN1199_RS31790: T2TS

Domain 1 (16 - 474): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.90 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.58 out of 28.19

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.24 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.25 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.35 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
ZuR variant 1	Zinc-responsive repressor

NZ_CDME01000011.1 - Region 2 - ectoine

Download region GenBank file

Download region SVG

Location: 1,013,610 - 1,024,005 nt. (total: 10,396 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BN1199_RS33210: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase

BN1199_RS33200: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000857.3	0.68	other (other)	ectoine	Methylophaga alcalica
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000857.3	0.68	other (other)	ectoine	Methylophaga alcalica
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.27 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.01 out of 36.54

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.52 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.92 out of 20.01

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.77 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.68 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CDME01000011.1 - Region 3 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1,068,474 - 1,090,935 nt. (total: 22,462 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

BN1199_RS33455: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: hydrolase

BN1199_RS55205: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001548.4	0.49	ribosomal	citrulassin A	Streptomyces albulus
BGC0001506.5	0.49	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001539.4	0.49	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.48	ribosomal	ulleungdin	Streptomyces sp.
BGC0001552.3	0.47	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001307.3	0.47	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0002074.2	0.46	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001549.3	0.46	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001550.3	0.46	ribosomal	citrulassin D	Streptomyces katrae
BGC0001507.3	0.45	ribosomal	anantin C	Streptomyces olindensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001548.4	0.49	ribosomal	citrulassin A	Streptomyces albulus
BGC0001506.5	0.49	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001539.4	0.49	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0002053.3	0.48	ribosomal	ulleungdin	Streptomyces sp.
BGC0001552.3	0.47	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001307.3	0.47	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0002074.2	0.46	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001549.3	0.46	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001550.3	0.46	ribosomal	citrulassin D	Streptomyces katrae
BGC0001507.3	0.45	ribosomal	anantin C	Streptomyces olindensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.95 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.84 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 18 - 88; Score: 37.2

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_CDME01000011.1 - Region 4 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 1,184,886 - 1,210,592 nt. (total: 25,707 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BN1199_RS33990: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

BN1199_RS34005: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.60	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002073.3	0.49	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002683.2	0.44	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000939.5	0.44	other (other)	aerobactin	Grimontia hollisae
BGC0001870.3	0.43	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0002531.3	0.43	NRPS	cepaciachelin	Burkholderia ambifaria AMMD
BGC0000947.5	0.43	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002476.2	0.42	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0000325.5	0.40	NRPS	coelichelin	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.60	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002073.3	0.49	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002683.2	0.44	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000939.5	0.44	other (other)	aerobactin	Grimontia hollisae
BGC0001870.3	0.43	other (other)	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0002531.3	0.43	NRPS	cepaciachelin	Burkholderia ambifaria AMMD
BGC0000947.5	0.43	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002476.2	0.42	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0000569.5	0.41	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0000325.5	0.40	NRPS	coelichelin	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.64 out of 28.19

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (15):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.42 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.37 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.88 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.22 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.38 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.71 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.88 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.91 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.07 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.57 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.56 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.13 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.42 out of 23.43

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

TFBS Finder

Azole RiPPs

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
ZuR variant 1	Zinc-responsive repressor

Core peptide predictions

No core peptides found.

NZ_CDME01000011.1 - Region 5 - NRP-metallophore,NRPS,T2PKS,other

Download region GenBank file

Download region SVG

Location: 1,308,390 - 1,428,398 nt. (total: 120,009 nt) Show pHMM detection rules used

other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
T2PKS: (t2ks and t2clf)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

BN1199_RS34450: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BN1199_RS34500: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

BN1199_RS34515: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS34525: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS34550: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BN1199_RS34565: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BN1199_RS34730: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS34755: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

BN1199_RS34790: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acyltransferase carboxylase glycosyltransferase halogenase transferase

BN1199_RS34575: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BN1199_RS34595: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BN1199_RS34605: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

BN1199_RS34620: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

BN1199_RS53375: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: dehalogenase hydrolase

BN1199_RS34650: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BN1199_RS34745: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: cyclase decarboxylase dehydratase

BN1199_RS34390: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

BN1199_RS34540: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

BN1199_RS34590: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

BN1199_RS34765: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

BN1199_RS59075: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Isomerases: isomerase

