GCF_000758705.1 - 14 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP009287.1 (Paenibacillus graminis)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1	NRPS,transAT-PKS	765,586	830,083
Region 2	lassopeptide	1,017,842	1,041,738	High	paeninodin	ribosomal:unmodified
Region 3	proteusin	1,228,021	1,248,263
Region 4	NRPS,T1PKS,transAT-PKS	1,769,021	1,952,696	Low	zwittermicin A	NRPS:Type I+PKS
Region 5	NRPS,NRPS-like,T1PKS	2,149,447	2,206,015
Region 6	t3nrps-iterative	2,664,783	2,716,359	Low	bacillibactin/bacillibactin E/bacillibactin F	NRPS:Type I
Region 7	cyclic-lactone-autoinducer	3,035,492	3,056,156
Region 8	terpene-precursor	3,759,900	3,782,293
Region 9	cyclic-lactone-autoinducer	4,266,182	4,286,830
Region 10	ranthipeptide	4,547,291	4,568,838
Region 11	cyclic-lactone-autoinducer,terpene-precursor	4,796,976	4,832,511
Region 12	cyclic-lactone-autoinducer	5,294,105	5,314,772
Region 13	RRE-containing	5,609,140	5,630,567
Region 14	NRPS,transAT-PKS-like,NRPS-like	6,017,599	6,079,371

NZ_CP009287.1 - Region 1 - NRPS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 765,586 - 830,083 nt. (total: 64,498 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acylase

PGRAT_RS03475: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: deacetylase esterase

PGRAT_RS03430: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

PGRAT_RS03455: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

PGRAT_RS03445: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

PGRAT_RS03470: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PGRAT_RS03480: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

PGRAT_RS03485: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS03495: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS03515: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.85	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.80	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.78	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.77	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.76	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.76	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.34 out of 26.85

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.08 out of 26.06

Confidence: medium

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 27.40 out of 32.93

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.67 out of 26.06

Confidence: medium

Additional weak hits (13):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.88 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.41 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 23.52 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.78 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.56 out of 31.73

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.73 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 21.54 out of 30.11

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.31 out of 29.25

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.30 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.11 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.12 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.58 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 765585 - 830083:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly) + (ccmal) + (ccmal) + (mal - Ser - Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PGRAT_RS03470: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (458..854): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDIFVLELQIMIGGEYNMYGPTETTVWSTV
Nearest Stachelhaus code(s):: Gly DILQMGMVWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

PGRAT_RS03475: mal

PKS_AT (6..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 101.3
Methylmalonyl-CoA: 48.2
Methoxymalonyl-CoA: 47.4
inactive: 28.8
Propionyl-CoA: 27.6
2-Methylbutyryl-CoA: 20.6
Ethylmalonyl-CoA: 19.2
CHC-CoA: 17.3
fatty_acid: 12.6
Isobutyryl-CoA: 11.3
trans-1,2-CPDA: 9.9
Benzoyl-CoA: 8.7
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PGRAT_RS03495: Ser - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (1200..1604): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWECHFFASGEHNLYGPTETTVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2273..2677): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFASGEHNLYGPTEATVDVTY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes
RicR	Copper-responsive regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP009287.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1,017,842 - 1,041,738 nt. (total: 23,897 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

PGRAT_RS04385: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: cyclase

PGRAT_RS04345: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.81	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0002150.2	0.56	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.56	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002312.2	0.52	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001645.3	0.51	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0002656.2	0.51	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002487.3	0.49	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002567.2	0.47	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000513.3	0.46	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001356.4	0.81	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0002150.2	0.56	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.56	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0002312.2	0.52	ribosomal	ubonodin	Burkholderia ubonensis
BGC0001645.3	0.51	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0002656.2	0.51	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002487.3	0.49	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002567.2	0.47	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000513.3	0.46	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for PGRAT_RS32995

PGRAT_RS32995

Leader:

MKKEYSKPALEVLDVKMTMA

Full core:

GPGVAIVDAFQDDPDEVQHYS

Putative macrolactam:

GPGVAIVD

antiSMASH-DB 4.0 matches for PGRAT_RS32995

100.0%

NZ_CP009287.1and 3 others:

NZ_CP048429.1 Lassopeptides: GT351_RS12895_lassopeptideNZ_CP068595.1 Lassopeptides: JI735_RS13065_lassopeptideNZ_LN831776.1 Lassopeptides: PRIO_RS35380_lassopeptide

