GCF_000518265.1 - 31 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_KI912410.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To
Region 1.1	terpene-precursor	777,016	798,158
Region 1.2	RiPP-like	878,820	889,650
Region 1.3	RiPP-like	1,057,123	1,067,956

NZ_JADG01000003.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	NRPS,polyhalogenated-pyrrole	146,874	222,420
Region 2.2	NRPS,RRE-containing,RiPP-like	334,515	483,052
Region 2.3	NRPS-like	573,673	615,226
Region 2.4	T1PKS	675,467	805,344	Medium	K-41A	PKS

NZ_JADG01000004.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	terpene-precursor	351,289	372,377
Region 3.2	CDPS	381,139	401,828	Low	albonoursin	other:other
Region 3.3	terpene	490,411	511,448

NZ_KI912411.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	T2PKS,NRPS-like	163,443	256,616	Low	α naphtocyclinoic acid/fogacin	PKS
Region 4.2	PKS-like,terpene	336,663	392,079
Region 4.3	hydrogen-cyanide	535,134	548,059
Region 4.4	terpene,T1PKS	576,529	635,771

NZ_JADG01000007.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	T1PKS	78,730	125,155

NZ_JADG01000008.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	lanthipeptide-class-iii	393,685	416,429	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide

NZ_JADG01000009.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	T1PKS	1	29,204	Low	nystatin	PKS
Region 7.2	NRPS	117,711	213,714	Low	teicoplanin	NRPS:Type I
Region 7.3	terpene-precursor,T3PKS	321,042	368,363

NZ_JADG01000010.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 8.1	terpene,ectoine	3,418	28,167	High	ectoine	other:other
Region 8.2	lassopeptide	85,635	110,544	Low	cattlecin	ribosomal:RiPP
Region 8.3	RiPP-like	285,457	296,449
Region 8.4	NRPS,T1PKS,hglE-KS,redox-cofactor,lassopeptide,terpene	302,733	420,993

NZ_JADG01000011.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	azole-containing-RiPP,thioamitides,other	150,792	219,256	Low	neothioviridamide	ribosomal:RiPP
Region 9.2	NRPS,polyhalogenated-pyrrole,other,T1PKS	245,133	346,701	High	maduropeptin	PKS:Iterative type I
Region 9.3	lanthipeptide-class-ii	401,935	425,123	Low	cinnamycin B	ribosomal:RiPP

NZ_JADG01000012.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	terpene,NI-siderophore	150,595	183,044

NZ_KI912412.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	T1PKS,hglE-KS	112,066	164,024

NZ_JADG01000020.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 17.1	NRPS,CDPS	53,332	116,018	Low	coprisamide C/coprisamide D	NRPS:Type I

NZ_JADG01000021.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	terpene	31,163	52,521

NZ_JADG01000023.1 (Actinomadura oligospora ATCC 43269)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 20.1	lanthipeptide-class-ii	1	14,176

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene-precursor	777,016	798,158
Region 1.2	RiPP-like	878,820	889,650
Region 1.3	RiPP-like	1,057,123	1,067,956
Region 2.1	NRPS,polyhalogenated-pyrrole	146,874	222,420
Region 2.2	NRPS,RRE-containing,RiPP-like	334,515	483,052
Region 2.3	NRPS-like	573,673	615,226
Region 2.4	T1PKS	675,467	805,344	Medium	K-41A	PKS
Region 3.1	terpene-precursor	351,289	372,377
Region 3.2	CDPS	381,139	401,828	Low	albonoursin	other:other
Region 3.3	terpene	490,411	511,448
Region 4.1	T2PKS,NRPS-like	163,443	256,616	Low	α naphtocyclinoic acid/fogacin	PKS
Region 4.2	PKS-like,terpene	336,663	392,079
Region 4.3	hydrogen-cyanide	535,134	548,059
Region 4.4	terpene,T1PKS	576,529	635,771
Region 5.1	T1PKS	78,730	125,155
Region 6.1	lanthipeptide-class-iii	393,685	416,429	Medium	catenulipeptin	ribosomal:RiPP:Lanthipeptide
Region 7.1	T1PKS	1	29,204	Low	nystatin	PKS
Region 7.2	NRPS	117,711	213,714	Low	teicoplanin	NRPS:Type I
Region 7.3	terpene-precursor,T3PKS	321,042	368,363
Region 8.1	terpene,ectoine	3,418	28,167	High	ectoine	other:other
Region 8.2	lassopeptide	85,635	110,544	Low	cattlecin	ribosomal:RiPP
Region 8.3	RiPP-like	285,457	296,449
Region 8.4	NRPS,T1PKS,hglE-KS,redox-cofactor,lassopeptide,terpene	302,733	420,993
Region 9.1	azole-containing-RiPP,thioamitides,other	150,792	219,256	Low	neothioviridamide	ribosomal:RiPP
Region 9.2	NRPS,polyhalogenated-pyrrole,other,T1PKS	245,133	346,701	High	maduropeptin	PKS:Iterative type I
Region 9.3	lanthipeptide-class-ii	401,935	425,123	Low	cinnamycin B	ribosomal:RiPP
Region 10.1	terpene,NI-siderophore	150,595	183,044
Region 12.1	T1PKS,hglE-KS	112,066	164,024
Region 17.1	NRPS,CDPS	53,332	116,018	Low	coprisamide C/coprisamide D	NRPS:Type I
Region 18.1	terpene	31,163	52,521
Region 20.1	lanthipeptide-class-ii	1	14,176

No secondary metabolite regions were found in these records:: NZ_JADG01000013.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000016.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000017.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000018.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000019.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000022.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000024.1 (Actinomadura oligospora ATCC 43269); NZ_KI912413.1 (Actinomadura oligospora ATCC 43269); NZ_KI912414.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000029.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000030.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000031.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000032.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000033.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000034.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000035.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000036.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000037.1 (Actinomadura oligospora ATCC 43269); NZ_JADG01000038.1 (Actinomadura oligospora ATCC 43269)

Compact view

NZ_KI912410.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 777,016 - 798,158 nt. (total: 21,143 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

P696_RS0135375: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

P696_RS0135445: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Ligases: synthetase

P696_RS50240: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000657.5	0.45	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000496.5	0.43	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002316.2	0.42	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000657.5	0.45	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000496.5	0.43	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002316.2	0.42	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

P696_RS50240: PT_FPPS_like

Domain 1 (97 - 379): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.12 out of 23.79

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.76 out of 29.51

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.17 out of 29.65

Confidence: medium

Additional weak hits (8):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.63 out of 29.51

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.77 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.98 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.32 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.79 out of 26.85

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
LexA variant 1	Repressor of DNA damage response

