GCF_000709915.1 - 21 region(s)

Download region SVG

Location: 17,695 - 40,131 nt. (total: 22,437 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

DJ64_RS00130: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.53	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0001696.5	0.40	ribosomal	neothioviridamide	Streptomyces sp.
BGC0000625.5	0.40	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002560.3	0.39	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0000483.5	0.38	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002120.3	0.35	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001802.5	0.35	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0002425.3	0.33	ribosomal	stlassin	Streptomyces sp.
BGC0002669.2	0.32	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001474.4	0.29	ribosomal	thiopeptin	Streptomyces tateyamensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.53	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0001696.5	0.40	ribosomal	neothioviridamide	Streptomyces sp.
BGC0000625.5	0.40	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0002560.3	0.39	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0000483.5	0.38	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002120.3	0.35	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001802.5	0.35	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0002425.3	0.33	ribosomal	stlassin	Streptomyces sp.
BGC0002669.2	0.32	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0001474.4	0.29	ribosomal	thiopeptin	Streptomyces tateyamensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.97 out of 30.22

Confidence: medium

Additional weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.29 out of 27.55

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.80 out of 29.38

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ClgR	Caseinolytic protease gene regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_KL503830.1 - Region 2 - NRPS,T1PKS

Download region SVG

Location: 86,387 - 138,903 nt. (total: 52,517 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DJ64_RS00435: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DJ64_RS00455: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DJ64_RS00510: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

DJ64_RS00555: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

DJ64_RS00560: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: PPTase aminotransferase

DJ64_RS00425: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

DJ64_RS00440: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

DJ64_RS37355: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Ligases: ligase synthase

DJ64_RS00490: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DJ64_RS00515: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DJ64_RS00520: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DJ64_RS00525: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001455.6	1.19	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0000958.5	1.11	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001216.5	1.02	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001455.6	0.84	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0000958.5	0.82	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001216.5	0.79	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.36 out of 20.97

Confidence: medium

Additional weak hits (7):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.65 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.76 out of 30.25

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.89 out of 32.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.31 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 86386 - 138903:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - fatty_acid) + (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

DJ64_RS00490: X

AMP-binding (7..402): X

nrpys: Ant

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IGWCHGSMVVSTWLLYGAARQVYGMTEVGGFVTL
Nearest Stachelhaus code(s):: Ant GSVWLGVGFK (100% 8Å match); Pyv or Ant GSVWLGVGFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

DJ64_RS00515: mal

PKS_AT (563..846): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 112.4
Methoxymalonyl-CoA: 58.3
inactive: 53.8
Methylmalonyl-CoA: 39.1
Ethylmalonyl-CoA: 25.3
Isobutyryl-CoA: 18.2
Propionyl-CoA: 17.3
Benzoyl-CoA: 14.9
fatty_acid: 11.1
2-Methylbutyryl-CoA: 5.8
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

DJ64_RS00520: Thr - fatty_acid

Search NORINE for peptide: strict or relaxed

AMP-binding (461..874): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFSVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CAL_domain (1706..2115): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 15.6
AHBA: 2.7
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: -3.1

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
VqsM	Regulator of quorum-sensing signalling systems

NZ_KL503830.1 - Region 3 - RiPP-like

Download region SVG

Location: 223,688 - 235,067 nt. (total: 11,380 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.73	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.41	ribosomal	microcin N	Escherichia coli
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002073.3	0.40	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.73	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.41	ribosomal	microcin N	Escherichia coli
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0002073.3	0.40	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.17 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.45 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KL503830.1 - Region 4 - lanthipeptide-class-i

Download region SVG

Location: 321,805 - 346,333 nt. (total: 24,529 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DJ64_RS01305: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: deacetylase hydrolase

DJ64_RS01310: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

DJ64_RS01340: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase dehydratase

DJ64_RS01330: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

DJ64_RS01335: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.51	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.46	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000544.4	0.44	ribosomal	planosporicin	Planomonospora alba
BGC0000867.3	0.44	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000506.4	0.43	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.51	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000560.5	0.47	ribosomal	subtilomycin	Bacillus subtilis
BGC0002635.2	0.46	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000544.4	0.44	ribosomal	planosporicin	Planomonospora alba
BGC0000867.3	0.44	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000506.4	0.43	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for DJ64_RS01330

DJ64_RS34550

Leader:

MRTEIVLSQDAPELDLDLDLRVSDLPEQA

Core:

ESFGQGTYTSPSSYAIGTRCPVCC

Core with dehydrations:

EDhaFGQGDhbYDhbDhaPDhaDhaYAIGDhbRCysPVCysCys

antiSMASH-DB 4.0 matches for DJ64_RS34550

100.0%

NZ_CP043959.1and 5 others:

NZ_CP104864.1 Lanthipeptides: N7E53_RS01070_lanthipeptideNZ_JMLN01000003.1 Lanthipeptides: BR33_RS35695_lanthipeptideNZ_KL503830.1 Lanthipeptides: DJ64_RS34550_lanthipeptideNZ_VIUV01000001.1 Lanthipeptides: FB570_RS00565_lanthipeptideNZ_WUUF01000042.1 Lanthipeptides: GSE51_RS09870_lanthipeptide

Lanthipeptides: F3L20_RS18420_lanthipeptide

1

ESFGQGTYTSPSSYAIGTRCPVCC

24

ESFGQGTYTSPSSYAIGTRCPVCC

1

ESFGQGTYTSPSSYAIGTRCPVCC

24

95.8%

NZ_CP054939.1and 2 others:

NZ_FKJH01000076.1 Lanthipeptides: STEPF7_RS31605_lanthipeptideNZ_GG657758.1 Lanthipeptides: SSRG_RS36710_lanthipeptide

Lanthipeptides: HUT14_RS33610_lanthipeptide

1

ESFGQGTYTSPSSYAIGTRCPVCC

24

ESFGQGTYTSPSSYAIGTRCP+CC

1

ESFGQGTYTSPSSYAIGTRCPICC

24

91.7%

NZ_BMUN01000001.1and 8 others:

NZ_CP012382.1 Lanthipeptides: SAM23877_RS36835_lanthipeptideNZ_CP012949.1 Lanthipeptides: SAM40697_RS33360_lanthipeptideNZ_CP027299.1 Lanthipeptides: C1N79_RS34825_lanthipeptideNZ_CP039123.1 Lanthipeptides: E5N77_RS35110_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33410_lanthipeptideNZ_CP104697.1 Lanthipeptides: N6Q81_RS33410_lanthipeptideNZ_JACWAA010000001.1 Lanthipeptides: ICA23_RS00945_lanthipeptideNZ_MQUH01000030.1 Lanthipeptides: BSZ07_RS37165_lanthipeptide

Lanthipeptides: IE238_RS00870_lanthipeptide

1

ESFGQGTYTSPSSYAIGTRCPVCC

24

ESFGQGT+TSPSSYAIGTRCP+CC

1

ESFGQGTFTSPSSYAIGTRCPICC

24

with 17 more sequence matches

Only the first 10 are displayed here.

87.5%

NZ_CP058273.1:

Lanthipeptides: AY578_RS00390_lanthipeptide

4

GQGTYTSPSSYAIGTRCPVCC

24

GQGTYTSPSSYAIGTRCPVCC

1

GQGTYTSPSSYAIGTRCPVCC

21

87.5%

NZ_KB891308.1and 2 others:

NZ_KZ819159.1 Lanthipeptides: DBP19_RS30055_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS32200_lanthipeptide

Lanthipeptides: B061_RS37915_lanthipeptide

3

FGQGTYTSPSSYAIGTRCPVCC

24

FG GTYTSPSSYAIGTRCPVCC

2

FGAGTYTSPSSYAIGTRCPVCC

23

87.5%

NZ_KZ195574.1:

Lanthipeptides: B9W62_RS39030_lanthipeptide

2

SFGQGTYTSPSSYAIGTRCPVCC

24

SFGQGT+TSPSSYAIGTRCP+CC

1

SFGQGTFTSPSSYAIGTRCPICC

23

83.3%

NZ_BMVQ01000001.1and 4 others:

NZ_BMWI01000001.1 Lanthipeptides: IE253_RS05465_lanthipeptideNZ_CP042324.1 Lanthipeptides: FQ762_RS01285_lanthipeptideNZ_GG657756.1 Lanthipeptides: SSPG_RS36720_lanthipeptideNZ_LT629768.1 Lanthipeptides: BLU60_RS01655_lanthipeptide

Lanthipeptides: IE283_RS00890_lanthipeptide

2

SFGQGTYTSPSSYAIGTRCPVCC

24

SFG+GT+TSPSSYAIGTRCP+CC

2

SFGEGTFTSPSSYAIGTRCPICC

24

79.2%

NZ_BEWD01000004.1:

Lanthipeptides: Sru02f_RS16280_lanthipeptide

3

FGQGTYTSPSSYAIGTRCPVCC

24

FG+GT+TSPSSYAIGTRCP+CC

3

FGEGTFTSPSSYAIGTRCPICC

24

79.2%

NZ_CP113837.1and 1 other:

NZ_LISX01000001.1 Lanthipeptides: AMK19_RS02530_lanthipeptide

Lanthipeptides: OU787_RS28205_lanthipeptide

6

GTYTSPSSYAIGTRCPVCC

24

GTYTSPSSYAIGTRCPVCC

1

GTYTSPSSYAIGTRCPVCC

19

75.0%

NZ_NNBO01000011.1:

Lanthipeptides: CG736_RS24265_lanthipeptide

6

GTYTSPSSYAIGTRCPVCC

24

GT+TSPSSYAIGTRCPVCC

1

GTFTSPSSYAIGTRCPVCC

19

62.5%

NZ_KK853997.1:

Lanthipeptides: KCH_RS38645_lanthipeptide

9

TSPSSYAIGTRCPVCC

24

TSPSSYAIGTRCP+CC

1

TSPSSYAIGTRCPICC

16

62.5%

NZ_NNBP01000006.1:

Lanthipeptides: CG747_RS11965_lanthipeptide

9

TSPSSYAIGTRCPVCC

24

TSPSSYAIGTRCP CC

1

TSPSSYAIGTRCPTCC

16

50.0%

NZ_CP050693.1:

Lanthipeptides: HC362_RS33495_lanthipeptide

3

FGQGTYTSPSSYAIGTRCPVCC

24

F G YTSPS+Y G+ C +CC

1

FASGGYTSPSTY--GSPCNLCC

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

DJ64_RS34550 - Class I

Cleavage pHMM score: -8.70

RODEO score: 18

Monoisotopic mass: 2387.1 Da

Molecular weight: 2388.6 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2406.6 Da N = 1; 2424.7 Da N = 2; 2442.7 Da N = 3; 2460.7 Da N = 4

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 158 - 241; Score: 55.6

TFBS definitions

Regulator	Description

NZ_KL503830.1 - Region 5 - T3PKS,terpene-precursor

Download region SVG

Location: 377,176 - 422,885 nt. (total: 45,710 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

DJ64_RS01585: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

DJ64_RS01675: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

DJ64_RS01720: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

DJ64_RS01680: Methylation

MITE: MITE0000155Methylation (identity: 70.10%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Hydrolases: deacetylase hydrolase

DJ64_RS01640: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

DJ64_RS01665: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

DJ64_RS01730: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Ligases: synthase synthetase

DJ64_RS01615: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

DJ64_RS01685: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transporter

DJ64_RS01765: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.56	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000677.5	0.29	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001647.3	0.27	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001456.3	0.25	terpene	isorenieratene	Streptomyces argillaceus
BGC0001910.4	0.25	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.25	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.24	terpene	raimonol	Streptomyces anulatus
BGC0001227.3	0.24	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.24	terpene	carotenoid	Streptomyces avermitilis
BGC0002309.2	0.24	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.82	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001962.3	0.51	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0002332.2	0.50	PKS	4-hydroxy-6-pentadecylpyran-2-one, 4-hydroxy-6-(2-oxoheptadecyl)pyran-2-one, Adipostatin A	Candidatus Entotheonella sp.
BGC0001077.4	0.47	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0001964.2	0.47	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000252.5	0.44	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0002000.4	0.44	PKS	setomimycin	Streptomyces aurantiacus JA 4570

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.20 out of 30.22

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.01 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.14 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.85 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_KL503830.1 - Region 6 - terpene

Download region SVG

Location: 606,279 - 630,013 nt. (total: 23,735 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DJ64_RS02655: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

DJ64_RS02665: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

DJ64_RS02680: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DJ64_RS02690: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.62	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.61	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.60	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.60	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.58	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.47	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000645.3	0.46	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000650.3	0.45	terpene	carotenoid	Algoriphagus sp. KK10202C

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.62	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.61	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.60	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.60	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.58	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.47	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.47	terpene	β-carotein	uncultured bacterium
BGC0000645.3	0.46	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000640.3	0.46	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000650.3	0.45	terpene	carotenoid	Algoriphagus sp. KK10202C

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

DJ64_RS02660: Lycopene_cycl

Domain 1 (5 - 280): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

DJ64_RS02670: PT_phytoene_like

Domain 1 (16 - 313): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.71 out of 26.85

Confidence: medium

Additional weak hits (2):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.96 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KL503830.1 - Region 7 - T2PKS

Download region SVG

Location: 827,963 - 900,472 nt. (total: 72,510 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

DJ64_RS03670: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

DJ64_RS03800: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

DJ64_RS03880: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DJ64_RS03885: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DJ64_RS03895: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DJ64_RS03905: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