Lassopeptides: PGRAT_RS32995_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPGVAIVDAFQDDPDEVQHYS

1

GPGVAIVDAFQDDPDEVQHYS

21

85.7%

NZ_KB910518.1:

Lassopeptides: B212_RS34705_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG+AIVD+FQDDPDE+QHYS

1

GPGIAIVDSFQDDPDEIQHYS

21

76.2%

NZ_CAKMMG010000012.1and 1 other:

NZ_CP070969.1 Lassopeptides: JRJ22_RS03140_lassopeptide

Lassopeptides: L6H70_RS25720_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG+AI D+FQDDPDE+ HYS

1

GPGIAIADSFQDDPDEIVHYS

21

with 57 more sequence matches

Only the first 10 are displayed here.

71.4%

NZ_CP026029.1:

Lassopeptides: C2I18_RS15915_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG AI D+FQ+DPDE HYS

1

GPGFAIADSFQNDPDETVHYS

21

71.4%

NZ_FOIK01000007.1:

Lassopeptides: BMW84_RS24570_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG+AI D+FQDDPDE H+S

1

GPGLAIADSFQDDPDEHVHHS

21

71.4%

NZ_LN831205.1:

Lassopeptides: AQR02_RS32175_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG++I D+FQDDPDE+ HYS

1

GPGISIADSFQDDPDEIVHYS

21

66.7%

NC_017138.1and 11 others:

NZ_CP018874.1 Lassopeptides: BUW91_RS28875_lassopeptideNZ_CP028084.1 Lassopeptides: C1N54_RS05380_lassopeptideNZ_JANIOE010000001.1 Lassopeptides: NQ109_RS19625_lassopeptideNZ_NGUL01000003.1 Lassopeptides: CBE78_RS15420_lassopeptideNZ_NTZG01000008.1 Lassopeptides: CN510_RS30020_lassopeptideNZ_NUEC01000009.1 Lassopeptides: CN635_RS27505_lassopeptideNZ_NUOI01000031.1 Lassopeptides: COE08_RS30705_lassopeptideNZ_NVEG01000005.1 Lassopeptides: COL08_RS29985_lassopeptideNZ_NVEV01000001.1 Lassopeptides: COL23_RS28065_lassopeptideNZ_VDTN01000001.1 Lassopeptides: FS483_RS07665_lassopeptideNZ_VEEA01000001.1 Lassopeptides: FS744_RS11845_lassopeptide

Lassopeptides: BMWSH_RS26600_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG +I DA Q DPDE HYS

1

GPGTSIPDAVQPDPDETVHYS

21

66.7%

NZ_CP009241.1:

Lassopeptides: H70357_RS35650_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG + D+FQDDPDE+ HYS

1

GPGFKLADSFQDDPDEIVHYS

21

66.7%

NZ_CP009283.1and 3 others:

NZ_CP009284.1 Lassopeptides: R70331_RS31400_lassopeptideNZ_CP009285.1 Lassopeptides: PBOR_RS36815_lassopeptideNZ_FNDX01000027.1 Lassopeptides: BLR64_RS30065_lassopeptide

Lassopeptides: R70723_RS33225_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG+AI D+FQ DPDE+ H+S

1

GPGLAIADSFQSDPDEIVHHS

21

66.7%

NZ_CP059724.1:

Lassopeptides: H1230_RS28650_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG I D+FQ DP EV HYS

1

GPGERIADSFQADPTEVVHYS

21

66.7%

NZ_CP083269.1:

Lassopeptides: K8Z47_RS05490_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG I DA Q DPDE HYS

1

GPGFTIPDAVQPDPDETIHYS

21

66.7%

NZ_NUPF01000007.1:

Lassopeptides: COE35_RS26755_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG++I DA Q DPDE HYS

1

GPGLSIPDAVQSDPDETVHYS

21

66.7%

NZ_QQAY01000002.1:

Lassopeptides: DFR59_RS05045_lassopeptide

1

GPGVAIVDAFQDDPDEVQHYS

21

GPG A DA QDD DE HYS

1

GPGKATPDAVQDDVDETVHYS

21

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.63 out of 32.93

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.99 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.52 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.92 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.44 out of 29.25