NZ_KI912410.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 878,820 - 889,650 nt. (total: 10,831 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001873.3	0.39	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0002665.2	0.36	ribosomal	3-thiaglutamate	Pseudomonas syringae pv. maculicola str. ES4326
BGC0001149.5	0.35	NRPS, saccharide	brabantamide A	Pseudomonas sp. SHC52
BGC0001486.4	0.34	ribosomal	3-thiaglutamate	Pseudomonas syringae pv. maculicola str. ES4326
BGC0002745.3	0.34	PKS	verrucosidin	Penicillium polonicum
BGC0000595.3	0.32	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000847.4	0.32	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0000030.3	0.31	PKS	bikaverin	Fusarium fujikuroi IMI 58289
BGC0002387.2	0.31	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002199.2	0.30	other (other)	nanangelenin A	Aspergillus nanangensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001873.3	0.39	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0002665.2	0.36	ribosomal	3-thiaglutamate	Pseudomonas syringae pv. maculicola str. ES4326
BGC0001149.5	0.35	NRPS, saccharide	brabantamide A	Pseudomonas sp. SHC52
BGC0001486.4	0.34	ribosomal	3-thiaglutamate	Pseudomonas syringae pv. maculicola str. ES4326
BGC0002745.3	0.34	PKS	verrucosidin	Penicillium polonicum
BGC0000595.3	0.32	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000847.4	0.32	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0000030.3	0.31	PKS	bikaverin	Fusarium fujikuroi IMI 58289
BGC0002387.2	0.31	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002199.2	0.30	other (other)	nanangelenin A	Aspergillus nanangensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.94 out of 20.97

Confidence: medium

Additional weak hits (2):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.11 out of 18.57

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A

NZ_KI912410.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,057,123 - 1,067,956 nt. (total: 10,834 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: sulfhydrylase

P696_RS0136635: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001387.5	0.27	other (other)	nucleocidin	Streptomyces calvus
BGC0000821.5	0.27	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0000632.5	0.27	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000877.5	0.27	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0000457.5	0.25	NRPS	vicibactin	Rhizobium etli CFN 42
BGC0002443.3	0.24	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0000226.5	0.23	PKS	gilvocarcin V	Streptomyces griseoflavus
BGC0000700.5	0.23	saccharide	istamycin	Streptomyces tenjimariensis
BGC0001312.5	0.22	NRPS	viscosin	Pseudomonas fluorescens SBW25
BGC0001179.5	0.22	PKS	rishirilide B, rishirilide A	Streptomyces bottropensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001387.5	0.27	other (other)	nucleocidin	Streptomyces calvus
BGC0000821.5	0.27	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0000632.5	0.27	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000877.5	0.27	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0000457.5	0.25	NRPS	vicibactin	Rhizobium etli CFN 42
BGC0002443.3	0.24	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0000226.5	0.23	PKS	gilvocarcin V	Streptomyces griseoflavus
BGC0000700.5	0.23	saccharide	istamycin	Streptomyces tenjimariensis
BGC0001312.5	0.22	NRPS	viscosin	Pseudomonas fluorescens SBW25
BGC0001179.5	0.22	PKS	rishirilide B, rishirilide A	Streptomyces bottropensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

Additional weak hits (9):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.86 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.39 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.74 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.44 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.10 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.70 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.22 out of 27.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.90 out of 33.14

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.72 out of 30.98

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JADG01000003.1 - Region 1 - NRPS,polyhalogenated-pyrrole

Download region GenBank file

Download region SVG

Location: 146,874 - 222,420 nt. (total: 75,547 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
polyhalogenated-pyrrole: (Abhydrolase_6 and Trp_halogenase and (Acyl-CoA_dh_N or Acyl-CoA_dh_M or Acyl-CoA_dh_1) and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

P696_RS0100785: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

P696_RS0100840: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

P696_RS0100845: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

P696_RS42305: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

P696_RS42340: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

P696_RS42345: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase acyltransferase halogenase methyltransferase

P696_RS0100760: methyltransferase

smcogs: SMCOG1089: methyltransferase

P696_RS0100770: methyltransferase

smcogs: SMCOG1248: methyltransferase

P696_RS0100790: methyltransferase

smcogs: SMCOG1089: methyltransferase

P696_RS0100890: flavin-dependent trp 6 7 halogenase

halogenases: flavin-dependent trp 6 7 halogenase
MITE: MITE0000092Halogenation (identity: 72.00%)
smcogs: SMCOG1119: halogenase

P696_RS42295: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

P696_RS42300: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: esterase

P696_RS0100850: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

P696_RS0100810: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS0100825: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

P696_RS0100830: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

P696_RS0100855: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

P696_RS42315: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

P696_RS42335: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

P696_RS42360: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.81	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.80	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.80	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.80	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.79	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001261.3	0.79	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.77	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001249.5	0.77	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001641.4	0.75	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.77	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.76	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.76	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001249.5	0.75	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.73	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.52 out of 27.18

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.09 out of 29.72

Confidence: medium

Additional weak hits (17):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.70 out of 26.33

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.19 out of 35.63

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.54 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.89 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.65 out of 23.43

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.72 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.28 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.57 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.89 out of 31.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.75 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.20 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 146873 - 222420:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Asn) + (X - Asn - Asn - X - X - X) + (D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS0100810: X

AMP-binding (12..456): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RDTW--TAMRQAGALIEAGRAGFRP--GAFAVGY
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

P696_RS0100825: X - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (18..415): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AWLTFDAAQLEAQLLSGGEVNTYGPSECSVDVTA
Nearest Stachelhaus code(s):: Gln DAVQMGCVDK (62% 8Å match); Lys DADDAGTVDK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1078..1463): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLQVPNAKLVIAGELNEYGPTEASVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (71% 8Å match); Asn DLTKVGEVGK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

P696_RS0100830: X - Asn - Asn - X - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (514..920): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTAHFDVSVFEGSQVFAGEVNMYGITETTVHSTY
Nearest Stachelhaus code(s):: Ser DVWSVAMVHK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1583..1992): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLSVTTAKLVVGGEVNEYGPTEITVADAA
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2671..3056): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLQVPNAKLVVAGEINEYGPTEASVGTCV
Nearest Stachelhaus code(s):: D-Ala DLTKVNEVGK (74% 8Å match); Asn DLTKVGEVGK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3702..4110): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISVWQAEVVVTGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEVTADDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4778..5195): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTAHFDVSVFEASQVFAGEVNMYGITETTVHTTY
Nearest Stachelhaus code(s):: Ser DVWSVAMVHK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5854..6254): X

nrpys: Asn, D-Ala

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWASFDLVVPNAKLVVAGEVNEYGPTETAVGATV
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (76% 8Å match); D-Ala DLTKVNEVGK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

P696_RS0100855: X

AMP-binding (491..897): X

nrpys: Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDHNFDASVADPALATGGEINVYGPTEATVAATA
Nearest Stachelhaus code(s):: ndmHex DAMVLGVVAK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

P696_RS42335: AHBA

CAL_domain (42..459): AHBA

minowa: AHBA

Prediction, score:

AHBA: 24.5
NH2: 16.4
Acetyl-CoA: 9.9
shikimic_acid: 0.2
fatty_acid: -2.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes
NtrC	Nitrogen regulatory protein C