DJ64_RS03910: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

DJ64_RS03930: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

DJ64_RS03955: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase methyltransferase

DJ64_RS03720: methyltransferase

smcogs: SMCOG1089: methyltransferase

DJ64_RS03840: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

DJ64_RS03940: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Lyases: cyclase hydratase

DJ64_RS03830: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

DJ64_RS03835: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

DJ64_RS03860: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthase

DJ64_RS03815: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DJ64_RS03820: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

DJ64_RS03965: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

DJ64_RS03985: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.79	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.75	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001366.5	0.56	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000275.4	0.55	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000271.5	0.79	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.75	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.73	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.59	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001273.3	0.56	PKS	asperlactone	Aspergillus ochraceus
BGC0001366.5	0.56	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000275.4	0.55	PKS	tetracenomycin C	Streptomyces glaucescens

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.52 out of 27.04

Confidence: medium

Additional weak hits (20):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.20 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.03 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.59 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.89 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.74 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.70 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.20 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.76 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.01 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.19 out of 26.85

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.24 out of 27.04

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 25.75

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 827962 to 900472
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

DJ64_RS03685: MET (Score: 27.8; E-value: 3e-09)
DJ64_RS03800: OXY (Score: 278.2; E-value: 3.3e-85)
DJ64_RS03810: CYC C5-C18 (Score: 215.5; E-value: 4.6e-67)
DJ64_RS03815: KS (Score: 723.1; E-value: 2.1e-220)
DJ64_RS03820: CLF (Score: 547.3; E-value: 4.6e-167)
DJ64_RS03825: ACP (Score: 78.5; E-value: 6.5e-25)
DJ64_RS03830: CYC C9-C14 (Score: 252.3; E-value: 3e-78)
DJ64_RS03835: CYC C4-C21/C2-C23|C2-C19 (Score: 157.9; E-value: 1.6e-49)
DJ64_RS03840: MET C6|C8 (Score: 520.9; E-value: 2.7e-159)
DJ64_RS03880: KR (Score: 55.7; E-value: 1.3e-17)
DJ64_RS03885: KR (Score: 86.9; E-value: 3.9e-27)
DJ64_RS03895: KR (Score: 142.7; E-value: 3.8e-44)
DJ64_RS03940: GT (Score: 111.7; E-value: 1.3e-34)
DJ64_RS03955: KR (Score: 170.1; E-value: 1.7e-52)

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_KL503830.1 - Region 8 - ectoine

Download region SVG

Location: 1,738,911 - 1,749,309 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

DJ64_RS07940: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

DJ64_RS07950: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

DJ64_RS07965: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.60	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.50 out of 20.47

Confidence: medium

Additional weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.02 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_KL503830.1 - Region 9 - NI-siderophore

Download region SVG

Location: 2,746,499 - 2,776,271 nt. (total: 29,773 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

DJ64_RS12430: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DJ64_RS12455: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DJ64_RS12475: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: carboxylase transferase

DJ64_RS12440: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

DJ64_RS12445: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Lyases: decarboxylase

DJ64_RS12470: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

DJ64_RS12450: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Translocases: transporter

DJ64_RS12535: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.67	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000940.5	0.85	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.85	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.82	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002690.2	0.67	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002284.3	0.60	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002073.3	0.60	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.62 out of 30.11

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.26 out of 23.43

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.02 out of 23.43

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.66 out of 30.11

Confidence: medium

Additional weak hits (4):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.16 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.35 out of 21.55

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.99 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator
RpoN	Regulator of nitrogen assimilation and virulence

NZ_KL503830.1 - Region 10 - lassopeptide

Download region SVG

Location: 4,116,133 - 4,138,626 nt. (total: 22,494 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

DJ64_RS18750: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002015.4	0.93	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002307.3	0.84	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.84	ribosomal	MS-271	Streptomyces mirabilis
BGC0001920.4	0.84	ribosomal	siamycin I	Streptomyces sp.
BGC0001779.5	0.82	ribosomal	siamycin	Streptomyces nodosus
BGC0002318.2	0.62	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002053.3	0.59	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.59	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001552.3	0.59	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002015.4	0.93	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002307.3	0.84	ribosomal	humidimycin	Streptomyces humidus
BGC0001674.5	0.84	ribosomal	MS-271	Streptomyces mirabilis
BGC0001920.4	0.84	ribosomal	siamycin I	Streptomyces sp.
BGC0001779.5	0.82	ribosomal	siamycin	Streptomyces nodosus
BGC0002318.2	0.62	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0002053.3	0.59	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.59	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001552.3	0.59	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.60 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.56 out of 23.79