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

PGRAT_RS32995 - Class II: Cleavage pHMM score: -12.40; RODEO score: 16; Monoisotopic mass: 2240.0 Da; Molecular weight: 2241.3 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 15 - 95; Score: 81.8

TFBS definitions

Regulator	Description
LexA variant 3	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C

NZ_CP009287.1 - Region 3 - proteusin

Download region GenBank file

Download region SVG

Location: 1,228,021 - 1,248,263 nt. (total: 20,243 nt) Show pHMM detection rules used

proteusin: (PoyD or TIGR03793)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

PGRAT_RS05275: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000516.4	0.37	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0001787.3	0.37	ribosomal	suicin 3908	Streptococcus suis
BGC0000561.5	0.37	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000498.5	0.36	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000903.3	0.36	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000313.4	0.35	NRPS	beauvericin	Beauveria bassiana
BGC0001810.3	0.33	PKS	trehangelin	Polymorphospora rubra
BGC0002122.2	0.27	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0000080.5	0.27	PKS	jerangolid A, jerangolid D	Sorangium cellulosum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000516.4	0.37	ribosomal	geobacillin II	Geobacillus thermodenitrificans
BGC0001787.3	0.37	ribosomal	suicin 3908	Streptococcus suis
BGC0000561.5	0.37	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000498.5	0.36	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000903.3	0.36	other (other)	fluorometabolite	Streptomyces cattleya
BGC0002316.2	0.36	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000313.4	0.35	NRPS	beauvericin	Beauveria bassiana
BGC0001810.3	0.33	PKS	trehangelin	Polymorphospora rubra
BGC0002122.2	0.27	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0000080.5	0.27	PKS	jerangolid A, jerangolid D	Sorangium cellulosum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.11 out of 20.97

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.60 out of 24.78

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.58 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (5):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.94 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.67 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.00 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.72 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.62 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP009287.1 - Region 4 - NRPS,T1PKS,transAT-PKS

Download region GenBank file

Download region SVG

Location: 1,769,021 - 1,952,696 nt. (total: 183,676 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

PGRAT_RS07695: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

PGRAT_RS07715: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

PGRAT_RS07855: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: PPTase acetyltransferase acylase aminotransferase

PGRAT_RS07820: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

PGRAT_RS07865: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

PGRAT_RS07880: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

PGRAT_RS07885: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: esterase glucosidase hydrolase phosphatase

PGRAT_RS07640: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

PGRAT_RS07690: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

PGRAT_RS07700: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

PGRAT_RS07795: thioesterase

smcogs: SMCOG1004: thioesterase

PGRAT_RS07805: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: ligase synthase

PGRAT_RS07685: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PGRAT_RS07720: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07725: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07740: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07745: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PGRAT_RS07750: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07760: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07765: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07770: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

PGRAT_RS07800: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07815: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

PGRAT_RS07830: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07835: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07840: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07845: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS07870: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

PGRAT_RS07875: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PGRAT_RS31510: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS31515: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transporter

PGRAT_RS07630: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

PGRAT_RS07935: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	1.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	1.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	1.56	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	1.56	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.54	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.52	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	1.49	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	1.46	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.73	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.72	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.09 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.79 out of 20.97

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.98 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.54 out of 27.78

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.58 out of 20.97

Confidence: medium

Additional weak hits (11):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.08 out of 30.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.90 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.19 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.04 out of 29.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.07 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.42 out of 28.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.17 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.51 out of 30.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.91 out of 29.51

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.01 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 1769020 - 1952696:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asn) + (Gly - mal - Ser - Ser) + (ohmal) + (Thr) + (Gly - Cys) + (ohmal) + (ccmal - Gly) + (pk) + (X) + (ohmal - Gly) + (ccmal) + (ccmal) + (ccmal - Gly) + (ccmal) + (ccmal) + (Ser) + (X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PGRAT_RS07685: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (462..856): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTITSTKLIVGGEINEYGPTETVVGCMI
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

PGRAT_RS07720: Gly - mal - Ser - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (467..873): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGMTFDIFVLELQALIGGEYNVYGPTETTVWSTV
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (1600..1894): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; 2-Rhyd-Malonyl-CoA: 62.5%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 115.5
inactive: 76.1
Methoxymalonyl-CoA: 51.5
Methylmalonyl-CoA: 29.6
Propionyl-CoA: 26.7
Isobutyryl-CoA: 21.4
2-Methylbutyryl-CoA: 14.1
Ethylmalonyl-CoA: 8.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