NZ_JADG01000003.1 - Region 2 - NRPS,RRE-containing,RiPP-like

Download region GenBank file

Download region SVG

Location: 334,515 - 483,052 nt. (total: 148,538 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

P696_RS0101565: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase halogenase

P696_RS42535: aminotransferase

smcogs: SMCOG1019: aminotransferase

P696_RS42550: halogenase

smcogs: SMCOG1119: halogenase

Hydrolases: hydrolase

P696_RS0101580: isochorismatase

smcogs: SMCOG1027: isochorismatase

P696_RS0101605: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

P696_RS0101765: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

P696_RS42540: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

P696_RS42580: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS42585: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.86	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.85	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.84	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.82	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.81	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.80	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.79	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.78	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.75	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.73	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.75	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.80 out of 23.79

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.26 out of 23.79

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

Additional weak hits (30):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.13 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.25 out of 27.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.24 out of 36.54

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.95 out of 27.18

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.04 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.53 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.44 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.61 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.40 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.12 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 36.53

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.26 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.97 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.88 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.87 out of 26.85

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.18 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.79 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.06 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.38 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.00 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.47 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.41 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.87 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.95 out of 36.53

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.33 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 334514 - 483052:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - D-Trp - Ile - D-Phe - Gly - Gly - Orn - Orn) + (Ser - Asp - Val - D-Ser) + (Ser - Orn - Lys - Tyr - Asp - Orn) + (Asp - Phe - Asn - Lys - Asp - Asn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 334514 - 402894:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - D-Trp - Ile - D-Phe - Gly - Gly - Orn - Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 388442 - 483052:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Asp - Val - D-Ser) + (Ser - Orn - Lys - Tyr - Asp - Orn) + (Asp - Phe - Asn - Lys - Asp - Asn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS42540: Gly - Trp - Ile - Phe - Gly - Gly - Orn - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (498..906): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FTMTFDIAGLELQALCGGEWNVYGPTETTIWSAR
Nearest Stachelhaus code(s):: Gly DILQLGVIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1569..1948): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MSQAFDVAESEAQMVSGGEINAYGPTEATVYAVL
Nearest Stachelhaus code(s):: Trp DVSQVGAVAK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3056..3474): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LAHSFDAATFEGFLLAGGEVSVYGPTETTTFATS
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (79% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4142..4535): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAAVWELTLVTAGEVNAYGPTETTVCATA
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5668..6045): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LSMTFDIAGLELQALCGGEWNLYGPTETTIWSAV
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (6710..7135): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAGLELQALCGGEWNMYGPTETTIWSTC
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (7802..8200): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: VAWTFDVFTGDRELVVTTDLTAFGITETTIDSTY
Nearest Stachelhaus code(s):: Orn DVGEVGSIDK (62% 8Å match); Dab DVGEISAIDK (50% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (8875..9264): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: VGWTFDVFTGDRESLITTDLTAYGVTEATIDSSY
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

P696_RS42580: Ser - Asp - Val - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (205..605): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RRMSFDASVWEWHFFCSGEGNLYGPTEATIEAAS
Nearest Stachelhaus code(s):: Ser DVWHFSLIEK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1260..1669): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YEVQTDFGNTVTKIVLGGEFNHYGPTETTVGVTT
Nearest Stachelhaus code(s):: OH-Asp DLTKVGHVGK (74% 8Å match); Asp DLTKVGHVGK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2325..2724): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: ISGAFDAATFEGFLVVGGDVNGYGPTETTTFAAW
Nearest Stachelhaus code(s):: Val DAFFVGGTFK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3379..3770): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSLWEWHFVCSGEENLYGPTEASVDVSS
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

P696_RS0101765: Ser - Orn - Lys - Tyr - Asp - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (474..864): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSLWEWHFVCSGEENLYGPTEASIEVSS
Nearest Stachelhaus code(s):: Ser DVWHVSLIDK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1513..1910): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LAWAFDVFTGDREAVVTTDLTAFGITEATVDSTY
Nearest Stachelhaus code(s):: Orn DVGEIGSVDK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2567..2965): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VWRSFDAATGEWDCVCGGEHNVYGPTEASIDVSA
Nearest Stachelhaus code(s):: Lys or 4S-ohLys DLGDVGSIDK (41% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (3621..4011): Tyr

nrpys: Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: tyr (Tyr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDAVVSEMTLLAAGEFNAYGPTETAVCASM
Nearest Stachelhaus code(s):: Tyr DASTLAAVCK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4670..5062): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQTDFGNTMGKIVFGGEMNHYGPTEATVGVAT
Nearest Stachelhaus code(s):: OH-Asp DLTKVGHVGK (74% 8Å match); Asp DLTKVGHVGK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5722..6125): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: VAWAFDVFTGDREALVTTDRTAFGITEATIDSTS
Nearest Stachelhaus code(s):: Dab DVGEISAIDK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

P696_RS42585: Asp - Phe - Asn - Lys - Asp - Asn

Search NORINE for peptide: strict or relaxed

AMP-binding (541..937): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQTDFGNTMGKIVLGGEMNHYGPTETTVGVAT
Nearest Stachelhaus code(s):: OH-Asp DLTKVGHVGK (76% 8Å match); Asp DLTKVGHVGK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1596..1990): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDATVWEMTLITAGEVNAYGPTETTVCATT
Nearest Stachelhaus code(s):: Phe DAWTIAAVCK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2660..3056): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDMSVTSAKVVVGGEVNEYGPTETVVGCVV
Nearest Stachelhaus code(s):: Asn DMTKVGEVGK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3726..4131): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: VWRTVDVATGEWDCICGGEENVYGPTEASIDVSS
Nearest Stachelhaus code(s):: Lys DVGDVGSIDK (35% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (4810..5210): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YGVQTDLGNTMGKIILGGEANHYGPTETTIGVAT
Nearest Stachelhaus code(s):: Asp DLTKIGHIGK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (6566..6963): Asn

nrpys: Asn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSVKLVVGGEVNEYGPTETVVGCVV
Nearest Stachelhaus code(s):: Asn DLTKVGEVGK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 1 - 70; Score: 57.1; RRE type: Heterocycloanthracin_C_RRE; Location: 2 - 80; Score: 38.8
: RRE type: Thiopeptide_F_RRE; Location: 1 - 70; Score: 57.1; RRE type: Heterocycloanthracin_C_RRE; Location: 2 - 80; Score: 38.8

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_JADG01000003.1 - Region 3 - NRPS-like

Download region GenBank file

Download region SVG

Location: 573,673 - 615,226 nt. (total: 41,554 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

P696_RS0102295: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

P696_RS0102300: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Hydrolases: amidase