BN1199_RS34735: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

BN1199_RS34435: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS34635: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS34640: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BN1199_RS34660: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS34670: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS34740: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

BN1199_RS34445: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.30	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.20	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	1.20	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.16	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	1.15	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	1.14	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002071.2	1.13	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001240.4	1.12	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001825.4	1.11	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	1.10	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001133.4	0.72	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.71	NRPS	HC-toxin	Alternaria jesenskae
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002071.2	0.70	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001240.4	0.70	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.40 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.70 out of 20.97

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.42 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.48 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.74 out of 36.53

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (15):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.74 out of 20.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.28 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.77 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.79 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.18 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.84 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.52 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.04 out of 39.62

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.29 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.95 out of 36.53

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.13 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 1308389 - 1428398:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - D-Ser) + (His - X - D-X) + (X - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 1323011 - 1395524:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - D-Ser) + (His - X - D-X) + (X - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 1343362 - 1428398:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - D-Ser) + (His - X - D-X) + (X - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS34435: X

AMP-binding (27..409): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NVQIHGRTVVGAETGAGFDVEVYGQNESGPIAIR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BN1199_RS34660: Arg - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (434..798): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHAFDAAIDAWDVVFGGEVNAYGPTEYTVDATQ
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1417..1810): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS53375: His - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (464..843): His

nrpys: His

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTVAFDTSIWEMTLIVAGEFNSYGPTETTVDATL
Nearest Stachelhaus code(s):: His DTWTIASVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1475..1856): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWGSFIDGSTEGTLVSSGEVDLYGCSEAGGDSLM
Nearest Stachelhaus code(s):: me-bAla LDTTVSLGDK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3045..3431): X

nrpys: Trp, Pro

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTMAFDVSLAEIVIIVGTELNAYGPTEATVNSTL
Nearest Stachelhaus code(s):: Trp or Pro DVMFIGAVNK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

BN1199_RS34670: X - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (444..827): X

nrpys: me-bAla

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWLSFVDGTTEGTGVSSGEVNLYGSSEASGDSMY
Nearest Stachelhaus code(s):: me-bAla LDTTVSLGDK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1464..1847): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDAAWQPWEVGFGGDVNLYGPTECTVDTLA
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS34740: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (30..431): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SESLFTLSSPGGGVQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (88% 8Å match); Sal ALPGQGVLNK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 1323011 to 1395524
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

BN1199_RS34515: KR (Score: 102.2; E-value: 8.3e-32)
BN1199_RS34525: KR C19 (Score: 319.6; E-value: 3.1e-98)
BN1199_RS34550: OXY (Score: 108.6; E-value: 9.4e-34)
BN1199_RS34575: GT (Score: 165.1; E-value: 7.5e-51)
BN1199_RS34590: CYC C4-C21/C2-C23|C2-C19 (Score: 118.8; E-value: 2.3e-37)
BN1199_RS34620: HAL (Score: 425.6; E-value: 5.3e-130)
BN1199_RS34625: ACP (Score: 35.3; E-value: 2e-11)
BN1199_RS34635: KS (Score: 686.1; E-value: 3.7e-209)
BN1199_RS34640: CLF (Score: 509.2; E-value: 1.8e-155)
BN1199_RS59075: CYC C9-C14 (Score: 218.3; E-value: 8.7e-68); CYC C5-C18 (Score: 185.6; E-value: 7.4e-58)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000011.1 - Region 6 - T2PKS

Download region GenBank file

Download region SVG

Location: 1,479,301 - 1,551,816 nt. (total: 72,516 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

BN1199_RS35055: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

BN1199_RS35075: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BN1199_RS35090: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

BN1199_RS35095: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BN1199_RS35125: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

BN1199_RS35220: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BN1199_RS35230: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS35245: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

BN1199_RS35310: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

BN1199_RS35340: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase carboxylase methyltransferase transferase

BN1199_RS35040: aminotransferase

smcogs: SMCOG1019: aminotransferase

BN1199_RS35155: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BN1199_RS35165: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

BN1199_RS35335: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Lyases: cyclase decarboxylase

BN1199_RS35175: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

BN1199_RS35265: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

BN1199_RS35305: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Isomerases: isomerase