AMP-binding (2528..2924): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFICSGEHNLYGPTEASIDVSS
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3568..3964): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFICSGEHNLYGPTEASIDVSS
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

PGRAT_RS07725: mal

PKS_AT (535..826): mal

ATSignature: 2-Rhyd-Malonyl-CoA

Top 3 matches:: 2-Rhyd-Malonyl-CoA: 58.3%; Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 84.4
Methoxymalonyl-CoA: 56.0
Methylmalonyl-CoA: 44.5
inactive: 34.0
Propionyl-CoA: 22.4
Isobutyryl-CoA: 21.2
Benzoyl-CoA: 15.4
CHC-CoA: 11.1
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PGRAT_RS07745: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (269..672): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LHEHFDFSVWEGNQILGGEINMYGITETTVHTTF
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

PGRAT_RS07750: Gly - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (1847..2240): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIFWLELQTLVGGEFNLYGPTETTVWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2902..3286): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSLLSGDISCGGATEASIWSIY
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (97% 8Å match)
Stachelhaus code match:: 90% (moderate)

PGRAT_RS07765: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (1701..2123): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWSTFDISVFEAHSMLGGERNMYGPTEATIWISS
Nearest Stachelhaus code(s):: Gly DIFHMGMIWK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

PGRAT_RS07770: pk

PKS_AT (533..728): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 13.2
Malonyl-CoA: 8.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PGRAT_RS07800: X

AMP-binding (2185..2591): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YQFTHAIGILDAHSLLGGEVNFLGCSELMVISFY
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

PGRAT_RS07815: mal - Gly

Search NORINE for peptide: strict or relaxed

PKS_AT (531..820): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 57.9
Methoxymalonyl-CoA: 34.8
inactive: 27.6
Methylmalonyl-CoA: 17.7
Propionyl-CoA: 8.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

AMP-binding (1969..2362): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIFGLELQALCGGEWNMYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

PGRAT_RS07820: mal

PKS_AT (6..291): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 115.1
inactive: 45.4
Methoxymalonyl-CoA: 39.1
Methylmalonyl-CoA: 26.9
Benzoyl-CoA: 17.7
Propionyl-CoA: 15.6
2-Methylbutyryl-CoA: 15.1
trans-1,2-CPDA: 13.7
CHC-CoA: 12.9
Isobutyryl-CoA: 10.2
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PGRAT_RS07835: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (2011..2433): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWSTFDISVFEGHSAIGGEYNLYGPTEATIWATC
Nearest Stachelhaus code(s):: Gly DIFHMGMIWK (76% 8Å match); Thr DMFCAGLIWK (53% 8Å match)
Stachelhaus code match:: 80% (moderate)

PGRAT_RS07870: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (551..961): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEGHFFVSGEINLYGPTEATVEVSW
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

PGRAT_RS07875: X - X

AMP-binding (284..690): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWYAFDLAQKNANCFLGGEVNTYGPTECTDIASY
Nearest Stachelhaus code(s):: Hse DLKNVGSDVK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1352..1754): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWYAFDLAQKNANCFLGGEVNTYGPTECTDIASY
Nearest Stachelhaus code(s):: Hse DLKNVGSDVK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

NZ_CP009287.1 - Region 5 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 2,149,447 - 2,206,015 nt. (total: 56,569 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: amidase

PGRAT_RS08825: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase

PGRAT_RS08850: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PGRAT_RS08860: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.96	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.96	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001254.3	0.91	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.90	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.86	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001268.4	0.86	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.85	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.85	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.79	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.79	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0002191.2	0.62	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001268.4	0.62	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.71 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.93 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.44 out of 28.19

Confidence: medium

Additional weak hits (14):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.58 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.27 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.90 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.77 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.06 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.58 out of 21.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.24 out of 36.53

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.21 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.77 out of 32.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.29 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.04 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 21.44 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.81 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.89 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 2149446 - 2206015:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 2149446 - 2195599:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - ohmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 2156796 - 2206015:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PGRAT_RS08850: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (808..1231): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWHTFDISVWEWHFIFSGEANLYGPTEASIDVTY
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