P696_RS0102290: amidase

smcogs: SMCOG1105: amidase

Ligases: ligase

P696_RS0102350: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000874.5	0.44	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000495.5	0.42	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000878.5	0.42	other (other)	puromycin	Streptomyces alboniger
BGC0000877.5	0.42	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0002476.2	0.42	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0000679.5	0.41	terpene	diazepinomicin	Micromonospora sp. M42
BGC0002372.3	0.41	PKS, other (other), terpene	marinoterpin B, marinoterpin A, marinoterpin C	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.58	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000503.5	0.44	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000874.5	0.44	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000495.5	0.42	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000878.5	0.42	other (other)	puromycin	Streptomyces alboniger
BGC0000877.5	0.42	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0002476.2	0.42	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0000679.5	0.41	terpene	diazepinomicin	Micromonospora sp. M42
BGC0002372.3	0.41	PKS, other (other), terpene	marinoterpin B, marinoterpin A, marinoterpin C	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.34 out of 23.79

Confidence: medium

Additional weak hits (11):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.70 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.78 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.20 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.91 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.92 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.10 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 573672 - 615226:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS0102350: X

AMP-binding (108..328): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LEAVHSLGWGVSALLVGAGLRGYGSTETGATFLG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_JADG01000003.1 - Region 4 - T1PKS

Download region GenBank file

Download region SVG

Location: 675,467 - 805,344 nt. (total: 129,878 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

P696_RS0102815: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

P696_RS0102875: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

P696_RS0102880: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

P696_RS0102895: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

P696_RS0102930: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

P696_RS0102965: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

P696_RS0102980: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

P696_RS0102995: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acylase aminotransferase glycosyltransferase methyltransferase transferase

P696_RS0102870: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

P696_RS0102890: methyltransferase

smcogs: SMCOG1089: methyltransferase

P696_RS0102905: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

P696_RS0102920: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

P696_RS42850: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

P696_RS42865: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase hydrolase

P696_RS0102885: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

P696_RS0103015: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: dehydratase hydratase

P696_RS42815: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

P696_RS42845: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

P696_RS0102845: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

P696_RS0102970: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

P696_RS0102975: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

P696_RS0103040: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

P696_RS42835: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

P696_RS42895: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

P696_RS57845: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: transporter

P696_RS0102795: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.77	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.77	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.77	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0000278.3	0.63	PKS	urdamycin	Streptomyces fradiae
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.77	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.77	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.77	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000041.3	0.63	PKS	oronofacic acid	Pseudomonas syringae
BGC0000278.3	0.63	PKS	urdamycin	Streptomyces fradiae
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 21.24 out of 23.79

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.80 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

Additional weak hits (19):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 26.85

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.83 out of 25.88

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.27 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.50 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.59 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.32 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.21 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.46 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.28 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.94 out of 28.19

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.87 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.25 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.86 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.22 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.83 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.56 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 7, location 675466 - 805344:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Me-redmal) + (ccmal - redmal) + (Me-ohmal) + (Me-ohmal) + (Me-ohmal - Me-ccmal) + (ccmal - Me-redmal) + (Me-ccmal - redmal)
Non-colinear ordering:: P696_RS42865 + P696_RS0102965 + P696_RS0102845 + P696_RS58655 + P696_RS0102870 + P696_RS57845 + P696_RS0102970 + P696_RS0102975

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS0102845: mal - mal

PKS_AT (547..828): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 183.3
Methoxymalonyl-CoA: 70.5
inactive: 69.7
Methylmalonyl-CoA: 66.5
Propionyl-CoA: 48.8
Ethylmalonyl-CoA: 38.1
Isobutyryl-CoA: 32.2
Acetyl-CoA: 30.4
fatty_acid: 26.4
trans-1,2-CPDA: 16.2
CHC-CoA: 14.8
Benzoyl-CoA: 13.4
2-Methylbutyryl-CoA: 12.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (2254..2535): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.0
Methoxymalonyl-CoA: 79.8
inactive: 79.0
Methylmalonyl-CoA: 75.6
Ethylmalonyl-CoA: 48.3
Propionyl-CoA: 47.0
Acetyl-CoA: 44.2
Isobutyryl-CoA: 41.2
fatty_acid: 37.3
2-Methylbutyryl-CoA: 25.1
trans-1,2-CPDA: 17.2
CHC-CoA: 15.5
Benzoyl-CoA: 14.0
3-Methylbutyryl-CoA: 5.0

P696_RS58655: mmal

PKS_AT (562..854): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 214.5
Ethylmalonyl-CoA: 203.1
Methoxymalonyl-CoA: 176.9
2-Methylbutyryl-CoA: 158.2
trans-1,2-CPDA: 137.4
Propionyl-CoA: 123.7
Malonyl-CoA: 108.1
CHC-CoA: 99.1
Isobutyryl-CoA: 79.5
Benzoyl-CoA: 56.9
Acetyl-CoA: 53.0
fatty_acid: 40.4
inactive: 31.2
3-Methylbutyryl-CoA: 26.8

P696_RS57845: mmal - mmal

PKS_AT (565..859): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 202.5
Ethylmalonyl-CoA: 193.3
Methoxymalonyl-CoA: 161.7
2-Methylbutyryl-CoA: 140.8
trans-1,2-CPDA: 130.2
Propionyl-CoA: 113.9
Malonyl-CoA: 100.9
CHC-CoA: 91.3
Isobutyryl-CoA: 62.4
Benzoyl-CoA: 61.0
Acetyl-CoA: 50.0
fatty_acid: 38.6
3-Methylbutyryl-CoA: 31.6
inactive: 27.8

PKS_AT (2109..2403): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.6
Ethylmalonyl-CoA: 207.5
Methoxymalonyl-CoA: 180.7
2-Methylbutyryl-CoA: 159.9
trans-1,2-CPDA: 138.9
Propionyl-CoA: 122.5
Malonyl-CoA: 114.2
CHC-CoA: 100.0
Isobutyryl-CoA: 77.1
Acetyl-CoA: 58.6
Benzoyl-CoA: 57.4
fatty_acid: 41.2
inactive: 36.7
3-Methylbutyryl-CoA: 26.7

P696_RS0102870: mmal

PKS_AT (562..852): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 215.4
Ethylmalonyl-CoA: 202.2
Methoxymalonyl-CoA: 177.0
2-Methylbutyryl-CoA: 153.7
trans-1,2-CPDA: 140.1
Propionyl-CoA: 122.2
Malonyl-CoA: 120.2
CHC-CoA: 103.3
Isobutyryl-CoA: 75.9
Benzoyl-CoA: 57.6
Acetyl-CoA: 51.2
fatty_acid: 44.6
3-Methylbutyryl-CoA: 29.9
inactive: 29.0

P696_RS42865: mmal

PKS_AT (1405..1697): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 209.2
Ethylmalonyl-CoA: 203.3
Methoxymalonyl-CoA: 170.6
2-Methylbutyryl-CoA: 134.3
trans-1,2-CPDA: 134.0
Propionyl-CoA: 116.3
Malonyl-CoA: 115.3
CHC-CoA: 93.3
Isobutyryl-CoA: 84.4
Benzoyl-CoA: 69.8
Acetyl-CoA: 60.0
fatty_acid: 48.8
inactive: 39.1
3-Methylbutyryl-CoA: 33.2