BN1199_RS35290: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

BN1199_RS35135: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

BN1199_RS35185: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS35190: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BN1199_RS35295: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS35300: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001535.3	0.68	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0000231.5	0.63	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001723.5	0.60	PKS	oviedomycin	Streptomyces antibioticus
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0000271.5	0.59	PKS	spore pigment	Streptomyces avermitilis
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001535.3	0.68	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0000231.5	0.63	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.61	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001723.5	0.60	PKS	oviedomycin	Streptomyces antibioticus
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0000271.5	0.59	PKS	spore pigment	Streptomyces avermitilis
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

Additional weak hits (9):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.22 out of 27.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.47 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.87 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.79 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.98 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.50 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.56 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

BN1199_RS35295: X

AMP-binding (25..395): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YSVSFTGFCNAFYAVSGGELNQLGATEVGCAATM
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BN1199_RS35300: X

AMP-binding (34..424): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RPQH--RFYNAVETCFGGDLQLYGQSETGPVCAR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 1479300 to 1551816
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

BN1199_RS35125: OXY (Score: 14.4; E-value: 3.5e-05)
BN1199_RS35175: CYC C9-C14 (Score: 242.1; E-value: 4e-75)
BN1199_RS35180: CYC C5-C18 (Score: 197.8; E-value: 1.3e-61)
BN1199_RS35185: KS (Score: 699.6; E-value: 3e-213)
BN1199_RS35190: CLF (Score: 496.9; E-value: 9.1e-152)
BN1199_RS35230: KR (Score: 172.0; E-value: 4.3e-53)
BN1199_RS35265: CYC C4-C21/C2-C23|C2-C19 (Score: 135.6; E-value: 1.4e-42)
BN1199_RS35310: OXY (Score: 110.2; E-value: 3e-34)
BN1199_RS35315: OXY (Score: 27.4; E-value: 3.9e-09)
BN1199_RS35335: MET (Score: 205.4; E-value: 2.8e-63)

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000011.1 - Region 7 - indole

Download region GenBank file

Download region SVG

Location: 1,600,859 - 1,621,941 nt. (total: 21,083 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: kinase

BN1199_RS35640: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.49	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002128.3	0.42	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0001483.4	0.36	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001485.4	0.35	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001336.5	0.33	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001197.5	0.33	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002643.2	0.33	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0002194.3	0.33	PKS	epipyrone A	Epicoccum nigrum
BGC0001954.2	0.31	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001294.5	0.49	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002128.3	0.42	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000908.3	0.41	other (other)	melanin	Streptomyces avermitilis
BGC0001483.4	0.36	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001485.4	0.35	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0001336.5	0.33	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001197.5	0.33	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002643.2	0.33	other (other)	aetokthonotoxin	Aetokthonos hydrillicola Thurmond2011
BGC0002194.3	0.33	PKS	epipyrone A	Epicoccum nigrum
BGC0001954.2	0.31	NRPS, PKS	wortmanamide A, wortmanamide B	Talaromyces wortmannii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.74 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.08 out of 28.19

Confidence: medium

Additional weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.96 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.34 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.00 out of 30.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.96 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.04 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
ZuR variant 1	Zinc-responsive repressor

NZ_CDME01000011.1 - Region 8 - terpene

Download region GenBank file

Download region SVG

Location: 1,887,694 - 1,908,788 nt. (total: 21,095 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

BN1199_RS37020: aminotransferase

smcogs: SMCOG1019: aminotransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002346.3	0.43	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001374.5	0.41	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000595.3	0.41	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000503.5	0.38	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000646.5	0.37	terpene	β-carotein	uncultured bacterium
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000534.3	0.37	ribosomal	mutacin K8	Streptococcus mutans
BGC0001660.3	0.37	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001226.4	0.36	ribosomal	streptocollin	Streptomyces collinus Tu 365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002346.3	0.43	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0001374.5	0.41	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000595.3	0.41	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000503.5	0.38	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000646.5	0.37	terpene	β-carotein	uncultured bacterium
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000534.3	0.37	ribosomal	mutacin K8	Streptococcus mutans
BGC0001660.3	0.37	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001226.4	0.36	ribosomal	streptocollin	Streptomyces collinus Tu 365

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

BN1199_RS37030: Lycopene_cycl

Domain 1 (3 - 345): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.10 out of 21.84

Confidence: medium

Additional weak hits (3):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.52 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NZ_CDME01000011.1 - Region 9 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 1,937,064 - 1,957,044 nt. (total: 19,981 nt) Show pHMM detection rules used

Region on contig edge.