PGRAT_RS08860: fatty_acid - mal

CAL_domain (64..498): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 77.8
NH2: 51.2
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1281..1574): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 159.5
inactive: 98.6
Methylmalonyl-CoA: 60.9
Methoxymalonyl-CoA: 59.4
Isobutyryl-CoA: 56.7
Propionyl-CoA: 48.6
2-Methylbutyryl-CoA: 32.3
Ethylmalonyl-CoA: 32.0
Benzoyl-CoA: 25.4
Acetyl-CoA: 22.8
CHC-CoA: 13.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
fatty_acid: -1.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis
ZuR variant 1	Zinc-responsive repressor

NZ_CP009287.1 - Region 6 - t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 2,664,783 - 2,716,359 nt. (total: 51,577 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

PGRAT_RS10900: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase methyltransferase

PGRAT_RS10785: aminotransferase

smcogs: SMCOG1019: aminotransferase

PGRAT_RS10875: aminotransferase

smcogs: SMCOG1019: aminotransferase

PGRAT_RS10905: methyltransferase

smcogs: SMCOG1089: methyltransferase

PGRAT_RS10960: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: decarboxylase

PGRAT_RS10850: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

PGRAT_RS10865: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: ligase

PGRAT_RS10890: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0000410.5	0.50	NRPS	pseudomonine	Pseudomonas fluorescens
BGC0000947.5	0.49	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000943.5	0.47	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000755.3	0.46	saccharide	capsular polysaccharide	Avibacterium paragallinarum 221
BGC0000757.3	0.46	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000754.3	0.46	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0001488.3	0.46	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002674.2	0.46	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0002695.2	0.46	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000820.5	0.50	other (other)	physostigmine	Streptomyces griseofuscus
BGC0000410.5	0.50	NRPS	pseudomonine	Pseudomonas fluorescens
BGC0000947.5	0.49	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0000943.5	0.47	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0000755.3	0.46	saccharide	capsular polysaccharide	Avibacterium paragallinarum 221
BGC0000757.3	0.46	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0000754.3	0.46	saccharide	capsular polysaccharide	Avibacterium paragallinarum
BGC0001488.3	0.46	other (other)	4-formylaminooxyvinylglycine	Pseudomonas fluorescens WH6
BGC0002674.2	0.46	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0002695.2	0.46	NRPS	bacillibactin, bacillibactin E, bacillibactin F	Bacillus sp. WMMC1349

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.71 out of 20.47

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.06 out of 20.97

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.20 out of 27.78

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.27 out of 27.04

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 28.83 out of 32.74

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.40 out of 29.38

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.98 out of 27.55

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.04 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.66 out of 24.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.86 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.38 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.80 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.33 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.03 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.45 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.74 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.45 out of 26.06

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.75 out of 27.18

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

PGRAT_RS10890: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (27..404): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: CSVKHSSGMNEAFTHFYGAIYGYGISEAASRVTY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
DasR	N-acetylglucosamine dependent repressor
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_CP009287.1 - Region 7 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 3,035,492 - 3,056,156 nt. (total: 20,665 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.43	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000571.3	0.42	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002579.2	0.39	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000351.5	0.37	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002575.2	0.36	ribosomal	cochonodin I	Streptococcus suis
BGC0000546.3	0.35	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001863.4	0.34	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000527.5	0.34	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.5	0.43	ribosomal	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000571.3	0.42	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002579.2	0.39	ribosomal	carnobacteriocin XY	Carnobacterium maltaromaticum
BGC0000351.5	0.37	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0002575.2	0.36	ribosomal	cochonodin I	Streptococcus suis
BGC0000546.3	0.35	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001863.4	0.34	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000527.5	0.34	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.54 out of 23.79

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.99 out of 29.38

Confidence: medium

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 24.68 out of 28.14

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.16 out of 28.19

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 23.04 out of 24.78

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.98 out of 24.78

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.39 out of 24.78

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.14 out of 18.16

Confidence: strong

Additional weak hits (5):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.70 out of 32.74

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.87 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.01 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.00 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.09 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
FuR variant 1	Ferric Uptake Regulator
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
PerR	Peroxide regulator
ZuR variant 1	Zinc-responsive repressor

NZ_CP009287.1 - Region 8 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 3,759,900 - 3,782,293 nt. (total: 22,394 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

PGRAT_RS15710: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: aminotransferase