P696_RS0102965: mmal

PKS_AT (558..850): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 208.1
Ethylmalonyl-CoA: 197.1
Methoxymalonyl-CoA: 165.8
2-Methylbutyryl-CoA: 152.5
Malonyl-CoA: 120.9
trans-1,2-CPDA: 117.4
Propionyl-CoA: 115.3
CHC-CoA: 106.4
Isobutyryl-CoA: 92.5
Acetyl-CoA: 62.8
Benzoyl-CoA: 60.6
3-Methylbutyryl-CoA: 50.8
inactive: 46.9
fatty_acid: 28.6

P696_RS0102970: mal - mmal

PKS_AT (571..867): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.3
inactive: 100.5
Methoxymalonyl-CoA: 58.7
Methylmalonyl-CoA: 53.0
Propionyl-CoA: 25.4
Benzoyl-CoA: 17.4
Acetyl-CoA: 17.2
Isobutyryl-CoA: 15.6
Ethylmalonyl-CoA: 12.0
CHC-CoA: 10.1
trans-1,2-CPDA: 5.6
2-Methylbutyryl-CoA: 2.3
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2297..2589): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 211.7
Ethylmalonyl-CoA: 201.9
Methoxymalonyl-CoA: 174.0
2-Methylbutyryl-CoA: 153.5
trans-1,2-CPDA: 138.7
Propionyl-CoA: 131.4
Malonyl-CoA: 109.2
CHC-CoA: 99.9
Isobutyryl-CoA: 72.5
Benzoyl-CoA: 49.0
Acetyl-CoA: 44.4
fatty_acid: 37.3
inactive: 24.8
3-Methylbutyryl-CoA: 22.6

P696_RS0102975: mmal - mal

PKS_AT (563..857): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.8
Ethylmalonyl-CoA: 205.4
Methoxymalonyl-CoA: 169.7
2-Methylbutyryl-CoA: 152.1
trans-1,2-CPDA: 138.6
Propionyl-CoA: 124.3
Malonyl-CoA: 110.6
CHC-CoA: 98.5
Isobutyryl-CoA: 73.6
Benzoyl-CoA: 59.0
Acetyl-CoA: 53.3
fatty_acid: 40.2
inactive: 28.5
3-Methylbutyryl-CoA: 23.3

PKS_AT (2274..2553): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.5
Methoxymalonyl-CoA: 81.6
Methylmalonyl-CoA: 77.8
inactive: 76.2
Isobutyryl-CoA: 42.8
Acetyl-CoA: 40.7
Ethylmalonyl-CoA: 40.6
Propionyl-CoA: 40.0
fatty_acid: 30.6
trans-1,2-CPDA: 23.1
CHC-CoA: 18.2
Benzoyl-CoA: 16.4
2-Methylbutyryl-CoA: 14.2
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_JADG01000004.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 351,289 - 372,377 nt. (total: 21,089 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

P696_RS0106260: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

P696_RS0106265: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: phosphorylase

P696_RS0106250: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Lyases: decarboxylase

P696_RS0106225: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: synthetase

P696_RS0106220: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.40	other (other)	melanin	Streptomyces avermitilis
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000677.5	0.43	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001456.3	0.41	terpene	isorenieratene	Streptomyces argillaceus
BGC0000664.5	0.41	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000649.3	0.40	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.40	other (other)	melanin	Streptomyces avermitilis
BGC0000633.3	0.40	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.40	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0002345.2	0.40	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001485.4	0.40	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

P696_RS0106220: PT_FPPS_like

Domain 1 (55 - 356): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 24.00 out of 24.78

Confidence: strong

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 25.93 out of 29.65

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.03 out of 30.11

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.27 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.27 out of 30.22

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.57 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response

NZ_JADG01000004.1 - Region 2 - CDPS

Download region GenBank file

Download region SVG

Location: 381,139 - 401,828 nt. (total: 20,690 nt) Show pHMM detection rules used

CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

P696_RS0106375: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

Transferases: methyltransferase sulfotransferase

P696_RS0106355: methyltransferase

smcogs: SMCOG1089: methyltransferase

P696_RS43675: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

Hydrolases: hydrolase

P696_RS0106400: isochorismatase

smcogs: SMCOG1027: isochorismatase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000851.5	0.65	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001986.3	0.59	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001592.5	0.44	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.43	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000902.4	0.43	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001483.4	0.38	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002387.2	0.36	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002509.3	0.36	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0002545.3	0.35	PKS	sungeidine C, sungeidine B, sungeidine D, sungeidine H, sungeidine A, sungeidine E, sungeidine F, sungeidine G	Micromonospora sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000851.5	0.65	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0001986.3	0.59	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001592.5	0.44	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000889.5	0.43	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000902.4	0.43	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.40	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001483.4	0.38	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002387.2	0.36	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002509.3	0.36	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0002545.3	0.35	PKS	sungeidine C, sungeidine B, sungeidine D, sungeidine H, sungeidine A, sungeidine E, sungeidine F, sungeidine G	Micromonospora sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 25.87 out of 27.04

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.57 out of 27.04

Confidence: medium

Additional weak hits (5):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.37 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.48 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.42 out of 26.85

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.97 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor

NZ_JADG01000004.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 490,411 - 511,448 nt. (total: 21,038 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase hydratase

P696_RS0106885: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

P696_RS43785: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000280.5	0.40	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000548.4	0.40	ribosomal	salivaricin A	Streptococcus salivarius
BGC0002313.3	0.39	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002116.3	0.37	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0000281.3	0.37	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002425.3	0.37	ribosomal	stlassin	Streptomyces sp.
BGC0000488.4	0.37	ribosomal	circularin A	Clostridium beijerinckii
BGC0001391.3	0.36	ribosomal	thusin	Bacillus thuringiensis serovar rongseni
BGC0000547.5	0.36	ribosomal	salivaricin 9	Streptococcus salivarius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000501.3	0.41	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000280.5	0.40	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0000548.4	0.40	ribosomal	salivaricin A	Streptococcus salivarius
BGC0002313.3	0.39	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0002116.3	0.37	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0000281.3	0.37	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002425.3	0.37	ribosomal	stlassin	Streptomyces sp.
BGC0000488.4	0.37	ribosomal	circularin A	Clostridium beijerinckii
BGC0001391.3	0.36	ribosomal	thusin	Bacillus thuringiensis serovar rongseni
BGC0000547.5	0.36	ribosomal	salivaricin 9	Streptococcus salivarius

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

P696_RS43785: T1TS

Domain 1 (17 - 321): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 28.86 out of 35.63

Confidence: medium

Additional weak hits (9):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.29 out of 29.51

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.21 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.68 out of 29.38

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.94 out of 30.98

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
NrtR	NAD synthesis repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_KI912411.1 - Region 1 - NRPS-like,T2PKS

Download region GenBank file

Download region SVG

Location: 163,443 - 256,616 nt. (total: 93,174 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

P696_RS0137870: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

P696_RS0137875: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

P696_RS0137890: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

P696_RS0137895: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS0137900: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