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BN1199_RS37235: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase

BN1199_RS37230: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002551.2	0.48	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0000565.5	0.48	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002485.2	0.48	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.48	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000480.5	0.44	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0000475.5	0.44	ribosomal	patellamide A, patellamide C	Prochloron didemni
BGC0000471.4	0.43	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000477.3	0.43	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002311.3	0.43	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000473.4	0.41	ribosomal	aerucyclamide A, aerucyclamide B, aerucyclamide C, aerucyclamide D	Microcystis aeruginosa NIES-298

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002551.2	0.48	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398
BGC0000565.5	0.48	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0002485.2	0.48	other (other), ribosomal	muscoride A, muscoride B	Desmonostoc sp. PCC 7906
BGC0000483.5	0.48	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0000480.5	0.44	ribosomal	tenuecyclamide A, tenuecyclamide C	Nostoc spongiaeforme var. tenue str. Carmeli
BGC0000475.5	0.44	ribosomal	patellamide A, patellamide C	Prochloron didemni
BGC0000471.4	0.43	ribosomal	viridisamide A	Oscillatoria nigro-viridis PCC 7112
BGC0000477.3	0.43	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0002311.3	0.43	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0000473.4	0.41	ribosomal	aerucyclamide A, aerucyclamide B, aerucyclamide C, aerucyclamide D	Microcystis aeruginosa NIES-298

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.04 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.02 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 9 - 108; Score: 94.8; RRE type: Cyanobactin_D_RRE; Location: 8 - 87; Score: 57.8; RRE type: NHLP_CD_RRE; Location: 9 - 90; Score: 57.1

TFBS definitions

Regulator	Description

Core peptide predictions

No core peptides found.

NZ_CDME01000012.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 26,680 - 99,150 nt. (total: 72,471 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BN1199_RS37425: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

BN1199_RS37440: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS37490: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BN1199_RS37505: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

BN1199_RS37510: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

BN1199_RS37525: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

BN1199_RS37545: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS37555: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS37565: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

BN1199_RS37575: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS37705: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

BN1199_RS37740: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acyltransferase aminotransferase carboxylase glycosyltransferase methyltransferase transferase

BN1199_RS37480: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

BN1199_RS37500: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

BN1199_RS37540: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

BN1199_RS37580: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

BN1199_RS37590: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

BN1199_RS37615: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

BN1199_RS37620: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

BN1199_RS37640: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: dehalogenase esterase hydrolase

BN1199_RS37770: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

BN1199_RS37785: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

BN1199_RS57610: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Lyases: cyclase

BN1199_RS37550: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

BN1199_RS37570: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

BN1199_RS37600: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

BN1199_RS37605: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.79	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.68	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	0.64	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002000.4	0.62	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0002514.3	0.61	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0002477.3	0.61	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0001904.2	0.60	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.79	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.68	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	0.64	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002000.4	0.62	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0002514.3	0.61	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0002477.3	0.61	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0001904.2	0.60	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.99 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.19 out of 23.79

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.40 out of 27.55

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.40 out of 27.55

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

Additional weak hits (10):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.00 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.01 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.10 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.83 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.17 out of 27.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.32 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.64 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.42 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 26679 to 99150
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 708.4; E-value: 5.1e-216)
Product molecular weight(s):: acetyl-CoA_8: 521 Da
acetyl-CoA_9: 563 Da

BN1199_RS37440: KR (Score: 98.1; E-value: 1.6e-30)
BN1199_RS37525: KR (Score: 104.0; E-value: 2.4e-32)
BN1199_RS37540: GT (Score: 319.4; E-value: 9.9e-98)
BN1199_RS37545: KR (Score: 131.6; E-value: 9.1e-41)
BN1199_RS37550: CYC C7-C12 (Score: 317.5; E-value: 1.7e-97)
BN1199_RS37555: KR (Score: 110.7; E-value: 2.1e-34)
BN1199_RS37570: CYC C7-C12 (Score: 489.7; E-value: 6.4e-150)
BN1199_RS37575: KR C9 (Score: 475.1; E-value: 1.2e-145)
BN1199_RS37595: ACP (Score: 121.7; E-value: 2.2e-38)
BN1199_RS37600: CLF 8|9 (Score: 708.4; E-value: 5.1e-216)
BN1199_RS37605: KS (Score: 787.5; E-value: 6.2e-240)
BN1199_RS37610: CYC C5-C14 (Score: 472.8; E-value: 9.3e-145)
BN1199_RS37650: DIMER (Score: 250.9; E-value: 3.5e-77)