PGRAT_RS15755: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Ligases: synthetase

PGRAT_RS15735: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.41	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002487.3	0.40	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002656.2	0.39	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002657.2	0.38	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000410.5	0.36	NRPS	pseudomonine	Pseudomonas fluorescens
BGC0002712.2	0.35	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis
BGC0002476.2	0.34	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002488.3	0.34	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002804.2	0.34	other (other)	protegencin	Pseudomonas protegens CHA0

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.41	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002699.2	0.40	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002487.3	0.40	other (other)	staphylopine	Staphylococcus aureus subsp. aureus Mu50
BGC0002656.2	0.39	PKS	oryzanaphthopyran A, oryzanaphthopyran B, oryzanaphthopyran C, oryzanthrone A, oryzanthrone B, chlororyzanthrone A, chlororyzanthrone B	Streptacidiphilus oryzae TH49
BGC0002657.2	0.38	NRPS, PKS	deoxyhangtaimycin	Streptomyces spectabilis
BGC0000410.5	0.36	NRPS	pseudomonine	Pseudomonas fluorescens
BGC0002712.2	0.35	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis
BGC0002476.2	0.34	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002488.3	0.34	other (other)	bacillopaline	Paenibacillus mucilaginosus KNP414
BGC0002804.2	0.34	other (other)	protegencin	Pseudomonas protegens CHA0

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

PGRAT_RS15735: PT_FPPS_like

Domain 1 (538 - 759): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.81 out of 29.38

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.54 out of 26.06

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

Additional weak hits (5):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.03 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.23 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.10 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.69 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.74 out of 26.06

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
FuR variant 1	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes

NZ_CP009287.1 - Region 9 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 4,266,182 - 4,286,830 nt. (total: 20,649 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

No matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.52 out of 23.79

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.38 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.04 out of 26.06

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.85 out of 24.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.76 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.18 out of 28.19

Confidence: medium

Additional weak hits (7):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.40 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.67 out of 28.14

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.53 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.03 out of 30.25

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.85 out of 32.93

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.63 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_CP009287.1 - Region 10 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 4,547,291 - 4,568,838 nt. (total: 21,548 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or (YcaO or TIGR03604))))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.50	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002116.3	0.44	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000600.3	0.42	ribosomal	thurincin H	Bacillus thuringiensis
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000486.4	0.41	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000584.5	0.41	ribosomal	colicin V	Escherichia coli
BGC0000626.3	0.40	ribosomal	thuricin	Bacillus thuringiensis
BGC0002700.2	0.40	ribosomal	bacinapeptin	Bacillus nakamurai

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.50	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002116.3	0.44	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000600.3	0.42	ribosomal	thurincin H	Bacillus thuringiensis
BGC0001555.4	0.41	ribosomal	colicin V	Escherichia coli chi7122
BGC0000486.4	0.41	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001210.5	0.41	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000584.5	0.41	ribosomal	colicin V	Escherichia coli
BGC0000626.3	0.40	ribosomal	thuricin	Bacillus thuringiensis
BGC0002700.2	0.40	ribosomal	bacinapeptin	Bacillus nakamurai

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.99 out of 29.38

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.31 out of 26.06

Confidence: medium

Additional weak hits (2):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.91 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.41 out of 28.14

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Other_Sactipeptide_rSAM_RRE; Location: 4 - 141; Score: 30.2

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NZ_CP009287.1 - Region 11 - cyclic-lactone-autoinducer,terpene-precursor

Download region GenBank file

Download region SVG

Location: 4,796,976 - 4,832,511 nt. (total: 35,536 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

PGRAT_RS20615: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Transferases: carboxylase

PGRAT_RS20775: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Ligases: synthase synthetase

PGRAT_RS20730: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

PGRAT_RS20735: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.3	0.18	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001361.3	0.18	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.18	terpene	sodorifen	Serratia plymuthica
BGC0002397.2	0.16	terpene	astallatene	Arabidopsis thaliana
BGC0000584.5	0.16	ribosomal	colicin V	Escherichia coli
BGC0000668.5	0.16	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0002400.2	0.14	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002306.2	0.14	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002151.2	0.13	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.13	ribosomal	triculamin	Streptomyces triculaminicus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.54	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.50	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001361.3	0.49	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002283.2	0.49	terpene	sodorifen	Serratia plymuthica
BGC0000584.5	0.46	ribosomal	colicin V	Escherichia coli
BGC0002398.2	0.44	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001843.2	0.43	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000449.5	0.42	NRPS	tridecaptin	Paenibacillus terrae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