P696_RS0137955: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

P696_RS0137960: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS0137995: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

P696_RS0138010: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS0138025: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

P696_RS0138055: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

P696_RS0137905: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: deacetylase glucanase glucosidase hydrolase

P696_RS0138165: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

P696_RS50855: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

P696_RS50885: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

P696_RS55325: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: cyclase

P696_RS0137920: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Isomerases: racemase

P696_RS0138125: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

P696_RS0137880: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

P696_RS0137935: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

P696_RS0137940: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

P696_RS0138090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

P696_RS58970: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000231.5	0.51	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001723.5	0.39	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	0.39	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000894.4	0.33	other (other)	citrinin	Monascus aurantiacus
BGC0000218.5	0.33	PKS	doxorubicin	Streptomyces peucetius
BGC0001928.2	0.32	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002047.2	0.32	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002285.2	0.32	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000275.4	0.32	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.69	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0002277.2	0.64	NRPS	atromentin	Suillus grevillei
BGC0000272.3	0.64	PKS	spore pigment	Streptomyces collinus
BGC0002274.2	0.64	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0002193.2	0.64	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 24.49 out of 30.22

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (27):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.52 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.59 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.20 out of 21.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.19 out of 25.88

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.12 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.83 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.83 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.52 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.16 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.86 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.04 out of 23.43

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.64 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.82 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.44 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.82 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.59 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.53 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.94 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.47 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.51 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 163442 - 256616:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 163442 - 235970:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 213820 - 256616:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS0138090: fatty_acid

CAL_domain (41..449): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 13.1
shikimic_acid: 0.0
NH2: 0.0
Acetyl-CoA: 0.0
AHBA: -2.0

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 163442 to 235970
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 7 (Score: 604.3; E-value: 2.1e-184)
Product molecular weight(s):: acetyl-CoA_7: 327 Da

P696_RS0137885: MET (Score: 26.0; E-value: 1.1e-08)
P696_RS0137895: KR (Score: 207.6; E-value: 6.2e-64)
P696_RS0137905: MET (Score: 162.5; E-value: 3.2e-50)
P696_RS0137920: CYC C7-C12 (Score: 116.7; E-value: 2.2e-36)
P696_RS0137925: CYC C5-C14/C3-C16 (Score: 328.3; E-value: 7.4e-101)
P696_RS0137935: KS (Score: 755.4; E-value: 3.5e-230)
P696_RS0137940: CLF 7 (Score: 604.3; E-value: 2.1e-184)
P696_RS0137945: ACP (Score: 90.7; E-value: 1.1e-28)
P696_RS0137960: KR (Score: 203.4; E-value: 1.1e-62)
P696_RS0138010: KR (Score: 137.2; E-value: 1.8e-42)
P696_RS0138055: KR (Score: 154.6; E-value: 9.1e-48)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
ClgR	Caseinolytic protease gene regulator

NZ_KI912411.1 - Region 2 - PKS-like,terpene

Download region GenBank file

Download region SVG

Location: 336,663 - 392,079 nt. (total: 55,417 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase phosphate reductase

P696_RS0138485: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

P696_RS0138540: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

P696_RS0138580: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS0138610: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

Transferases: acetyltransferase kinase methyltransferase transketolase

P696_RS0138500: methyltransferase

smcogs: SMCOG1089: methyltransferase

P696_RS0138590: transketolase

smcogs: SMCOG1204: transketolase

P696_RS0138615: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

P696_RS0138715: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

P696_RS53395: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: deacetylase esterase hydrolase

P696_RS0138550: putative esterase

smcogs: SMCOG1104: putative esterase

P696_RS0138555: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

P696_RS0138620: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: cyclase dehydratase

P696_RS0138490: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

P696_RS55355: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase

P696_RS0138545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS0138560: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS0138570: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

P696_RS50980: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001374.5	0.27	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000563.4	0.27	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001135.5	0.27	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.27	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001226.4	0.27	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000307.4	0.27	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.26	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.26	NRPS	enniatin	Fusarium equiseti
BGC0000503.5	0.26	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000496.5	0.26	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.60	NRPS	enniatin	Fusarium equiseti
BGC0001250.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.59	NRPS	epichloenin A	Epichloe festucae
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

P696_RS55355: T1TS

Domain 1 (59 - 362): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.58 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.81 out of 20.97

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.37 out of 26.85

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.96 out of 29.51

Confidence: medium

Additional weak hits (14):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.62 out of 20.01

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.14 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.72 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.07 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.74 out of 29.38

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.45 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.84 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.37 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.30 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.67 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.75 out of 30.98

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

P696_RS0138545: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (8..425): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWTAFDLSVLDAYSLFAGEYNLYGPTETNVCLFH
Nearest Stachelhaus code(s):: Pro DLLYLALVCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

P696_RS0138560: X

AMP-binding (27..442): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SGTTYTGLVQGLYCITGSAHSLWGMTENGVTVTR
Nearest Stachelhaus code(s):: Pro DVQYIAHVTK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
DosR	Hypoxia stress response regulator
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

NZ_KI912411.1 - Region 3 - hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 535,134 - 548,059 nt. (total: 12,926 nt) Show pHMM detection rules used

hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

P696_RS0139380: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

P696_RS0139400: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

P696_RS0139410: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

P696_RS0139420: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS0139430: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Translocases: permease

P696_RS51195: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.53	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000932.5	0.36	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0000888.5	0.35	other (other)	bacilysin	Bacillus sp. CS93
BGC0002474.2	0.35	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001184.4	0.33	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001502.4	0.33	NRPS	amonabactin P 750	Aeromonas hydrophila subsp. hydrophila ATCC 7966
BGC0002478.3	0.32	PKS	rubiginone A2, rubiginone J, rubiginone K, rubiginone L, rubiginone M, rubiginone N, ochromycinone, rubiginone B2	Streptomyces sp. CB02414
BGC0001625.5	0.32	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.53	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001364.3	0.36	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000932.5	0.36	other (other)	tropodithietic acid, hydroxytropodithietic acid	Phaeobacter inhibens DSM 17395
BGC0000888.5	0.35	other (other)	bacilysin	Bacillus sp. CS93
BGC0002474.2	0.35	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001184.4	0.33	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0001502.4	0.33	NRPS	amonabactin P 750	Aeromonas hydrophila subsp. hydrophila ATCC 7966
BGC0002478.3	0.32	PKS	rubiginone A2, rubiginone J, rubiginone K, rubiginone L, rubiginone M, rubiginone N, ochromycinone, rubiginone B2	Streptomyces sp. CB02414
BGC0001625.5	0.32	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.95 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.28 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.74 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.59 out of 28.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KI912411.1 - Region 4 - T1PKS,terpene

Download region GenBank file

Download region SVG

Location: 576,529 - 635,771 nt. (total: 59,243 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

P696_RS0139635: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

P696_RS0139640: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

P696_RS51265: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

P696_RS51295: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: aminotransferase glycosyltransferase kinase methyltransferase