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000013.1 - Region 1 - thioamide-NRP

Download region GenBank file

Download region SVG

Location: 53,410 - 124,643 nt. (total: 71,234 nt) Show pHMM detection rules used

thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BN1199_RS38715: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS38795: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BN1199_RS38830: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS38835: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS38880: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: glycosyltransferase

BN1199_RS38740: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: glucosidase

BN1199_RS38705: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: decarboxylase dehydratase lyase

BN1199_RS38815: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

BN1199_RS38885: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

BN1199_RS38935: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

BN1199_RS38825: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

BN1199_RS38865: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS38890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002499.2	0.55	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001928.2	0.51	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000820.5	0.49	other (other)	physostigmine	Streptomyces griseofuscus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001605.3	0.48	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002285.2	0.48	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000234.5	0.47	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002499.2	0.55	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001928.2	0.51	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000820.5	0.49	other (other)	physostigmine	Streptomyces griseofuscus
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001605.3	0.48	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002285.2	0.48	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000234.5	0.47	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.56 out of 30.11

Confidence: medium

Additional weak hits (12):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.41 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.85 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.51 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.14 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.49 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.72 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.59 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.57 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.02 out of 23.43

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

BN1199_RS38865: X

AMP-binding (39..447): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GRFMFGSNATPTFGVLGGSINVYGSADGVNCHTA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

BN1199_RS38890: X

AMP-binding (29..422): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GAFLTSFGSNGVIGAPGGAVNVYGSADGVNCHTA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000014.1 - Region 1 - NAPAA

Download region GenBank file

Download region SVG

Location: 255,132 - 288,974 nt. (total: 33,843 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

BN1199_RS40435: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (15):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.19 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.12 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.63 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.37 out of 30.22

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.49 out of 30.97

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.26 out of 32.93

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 23.05 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.08 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.84 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.58 out of 18.57

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.17 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.66 out of 27.04

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.36 out of 23.43

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.84 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 255131 - 288974:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS40435: X

AMP-binding (29..396): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTILGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_CDME01000014.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 501,327 - 567,540 nt. (total: 66,214 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

BN1199_RS41535: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS41545: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BN1199_RS41570: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: hydrolase

BN1199_RS41640: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Isomerases: racemase

BN1199_RS41660: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

BN1199_RS41705: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

BN1199_RS41630: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS41635: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.36 out of 36.53

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.67 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.41 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.43 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.27 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.10 out of 21.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.57 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 501326 - 567540:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Ala) + (D-Orn - Orn - D-Orn - Val - D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS41630: Orn - Orn - Orn - Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (480..849): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNHAFDTSLEGFDLMLGGEYNFYGPTECTVDALS
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1877..2239): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNHAFDTSLEGLDLSIGGEYNFYGPTEATVDTVS
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2852..3213): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNHAFDTSLEGLDLMLGGEYNFYGPTECTVDALS
Nearest Stachelhaus code(s):: Orn DTEDMGFVDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4248..4625): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LEQSFDASTYEVWLWTGGEVDGYGPTETTTFATC
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5248..5616): X

nrpys: Leu, 3OH-Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAQSFDASVLEMLIIVGGDINAYGPTESTVVTSW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (82% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

BN1199_RS41635: X - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (24..399): X

nrpys: Leu, 3OH-Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAESFDASVLEMLIIVGGDINAYGPTECTVVATW
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DALLIGAVVK (85% 8Å match); Leu DALLIGAVVK (68% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1942..2313): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEASGVLAGEVNAYGPTEATVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAAVYK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator

NZ_CDME01000014.1 - Region 3 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 579,984 - 602,884 nt. (total: 22,901 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BN1199_RS41845: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

BN1199_RS41850: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Lyases: cyclase