Confidence: strong

Additional weak hits (2):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.51 out of 30.22

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 2 - 85; Score: 76.4; RRE type: Lasso_Fused_RRE; Location: 0 - 57; Score: 27.3

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KL503830.1 - Region 11 - terpene

Download region SVG

Location: 4,999,497 - 5,020,582 nt. (total: 21,086 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

DJ64_RS22850: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

DJ64_RS22840: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

DJ64_RS22845: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.76	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0002181.3	0.37	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.85	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0001746.3	0.76	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.45	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001910.4	0.39	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0002339.3	0.38	terpene	2-hydroxysorangiadenosine	Vitiosangium cumulatum
BGC0002181.3	0.37	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000650.3	0.37	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000678.5	0.36	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

DJ64_RS22845: T1TS

Domain 1 (8 - 339): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.77 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

Additional weak hits (3):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.19 out of 30.22

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.73 out of 27.18

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes

NZ_KL503830.1 - Region 12 - terpene-precursor

Download region SVG

Location: 5,023,589 - 5,044,710 nt. (total: 21,122 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

DJ64_RS23010: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

DJ64_RS22965: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000678.5	0.42	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.38	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0001605.3	0.35	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001789.3	0.35	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000644.3	0.35	terpene	carotenoid	Dietzia sp. CQ4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000678.5	0.42	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001928.2	0.39	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0000561.5	0.38	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0001911.3	0.38	terpene	raimonol	Streptomyces anulatus
BGC0001605.3	0.35	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001789.3	0.35	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000644.3	0.35	terpene	carotenoid	Dietzia sp. CQ4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

DJ64_RS22965: PT_FPPS_like

Domain 1 (86 - 371): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

Additional weak hits (3):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.74 out of 27.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.89 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
ToxT	Regulator of MSHA biosynthesis

NZ_KL503830.1 - Region 13 - NRPS

Download region SVG

Location: 5,707,657 - 5,792,644 nt. (total: 84,988 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

DJ64_RS25950: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

DJ64_RS25985: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DJ64_RS25990: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DJ64_RS26015: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

DJ64_RS26020: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

Hydrolases: esterase

DJ64_RS25975: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase

DJ64_RS25925: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DJ64_RS25930: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DJ64_RS25935: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

DJ64_RS25980: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.74	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001984.3	0.73	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.74	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001984.3	0.73	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.58 out of 28.19

Confidence: medium

Additional weak hits (9):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.38 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.96 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.04 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.80 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.49 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.95 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.04 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 5707656 - 5792644:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - D-Asp - Tyr - Thr - D-Leu) + (Asp - Gly - Pro - Gly) + (Gly - Ala - NMe-Gly)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

DJ64_RS25925: Gly - Asp - Tyr - Thr - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (461..845): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAVLEQQALTGGETNMYGPTETTVWSMT
Nearest Stachelhaus code(s):: Gly DILQLGMVWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2150..2530): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YRATFDLTVTCTKGVLGGEINAYGPTEATVNVME
Nearest Stachelhaus code(s):: Asp DLTKVGAVNK (94% 8Å match); OH-Asp or Asp DLTKVGAVNK (79% 8Å match); Asp DLTKVGAVNK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3636..4020): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAYVSEVTLAVAGEINAYGPTETTVCATM
Nearest Stachelhaus code(s):: Tyr DASTAAAVCK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4714..5126): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5799..6195): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSWDASILEVFLATGGDVNAYGPTEVTVMALS
Nearest Stachelhaus code(s):: Leu DALFAGAVMK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

DJ64_RS25930: Asp - Gly - Pro - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (472..851): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YRASFDLTVTGTKGVLGGEINAYGPTEATVNCLE
Nearest Stachelhaus code(s):: Asp DLTKVGAVNK (100% 8Å match); Asp DLTKVGAVNK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1515..1906): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAGLELQALAGGELNVYGPTETTVWSTA
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2567..2966): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVSVQESYAVQAGEHNHYGPAETHVVTTW
Nearest Stachelhaus code(s):: Pro DVQYVAHVVK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3633..4008): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAGLELQALVGGETNLYGPTETTVWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

DJ64_RS25935: Gly - Ala - Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (477..852): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAGLELQALVGGETNLYGPTETTVWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1518..1918): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEGSGVLAGEANIYGPTEATVYAAA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2585..2988): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LALTFDISNLETQALVGGETNVYGPTETTIWSTS
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

DJ64_RS25980: fatty_acid

CAL_domain (42..485): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 40.9
NH2: 15.6
AHBA: 2.7
shikimic_acid: 0.0
Acetyl-CoA: -2.1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_KL503830.1 - Region 14 - RiPP-like