P696_RS0139590: methyltransferase

smcogs: SMCOG1089: methyltransferase

P696_RS0139630: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

P696_RS0139655: methyltransferase

smcogs: SMCOG1089: methyltransferase

P696_RS0139745: methyltransferase

smcogs: SMCOG1089: methyltransferase

P696_RS0139760: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

P696_RS51290: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: hydrolase

P696_RS57720: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase lyase

P696_RS0139540: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

P696_RS51250: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

P696_RS0139685: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.53	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.53	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000056.3	0.40	PKS	esperamicin	Actinomadura verrucosospora
BGC0000207.5	0.28	PKS	chartreusin	Streptomyces chartreusis
BGC0001244.3	0.26	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.24	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002000.4	0.24	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002012.4	0.23	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0000657.5	0.23	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001257.3	0.22	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000658.3	0.80	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.80	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000056.3	0.72	PKS	esperamicin	Actinomadura verrucosospora
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000657.5	0.56	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001257.3	0.56	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.55	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000107.3	0.55	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002284.3	0.55	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene		2-methylisoborneol	C11	C1-C6	OH
monoterpene		2-methylenebornane	C11	C1-C6	none

Genes with terpene domains:

P696_RS51250: T1TS

Domain 1 (77 - 422): Type 1 terpene synthase

Subtype: 2-Methylisoborneol synthase type

Reactions:: 2-MeGPP → 2-methylisoborneol; 2-MeGPP → 2-methylenebornane

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 17.99 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.98 out of 23.79

Confidence: medium

Additional weak hits (20):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.21 out of 30.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.08 out of 21.55

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.94 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.51 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.91 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.40 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.76 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.88 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.71 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.10 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.15 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.94 out of 28.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.03 out of 36.53

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Terpene

TFBS Finder

NRPS/PKS substrate predictions

P696_RS0139685: mal

PKS_AT (618..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 74.7
Methoxymalonyl-CoA: 44.5
Methylmalonyl-CoA: 39.2
inactive: 32.0
fatty_acid: 18.3
Ethylmalonyl-CoA: 12.6
Isobutyryl-CoA: 7.9
Propionyl-CoA: 0.6
CHC-CoA: 0.6
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -0.2

Link to PARAS substrate predictor

Glossary

Acronym	Full name
2-MeGPP	2-methylgeranyl diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_JADG01000007.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 78,730 - 125,155 nt. (total: 46,426 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

P696_RS0109750: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS0109795: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

P696_RS0109815: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

P696_RS44380: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

P696_RS0109830: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Hydrolases: esterase

P696_RS0109915: putative esterase

smcogs: SMCOG1104: putative esterase

Translocases: transport

P696_RS0109920: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.00 out of 29.51

Confidence: medium

Additional weak hits (8):

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.97 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.38 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.76 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.84 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 78729 - 125155:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS44380: pk

PKS_AT (628..924): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 109.4
Ethylmalonyl-CoA: 89.2
Methoxymalonyl-CoA: 83.7
fatty_acid: 70.6
Propionyl-CoA: 63.9
2-Methylbutyryl-CoA: 58.1
Isobutyryl-CoA: 55.3
Acetyl-CoA: 45.7
trans-1,2-CPDA: 45.6
CHC-CoA: 31.1
3-Methylbutyryl-CoA: 29.1
inactive: 24.7
Benzoyl-CoA: 18.8
Malonyl-CoA: -2.8

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
DosR	Hypoxia stress response regulator

NZ_JADG01000008.1 - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 393,685 - 416,429 nt. (total: 22,745 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

P696_RS0113750: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

Lyases: dehydratase

P696_RS0113665: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

P696_RS0113670: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.53	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.5	0.65	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.65	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000496.5	0.63	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000501.3	0.60	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000553.3	0.53	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000518.3	0.53	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002698.2	0.51	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002111.3	0.49	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for P696_RS45245

P696_RS55875

Leader:

MALLDLQGLQAPTASGGAS

Core:

GGSGLTIVTCASHTPSNLSLALCH

Core with dehydrations:

GGDhaGLDhbIVDhbCysADhaHDhbPDhaNLDhaLALCysH

antiSMASH-DB 4.0 matches for P696_RS55875

100.0%

NZ_JADG01000008.1:

Lanthipeptides: P696_RS55875_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGSGLTIVTCASHTPSNLSLALCH

1

GGSGLTIVTCASHTPSNLSLALCH

24

79.2%

NZ_JAKRKC020000001.1:

Lanthipeptides: MF672_RS25655_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT+ TC SHTPSNLS+ALCH

1

GGSSLTVATCGSHTPSNLSVALCH

24

73.1%

NZ_CP043661.1and 1 other:

NZ_SOCE01000001.1 Lanthipeptides: EV138_RS20105_lanthipeptide

Lanthipeptides: F1D05_RS17325_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT++ CASHTPSNLSL LCH

3

GGSTLTVLGCASHTPSNLSLLLCH

26

with 53 more sequence matches

Only the first 10 are displayed here.

72.0%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31650_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT++ CAS TPSNLSL LCH

2

GGSTLTVLGCASVTPSNLSLVLCH

25

72.0%

NZ_SHKR01000011.1and 7 others:

NZ_SLWR01000003.1 Lanthipeptides: EV646_RS09945_lanthipeptideNZ_SNWS01000006.1 Lanthipeptides: EV651_RS15130_lanthipeptideNZ_SODF01000002.1 Lanthipeptides: EV650_RS20180_lanthipeptideNZ_SODP01000004.1 Lanthipeptides: EV653_RS35635_lanthipeptideNZ_SODT01000012.1 Lanthipeptides: EV647_RS27100_lanthipeptideNZ_SODU01000003.1 Lanthipeptides: EV137_RS31660_lanthipeptideNZ_SZPZ01000003.1 Lanthipeptides: FDA38_RS24670_lanthipeptide

Lanthipeptides: EV645_RS10765_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT++ CAS TPSNLSL LCH

2

GGSTLTVLGCASQTPSNLSLLLCH

25

70.8%

NZ_JACDUR010000006.1and 2 others:

NZ_JPMW01000001.1 Lanthipeptides: EV45_RS41010_lanthipeptideNZ_JPMW01000001.1 Lanthipeptides: EV45_RS41005_lanthipeptide

Lanthipeptides: HNR30_RS31115_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT +TC S PSNLS+ALCH

1

GGSTLTALTCNSGKPSNLSVALCH

24

70.8%

NZ_JACHIN010000017.1:

Lanthipeptides: HNR40_RS44190_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT++TC S PSNLS+ALCH

1

GGSTLTVLTCHSGKPSNLSVALCH

24

70.8%

NZ_JACHJP010000003.1and 2 others:

NZ_JACHJP010000003.1 Lanthipeptides: FHS44_RS18405_lanthipeptideNZ_JACHJP010000003.1 Lanthipeptides: FHS44_RS18400_lanthipeptide