BN1199_RS41825: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: ligase

BN1199_RS41870: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002704.2	0.46	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.44	ribosomal	archalan α	Halorussus salinus
BGC0000933.3	0.44	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001229.4	0.41	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0002704.2	0.46	ribosomal	archalan β	Halorussus salinus
BGC0002703.2	0.44	ribosomal	archalan α	Halorussus salinus
BGC0000933.3	0.44	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001407.5	0.41	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001229.4	0.41	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001210.5	0.40	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000527.5	0.39	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for BN1199_RS41825

allorf_586457_586582

Leader:

MTELVPSYGG

Core:

LIAESCLKAQLATVPVHALSRVGGVTEGCYS

Core with dehydrations:

LIAEDhaCysLKAQLADhbVPVHALDhaRVGGVDhbEGCysYDha

antiSMASH-DB 4.0 matches for allorf_586457_586582

100.0%

NZ_CDME01000014.1:

Lanthipeptides: allorf_586457_586582_lanthipeptide

1

LIAESCLKAQLATVPVHALSRVGGVTEGCYS

31

LIAESCLKAQLATVPVHALSRVGGVTEGCYS

1

LIAESCLKAQLATVPVHALSRVGGVTEGCYS

31

22.2%

NZ_CP016795.1and 3 others:

NZ_CP016795.1 Lanthipeptides: allorf_4181662_4181862_lanthipeptideNZ_CP036534.1 Lanthipeptides: allorf_4249220_4249420_lanthipeptideNZ_CP036534.1 Lanthipeptides: allorf_4249220_4249420_lanthipeptide

Lanthipeptides: allorf_4181662_4181862_lanthipeptide

1

LIAESCLKAQLATVPVHALSRVGGVTEG

28

++ L ++PV A R G EG

5

MVQTGALHDDFLSLPVDADGRGGATAEG

32

17.6%

NZ_CP048405.1:

Lanthipeptides: allorf_5239913_5240104_lanthipeptide

5

SCLKAQLATVPVHALSR

21

+CL+ + T+P L R

15

ACLRNRSGTIPARELMR

31

with 1 more sequence matches

10.7%

NZ_KB900614.1:

Lanthipeptides: allorf_2973181_2973414_lanthipeptide

21

RVGGVTEGC

29

R G +TEGC

16

RAGWITEGC

24

allorf_592881_593102

Leader:

MSSSAHPDTACLTRTVRFRMGDSGRTVHAFAGTVDRTPGREVPTTTQYGWSRTQMWGA

Core:

VTHVRACARCQPVYS

Core with dehydrations:

VDhbHVRACysARCysQPVYDha

antiSMASH-DB 4.0 matches for allorf_592881_593102

100.0%

NZ_CDME01000014.1:

Lanthipeptides: allorf_592881_593102_lanthipeptide

1

VTHVRACARCQPVYS

15

VTHVRACARCQPVYS

1

VTHVRACARCQPVYS

15

24.2%

NZ_WKYV01000009.1:

Lanthipeptides: GKG41_RS09335_lanthipeptide

1

VTHVRACARCQPVY

14

VT VR C RC Y

14

VTQVRTCTRCTSSY

27

21.4%

NZ_AP026714.1and 3 others:

NZ_KZ845958.1 Lanthipeptides: allorf_1543516_1543677_lanthipeptideNZ_NGMP01000002.1 Lanthipeptides: allorf_000439_000600_lanthipeptideNZ_NGMV01000001.1 Lanthipeptides: allorf_1658458_1658619_lanthipeptide

Lanthipeptides: allorf_1208715_1208876_lanthipeptide

6

ACARCQPVYS

15

AC R PV+S

8

ACNRNSPVHS

17

with 3 more sequence matches

17.2%

NZ_CP101621.1:

Lanthipeptides: NN913_RS16125_lanthipeptide

4

VRACARCQPVYS

15

+R C C P +S

16

LRTCTLCFPTFS

27

14.3%

NZ_CP011112.1:

Lanthipeptides: allorf_0460321_0460527_lanthipeptide

9

RCQPVYS

15

RCQP+Y

25

RCQPLYG

31

8.9%

NZ_CP036019.1and 1 other:

NZ_CP036019.1 Lanthipeptides: EXW52_RS27200_lanthipeptide

Lanthipeptides: EXW52_RS27200_lanthipeptide

6

ACARCQP

12

C RC+P

11

GCGRCEP

17

MIBiG 4.0 matches for allorf_592881_593102

14.8%

BGC0002144.3 (RCCGEPOP_RS37510):