Download region SVG

Location: 5,991,672 - 6,002,982 nt. (total: 11,311 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002387.2	0.33	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001377.5	0.29	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.29	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002788.2	0.25	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001060.5	0.24	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.23	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000241.5	0.23	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0000240.5	0.22	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0000337.4	0.21	NRPS	destruxin A	Metarhizium robertsii ARSEF 23
BGC0000029.5	0.21	PKS	BE-14106	Streptomyces sp. DSM 21069

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002387.2	0.33	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0001377.5	0.29	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.29	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0002788.2	0.25	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001060.5	0.24	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.23	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000241.5	0.23	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0000240.5	0.22	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica
BGC0000337.4	0.21	NRPS	destruxin A	Metarhizium robertsii ARSEF 23
BGC0000029.5	0.21	PKS	BE-14106	Streptomyces sp. DSM 21069

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.90 out of 30.12

Confidence: medium

Additional weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.49 out of 29.38

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.35 out of 29.51

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.76 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NZ_KL503830.1 - Region 15 - T1PKS,terpene

Download region SVG

Location: 6,005,970 - 6,062,301 nt. (total: 56,332 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: synthase

DJ64_RS26870: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Hydrolases: esterase glucanase peptidase synthase

DJ64_RS26870: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

DJ64_RS26940: putative esterase

smcogs: SMCOG1104: putative esterase

DJ64_RS27050: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

DJ64_RS27060: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

Lyases: cyclase decarboxylase dehydratase

DJ64_RS26910: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

DJ64_RS26970: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

DJ64_RS27040: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

DJ64_RS26920: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DJ64_RS26930: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DJ64_RS26955: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

DJ64_RS38800: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DJ64_RS38805: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.67	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001160.5	0.33	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.31	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000849.4	0.31	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0001284.4	0.30	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.30	PKS	ACT-Toxin II	Alternaria alternata
BGC0001197.5	0.30	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001276.3	0.29	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000850.5	0.29	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001273.3	0.29	PKS	asperlactone	Aspergillus ochraceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.87	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.64	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001161.5	0.62	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001162.3	0.62	PKS	1-heptadecene	Moorea producens JHB
BGC0001163.3	0.62	PKS	1-heptadecene	Moorea producens 3L
BGC0001273.3	0.62	PKS	asperlactone	Aspergillus ochraceus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

DJ64_RS27040: T1TS + T1TS

Domain 1 (2 - 325): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (326 - 694): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (7):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.19 out of 30.25

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.73 out of 23.43

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 19.26

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.73 out of 29.51

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.91 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.84 out of 27.78

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

DJ64_RS26920: X

AMP-binding (83..299): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AQIVDARGIVLAVAVTA--VEAYGPAAAAGVALA
Nearest Stachelhaus code(s):: oh-D-Kyn DAVVVAGVVK (24% 8Å match)
Stachelhaus code match:: 60% (weak)

DJ64_RS26930: NH2

CAL_domain (210..527): NH2

minowa: NH2

Prediction, score:

NH2: 92.1
fatty_acid: 21.7
shikimic_acid: 0.0
AHBA: 0.0
Acetyl-CoA: -1.9

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_KL503830.1 - Region 16 - NRPS,T1PKS

Download region SVG

Location: 6,117,762 - 6,165,315 nt. (total: 47,554 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

DJ64_RS27515: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

DJ64_RS37520: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: hydrolase

DJ64_RS27435: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthase

DJ64_RS27430: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.65	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.92 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

Additional weak hits (1):

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 20, location 6117761 - 6165315:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

DJ64_RS27430: Gly - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (649..1043): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: TALTFDIFGLEL--LVGGEVNVYGPTETTIWSTS
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

PKS_AT (1780..2066): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 133.2
inactive: 81.5
Methoxymalonyl-CoA: 54.6
Methylmalonyl-CoA: 45.1
Isobutyryl-CoA: 26.8
Propionyl-CoA: 24.8
Ethylmalonyl-CoA: 23.2
fatty_acid: 18.5
Benzoyl-CoA: 11.5
CHC-CoA: 11.2
2-Methylbutyryl-CoA: 11.0
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_KL503830.1 - Region 17 - NI-siderophore

Download region SVG

Location: 6,241,674 - 6,272,916 nt. (total: 31,243 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DJ64_RS27925: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