PGRAT_RS20735: PT_FPPS_like

Domain 1 (50 - 315): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 24.06 out of 27.78

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.38 out of 20.97

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.95 out of 26.06

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.79 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.76 out of 28.19

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.19 out of 32.93

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.42 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.45 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.13 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.24 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 24.78 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.87 out of 33.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.78 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.97 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_CP009287.1 - Region 12 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 5,294,105 - 5,314,772 nt. (total: 20,668 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

No matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.18 out of 23.79

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 23.43 out of 27.78

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.69 out of 23.79

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.54 out of 26.06

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.85 out of 24.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.76 out of 24.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.18 out of 28.19

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.41 out of 32.93

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.94 out of 25.31

Confidence: medium

Additional weak hits (2):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 25.17 out of 33.73

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.13 out of 25.88

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor

NZ_CP009287.1 - Region 13 - RRE-containing

Download region GenBank file

Download region SVG

Location: 5,609,140 - 5,630,567 nt. (total: 21,428 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

PGRAT_RS31850: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.46	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000500.5	0.43	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000802.5	0.40	saccharide	succinoglycan	Sinorhizobium meliloti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002306.2	0.46	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000500.5	0.43	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000623.3	0.42	ribosomal	plantaricin W α, plantaricin W β	Lactobacillus plantarum
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.40	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0002698.2	0.40	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000802.5	0.40	saccharide	succinoglycan	Sinorhizobium meliloti

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.16 out of 26.85

Confidence: medium

Additional weak hits (4):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.59 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 20.77 out of 28.14

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.44 out of 20.47

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.68 out of 28.14

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Other_Sactipeptide_rSAM_RRE; Location: 2 - 121; Score: 59.3

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP009287.1 - Region 14 - NRPS,NRPS-like,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 6,017,599 - 6,079,371 nt. (total: 61,773 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

PGRAT_RS26130: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

PGRAT_RS31930: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

PGRAT_RS31935: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: ligase synthase

PGRAT_RS26145: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

PGRAT_RS26150: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

PGRAT_RS26155: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

PGRAT_RS26175: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.32	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	1.14	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	1.13	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	1.10	NRPS	AM-toxin	Alternaria alternata
BGC0001133.4	1.09	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	1.07	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	1.05	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	1.04	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	1.03	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	1.03	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.75 out of 27.55

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.70 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.49 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.88 out of 20.97

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.76 out of 32.93

Confidence: medium

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.90 out of 32.93

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.21 out of 26.06

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.13 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.73 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.65 out of 28.19

Confidence: medium

Additional weak hits (19):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 20.68 out of 26.12

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.05 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.91 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.58 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.83 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.04 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.61 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.03 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.03 out of 30.22

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.02 out of 28.14

Confidence: weak

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.22 out of 20.47

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 23.01 out of 28.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.88 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.58 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.77 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 18, location 6017598 - 6079371:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid) + (mal - D-Asn - Tyr) + (Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 19, location 6017598 - 6076725:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid) + (mal - D-Asn - Tyr) + (Pro)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 20, location 6036752 - 6079371:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid) + (mal - D-Asn - Tyr) + (Pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

PGRAT_RS26145: Tyr - Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (276..673): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: TWRFFDGFLTSTIATLAGEVNEYGPTESSVLATL
Nearest Stachelhaus code(s):: Tyr DGTITAEVAK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1314..1704): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LSNSFDVSLMDMILITIGSINAYGPTETTVYSSV
Nearest Stachelhaus code(s):: Trp or Pro DVMFIGAVNK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

PGRAT_RS26150: Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (2509..2903): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWGSFDLSVTLIMLIIGGEYNVYGPTETTVACTF
Nearest Stachelhaus code(s):: Asn DLTKIGEVGK (68% 8Å match); OH-Asp or OMe-Asp DLTKIGAVNK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

PGRAT_RS26155: fatty_acid

CAL_domain (32..477): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 206.2
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
IolR	Regulator of the inositol catabolism
LexA variant 3	Repressor of DNA damage response
MogR	Repressor of flagellar motility genes
ZuR variant 1	Zinc-responsive repressor