LAP: phazolicin

7

CARCQP

12

CARC

3

CARCDS

8

allorf_592920_593096

Leader:

MGNSSPHLRPGPPVLGSGGYLATWSSVDGTGEGMDCATA

Core:

VTHPEPDSTCQACGVRMGR

Core with dehydrations:

VDhbHPEPDDhaDhbCysQACysGVRMGR

antiSMASH-DB 4.0 matches for allorf_592920_593096

100.0%

NZ_CDME01000014.1:

Lanthipeptides: allorf_592920_593096_lanthipeptide

1

VTHPEPDSTCQACGVRMGR

19

VTHPEPDSTCQACGVRMGR

1

VTHPEPDSTCQACGVRMGR

19

30.4%

NZ_AP018268.1:

Lanthipeptides: allorf_1172443_1172643_lanthipeptide

6

PDSTCQACGVR

16

PDS ACGV+

8

PDSRRLACGVQ

18

22.6%

NZ_CP013979.1:

Lanthipeptides: allorf_0356683_0356829_lanthipeptide

1

VTHPEP--DSTCQACGVR

16

++ PEP TC+ CG +

9

ISQPEPCDRRTCEICGSK

26

with 1 more sequence matches

15.4%

NZ_BFCH01000018.1:

Lanthipeptides: allorf_0596314_0596454_lanthipeptide

4

PEPDSTCQAC

13

PE TC+AC

20

PEERETCRAC

29

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.07 out of 26.85

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

Additional weak hits (7):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.98 out of 31.73

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.77 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.09 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.46 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.15 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.71 out of 29.38

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_586457_586582 - Class II

Cleavage pHMM score: -0.60

RODEO score: 0

Monoisotopic mass: 3081.6 Da

Molecular weight: 3083.6 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3101.6 Da N = 1; 3119.6 Da N = 2; 3137.6 Da N = 3

allorf_592881_593102 - Class II

Cleavage pHMM score: -5.20

RODEO score: 0

Monoisotopic mass: 1652.8 Da

Molecular weight: 1653.9 Da

Number of bridges: 2

allorf_592920_593096 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 1988.9 Da

Molecular weight: 1990.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2008.3 Da N = 1

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CDME01000015.1 - Region 1 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 69,612 - 91,659 nt. (total: 22,048 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: dehalogenase

BN1199_RS42745: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001100.5	0.37	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0002667.2	0.37	ribosomal	estericin A	Clostridium estertheticum
BGC0002387.2	0.35	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002007.2	0.35	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000841.5	0.34	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000583.5	0.34	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001760.5	0.32	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0000595.3	0.32	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000544.4	0.31	ribosomal	planosporicin	Planomonospora alba
BGC0001801.5	0.31	NRPS	thiazostatin, watasemycin A, watasemycin B, 2-hydroxyphenylthiazoline enantiopyochelin, isopyochelin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001100.5	0.37	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0002667.2	0.37	ribosomal	estericin A	Clostridium estertheticum
BGC0002387.2	0.35	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002007.2	0.35	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000841.5	0.34	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000583.5	0.34	ribosomal	grisemycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001760.5	0.32	NRPS	rimosamide	Streptomyces rimosus subsp. rimosus ATCC 10970
BGC0000595.3	0.32	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000544.4	0.31	ribosomal	planosporicin	Planomonospora alba
BGC0001801.5	0.31	NRPS	thiazostatin, watasemycin A, watasemycin B, 2-hydroxyphenylthiazoline enantiopyochelin, isopyochelin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 22.38 out of 26.33

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.23 out of 27.04

Confidence: medium

Additional weak hits (4):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.21 out of 30.97

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.23 out of 20.01

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.24 out of 24.78

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 1 - 88; Score: 79.2

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor

NZ_CDME01000015.1 - Region 2 - melanin

Download region GenBank file

Download region SVG

Location: 216,018 - 226,368 nt. (total: 10,351 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