DJ64_RS28020: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

DJ64_RS27930: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: esterase

DJ64_RS28045: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001374.5	0.47	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002387.2	0.42	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002584.2	0.42	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000679.5	0.42	terpene	diazepinomicin	Micromonospora sp. M42
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000204.5	0.41	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001374.5	0.47	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000942.4	0.47	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0000946.5	0.46	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002387.2	0.42	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002584.2	0.42	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000679.5	0.42	terpene	diazepinomicin	Micromonospora sp. M42
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0002346.3	0.41	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000204.5	0.41	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (4):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.71 out of 29.51

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.68 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.54 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.15 out of 18.57

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KL503830.1 - Region 18 - terpene

Download region SVG

Location: 6,692,221 - 6,718,914 nt. (total: 26,694 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

DJ64_RS29810: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

DJ64_RS29845: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase transferase

DJ64_RS29805: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

DJ64_RS29880: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase

DJ64_RS29795: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase synthetase

DJ64_RS29850: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

DJ64_RS29875: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.81	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000664.5	0.51	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000651.5	0.49	terpene	KS-505a	Streptomyces argenteolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.81	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0002591.2	0.51	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.
BGC0000664.5	0.51	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000651.5	0.49	terpene	KS-505a	Streptomyces argenteolus

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

DJ64_RS29835: PT_phytoene_like

Domain 1 (17 - 280): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

DJ64_RS29840: PT_phytoene_like

Domain 1 (17 - 302): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

DJ64_RS29850: PT_FPPS_like

Domain 1 (60 - 353): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

DJ64_RS29855: T2TS

Domain 1 (24 - 655): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.87 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.88 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.99 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KL503830.1 - Region 19 - RiPP-like

Download region SVG

Location: 7,128,674 - 7,138,889 nt. (total: 10,216 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.57	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.46	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.42	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.41	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000589.5	0.38	ribosomal	microcin M	Escherichia coli Nissle 1917

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000518.3	0.57	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.46	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0002698.2	0.42	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001639.3	0.41	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0000500.5	0.39	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000589.5	0.38	ribosomal	microcin M	Escherichia coli Nissle 1917

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (2):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.44 out of 20.01

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.48 out of 29.51

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KL503830.1 - Region 20 - NRPS-like,PKS-like,RiPP-like,T2PKS,betalactone

Download region SVG

Location: 7,491,891 - 7,563,100 nt. (total: 71,210 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)
PKS-like: (t2pks2 or ksIII)
betalactone: (HMGL-like and AMP-binding)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

DJ64_RS33550: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

DJ64_RS33555: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DJ64_RS33565: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

DJ64_RS33580: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

DJ64_RS33590: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

DJ64_RS33595: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

DJ64_RS33635: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

DJ64_RS33760: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

DJ64_RS33770: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase aminotransferase transferase

DJ64_RS33640: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

DJ64_RS33645: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

DJ64_RS33655: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

DJ64_RS33745: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

DJ64_RS37555: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

DJ64_RS33545: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase dehydratase

DJ64_RS33605: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

DJ64_RS33620: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

DJ64_RS33610: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

DJ64_RS33615: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

DJ64_RS33630: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

DJ64_RS33660: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

DJ64_RS33665: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

DJ64_RS33735: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	1.89	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001160.5	1.76	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	1.75	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000234.5	1.53	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001261.3	1.51	NRPS	AM-toxin	Alternaria alternata
BGC0001723.5	1.46	PKS	oviedomycin	Streptomyces antibioticus
BGC0000272.3	1.46	PKS	spore pigment	Streptomyces collinus
BGC0001257.3	1.34	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0000204.5	1.25	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001513.3	1.21	PKS	anthrabenzoxocinone	Actinobacteria bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.70	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002164.2	0.67	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001164.3	0.65	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (12):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.59 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.62 out of 31.73

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.04 out of 19.26

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.67 out of 29.72

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.58 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.58 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.41 out of 27.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.22 out of 27.55

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.97 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.41 out of 29.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 24, location 7491890 - 7563100:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 26, location 7524670 - 7563100:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 27, location 7525785 - 7563100:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Hpr)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

DJ64_RS33630: NH2

CAL_domain (39..471): NH2

minowa: NH2

Prediction, score:

NH2: 154.2
Acetyl-CoA: 43.0
fatty_acid: 42.0
AHBA: 12.4
shikimic_acid: 0.0

DJ64_RS33640: mal

PKS_AT (97..375): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 128.1
Methoxymalonyl-CoA: 78.3
Methylmalonyl-CoA: 72.1
inactive: 67.1
Propionyl-CoA: 50.9
Ethylmalonyl-CoA: 40.8
2-Methylbutyryl-CoA: 36.4
Isobutyryl-CoA: 26.9
trans-1,2-CPDA: 23.9
CHC-CoA: 13.4
fatty_acid: 10.5
Acetyl-CoA: 9.5
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