BN1199_RS43295: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000662.5	0.63	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.58	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000908.3	0.52	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.46	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.42	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.41	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001869.4	0.33	NRPS, other (phenazine)	griseoluteic acid, demethoxygriseoluteic acid, phenaszentine A, phenaszentine C, phenaszenketide C, phenaszenketide D	Xenorhabdus szentirmaii DSM 16338
BGC0001302.5	0.31	other (other)	lomofungin	Streptomyces lomondensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000662.5	0.63	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000912.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000911.3	0.59	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.58	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000908.3	0.52	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.46	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000889.5	0.42	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001592.5	0.41	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0001869.4	0.33	NRPS, other (phenazine)	griseoluteic acid, demethoxygriseoluteic acid, phenaszentine A, phenaszentine C, phenaszenketide C, phenaszenketide D	Xenorhabdus szentirmaii DSM 16338
BGC0001302.5	0.31	other (other)	lomofungin	Streptomyces lomondensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_CDME01000015.1 - Region 3 - CDPS

Download region GenBank file

Download region SVG

Location: 497,428 - 518,090 nt. (total: 20,663 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

BN1199_RS44450: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Isomerases: mutase

BN1199_RS44460: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.46	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0002103.2	0.42	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0001753.3	0.27	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0002448.2	0.25	NRPS	Q6402A	Streptomyces violaceusniger
BGC0001215.5	0.24	NRPS	conglobatin	Streptomyces conglobatus
BGC0000845.5	0.24	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0002460.3	0.23	other (other)	loonamycin A, loonamycin B, loonamycin C	Nocardiopsis flavescens
BGC0000993.4	0.22	NRPS, PKS	FR901228	Chromobacterium violaceum
BGC0000226.5	0.22	PKS	gilvocarcin V	Streptomyces griseoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.46	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0002103.2	0.42	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0001753.3	0.27	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0002448.2	0.25	NRPS	Q6402A	Streptomyces violaceusniger
BGC0001215.5	0.24	NRPS	conglobatin	Streptomyces conglobatus
BGC0000845.5	0.24	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0002460.3	0.23	other (other)	loonamycin A, loonamycin B, loonamycin C	Nocardiopsis flavescens
BGC0000993.4	0.22	NRPS, PKS	FR901228	Chromobacterium violaceum
BGC0000226.5	0.22	PKS	gilvocarcin V	Streptomyces griseoflavus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.95 out of 25.31

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.38 out of 27.04

Confidence: medium

Additional weak hits (3):

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.92 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.14 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
DasR	N-acetylglucosamine dependent repressor

NZ_CDME01000016.1 - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 502,872 - 556,965 nt. (total: 54,094 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

BN1199_RS49425: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

BN1199_RS49435: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

BN1199_RS49450: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase methyltransferase

BN1199_RS49495: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

BN1199_RS49540: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: decarboxylase dehydratase

BN1199_RS49395: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

BN1199_RS49525: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase synthase

BN1199_RS49455: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS49460: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

BN1199_RS49465: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS49470: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS49480: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

BN1199_RS49505: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

BN1199_RS49510: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

Additional weak hits (12):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.61 out of 26.85

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.16 out of 27.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.38 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.02 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.50 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.34 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.96 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.79 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 502871 - 556965:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 502871 - 546531:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 515159 - 556965:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

BN1199_RS49455: mal

PKS_AT (511..797): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 124.9
Methoxymalonyl-CoA: 72.3
inactive: 67.9
Methylmalonyl-CoA: 64.8
Propionyl-CoA: 45.9
Ethylmalonyl-CoA: 45.5
fatty_acid: 33.9
CHC-CoA: 28.8
2-Methylbutyryl-CoA: 24.9
Benzoyl-CoA: 19.1
trans-1,2-CPDA: 16.7
Isobutyryl-CoA: 16.1
Acetyl-CoA: 15.3
3-Methylbutyryl-CoA: 13.5

BN1199_RS49465: X

AMP-binding (10..403): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWQAFDIIYQETFVLTAGEVNQWGTTETHVATAH
Nearest Stachelhaus code(s):: Hpr DIQYIAQVVK (68% 8Å match); Pro DVQFIAQVVK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

BN1199_RS49470: X

AMP-binding (32..360): X

nrpys: Suc

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NRHLYALVAQAASLTVGGDYLTYGLSEAGRVSTL
Nearest Stachelhaus code(s):: Suc ALQSTGTPRK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

BN1199_RS49505: X

AMP-binding (23..398): X

nrpys: Gln, Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAEFFDASCEELSTVLGGEWNTYGPTETTVVACG
Nearest Stachelhaus code(s):: Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A