DJ64_RS37555: mal

PKS_AT (243..522): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 58.1
Methoxymalonyl-CoA: 41.4
Propionyl-CoA: 36.5
Methylmalonyl-CoA: 31.0
2-Methylbutyryl-CoA: 16.2
inactive: 14.7
Acetyl-CoA: 12.9
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

DJ64_RS33740: Hpr

Search NORINE for peptide: strict or relaxed

AMP-binding (78..469): Hpr

nrpys: Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDFSVQEAYALQGGEHNIYGPAETHAVTAC
Nearest Stachelhaus code(s):: Hpr DFQFLGVAVK (85% 8Å match)
Stachelhaus code match:: 80% (moderate)

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 18 - 123; Score: 60.5; RRE type: Cyanobactin_D_RRE; Location: 18 - 95; Score: 38.2; RRE type: NHLP_CD_RRE; Location: 19 - 96; Score: 37.6

Type II PKS gene cluster prediction details

Cluster section:: 7491890 to 7563100
Starter unit(s):: 2-methylbutyryl-CoA (Score: 790.0; E-value: 2.09e-179)
hexadienyl-CoA (Score: 138.0; E-value: 2.48e-40)
Malonyl elongations:: 8|9 (Score: 678.3; E-value: 6.9e-207)
Product molecular weight(s):: 2-methylbutyryl-CoA_8: 408 Da
2-methylbutyryl-CoA_9: 450 Da
hexadienyl-CoA_8: 418 Da
hexadienyl-CoA_9: 460 Da

DJ64_RS33545: CYC C5-C14 (Score: 469.2; E-value: 1.1e-143)
DJ64_RS33555: KR C9 (Score: 447.9; E-value: 2.4e-137)
DJ64_RS33615: KSIII (Score: 478.2; E-value: 3.3e-146); KSIII AKT74268.1_Trioxacarcin_2-methylbutyryl-CoA (Score: 492.0; E-value: 2.09e-179)
DJ64_RS33620: CYC C7-C12 (Score: 437.8; E-value: 4.1e-134)
DJ64_RS33640: AT (Score: 190.7; E-value: 7.8e-59); AT AAQ08910.1_Fredericamycin_hexadienyl-CoA (Score: 138.0; E-value: 2.48e-40)
DJ64_RS33660: KS (Score: 765.1; E-value: 3.9e-233)
DJ64_RS33665: CLF 8|9 (Score: 678.3; E-value: 6.9e-207)
DJ64_RS33670: ACP (Score: 114.7; E-value: 3.5e-36)
DJ64_RS33730: MET (Score: 20.3; E-value: 5.5e-07)
DJ64_RS33770: KR (Score: 183.6; E-value: 1.3e-56)
DJ64_RS37555: AT (Score: 398.5; E-value: 5.4e-122); AT ADB23379.1_TLN-05220/TLN-05223_2-methylbutyryl-CoA (Score: 298.0; E-value: 5.3e-96)

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_KL503831.1 - Region 1 - PKS-like,T1PKS

Download region SVG

Location: 16,567 - 64,671 nt. (total: 48,105 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxidase reductase

DJ64_RS33900: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

DJ64_RS33940: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

DJ64_RS33965: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

DJ64_RS33985: flavodoxin

smcogs: SMCOG1134: flavodoxin

Ligases: synthase

DJ64_RS33950: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

DJ64_RS33955: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001283.3	1.07	PKS	Bisenarsan	Streptomyces lividans 1326
BGC0001275.3	0.61	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.61	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001283.3	0.81	PKS	Bisenarsan	Streptomyces lividans 1326
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.40 out of 20.97

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 19.26

Confidence: medium

Additional weak hits (6):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.37 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.07 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.27 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.72 out of 20.97

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.05 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 16566 - 64671:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 16566 - 63598:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 23624 - 64671:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

DJ64_RS33950: mmal

PKS_AT (549..846): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Propionyl-CoA: 79.2%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 166.1
Ethylmalonyl-CoA: 147.7
Methoxymalonyl-CoA: 141.2
2-Methylbutyryl-CoA: 119.1
Malonyl-CoA: 108.9
trans-1,2-CPDA: 101.1
Isobutyryl-CoA: 88.0
Benzoyl-CoA: 86.1
Propionyl-CoA: 85.4
CHC-CoA: 62.3
Acetyl-CoA: 52.1
inactive: 47.5
3-Methylbutyryl-CoA: 45.8
fatty_acid: 19.6