Lanthipeptides: FHS44_RS18410_lanthipeptide

2

GSGLTIVTCASHTPSNLSLALCH

24

GS LT++ C SHTPSNLSL LCH

1

GSTLTVLGCESHTPSNLSLVLCH

23

70.8%

NZ_JACJIA010000018.1:

Lanthipeptides: HNR61_RS42145_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT TC S PSNLS+ALCH

1

GGSSLTAATCGSTKPSNLSVALCH

24

70.8%

NZ_JAHFZZ010000011.1:

Lanthipeptides: KLK06_RS32640_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT +TC S PSNLS+ALCH

1

GGSTLTALTCQSGHPSNLSVALCH

24

70.8%

NZ_WBMT01000033.1:

Lanthipeptides: F8566_RS47085_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT++TC S PSNLS ALCH

1

GGSTLTLLTCHSGKPSNLSAALCH

24

69.2%

NZ_CP029711.1:

Lanthipeptides: DKM19_RS31645_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT++ CAS TPSNLSL LCH

3

GGSTLTVLGCASVTPSNLSLILCH

26

66.7%

NZ_CP017717.1and 2 others:

NZ_FNDJ01000002.1 Lanthipeptides: BLS95_RS05705_lanthipeptideNZ_FNVT01000002.1 Lanthipeptides: C4V41_RS07345_lanthipeptide

Lanthipeptides: BKM31_RS59280_lanthipeptide

1

GGSGLTIVTCASHTPSNLSLALCH

24

GGS LT+++C S PSNLS+ALCH

1

GGSTLTVLSCHSGKPSNLSVALCH

24

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.79 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.53 out of 23.79

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.03 out of 29.72

Confidence: medium

Additional weak hits (1):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.56 out of 28.19

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

P696_RS55875 - Class III

Cleavage pHMM score: 7.10

RODEO score: 0

Monoisotopic mass: 2212.1 Da

Molecular weight: 2213.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2231.5 Da N = 1; 2249.5 Da N = 2; 2267.6 Da N = 3; 2285.6 Da N = 4; 2303.6 Da N = 5

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_JADG01000009.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 29,204 nt. (total: 29,204 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthase

P696_RS0114280: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

P696_RS58750: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0000037.4	0.60	PKS	cichorine	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

Additional weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.88 out of 29.38

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.03 out of 30.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.57 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 29204:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS0114280: mmal

PKS_AT (530..833): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 197.2
Ethylmalonyl-CoA: 185.6
Methoxymalonyl-CoA: 170.4
2-Methylbutyryl-CoA: 131.6
Propionyl-CoA: 111.9
trans-1,2-CPDA: 111.1
Malonyl-CoA: 103.0
Isobutyryl-CoA: 86.9
CHC-CoA: 86.3
Benzoyl-CoA: 64.6
Acetyl-CoA: 51.9
inactive: 41.5
fatty_acid: 30.4
3-Methylbutyryl-CoA: 24.8

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_JADG01000009.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 117,711 - 213,714 nt. (total: 96,004 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

P696_RS0114895: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase halogenase

P696_RS0114845: flavin-dependent tyrosine-like hpg halogenase

halogenases: flavin-dependent tyrosine-like hpg halogenase
MITE: MITE0000040Halogenation (identity: 69.90%)
smcogs: SMCOG1119: halogenase

P696_RS45600: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase

P696_RS0114880: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS45575: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

P696_RS45580: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS45585: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002071.2	0.74	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001641.4	0.74	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001758.4	0.76	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002071.2	0.74	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001641.4	0.74	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (9):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.28 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.94 out of 31.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.14 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.67 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.58 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.26 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.64 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 117710 - 213714:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Asp - Thr - Hpg - Hpg - D-Hpg) + (Thr - Ser - Ser - Hpg - D-Hpg) + (Hpg - Hpg - D-Phe) + (Pro - Thr - Ala)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS45575: Pro - Thr - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (471..881): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHTFDVSVQESFAAQAGEHNHYGPTETHVATAA
Nearest Stachelhaus code(s):: Pro DVQFAAHVVK (91% 8Å match); 4Me-Pro DVQFIAHVAK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1552..1969): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFSVWEGSQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2639..3042): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWAVFDLSVFDTNTLLAGEVNLYGLTETAVFSTA
Nearest Stachelhaus code(s):: Ala DVFNLALVFK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

P696_RS0114880: Hpg - Hpg - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (479..873): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASVFEVHVLTGGDRHLYGPTEITLCATG
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1536..1912): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASVFEAHVLTGGDRHLYGPTEITLCATG
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2577..2978): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LAHAFDAAVWEMTLVVAGEVNAYGPTETTVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (94% 8Å match); Ph-Ser DAWTVAAVCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

P696_RS45580: Thr - Ser - Ser - Hpg - Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFSVWEGSQVFGGEVNMYGITETTVHVTE
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1516..1911): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFMCSGEHNLYGPTEASVDVTH
Nearest Stachelhaus code(s):: Ser DVWHMSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2554..2953): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFLCSGEHNLYGPTEASVDVTH
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3611..3996): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASVYEVHLLTGGDRHLYGPTEITLCATG
Nearest Stachelhaus code(s):: Hpg DAYHLGLLCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4656..5049): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASVFEVHVLTGGDRHLYGPTEITLCATG
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

P696_RS45585: Asp - Thr - Hpg - Hpg - Hpg

Search NORINE for peptide: strict or relaxed

AMP-binding (441..836): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YFSSFDLTVTGTKVVVGGEVNAYGPTELTVNCAQ
Nearest Stachelhaus code(s):: Asp DLTKVGAVNK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1495..1894): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFSVWEGSQVFGGEVNMYGITETTVHVTE
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2938): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASVLEVHVLTGGDRHLYGPTEITLCATG
Nearest Stachelhaus code(s):: Hpg DALHLGLLCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3601..3989): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASLFEVHVLTGGDRHLYGPTEITLCATG
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4646..5026): Hpg

nrpys: Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Polar, uncharged (hydroxy-phenyl) (Dhpg, Hpg)
Single AA prediction:: hpg (Hpg)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPAFDASVFEVHVLTGGDRHLYGPTEITLCATG
Nearest Stachelhaus code(s):: Hpg DAFHLGLLCK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein

NZ_JADG01000009.1 - Region 3 - T3PKS,terpene-precursor

Download region GenBank file

Download region SVG

Location: 321,042 - 368,363 nt. (total: 47,322 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

P696_RS0115475: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

P696_RS0115580: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase glycosyltransferase sulfotransferase

P696_RS0115450: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

P696_RS0115540: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

P696_RS45725: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: dehalogenase

P696_RS0115480: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase

P696_RS0115460: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase synthetase

P696_RS0115470: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

P696_RS45745: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transport

P696_RS45755: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.36	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.36	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002736.2	0.36	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0002007.2	0.29	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001528.4	0.28	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0000677.5	0.28	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.26	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000678.5	0.26	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001529.5	0.25	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000906.3	0.24	other (other)	heme D1	Heliophilum fasciatum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002127.3	0.55	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001310.5	0.54	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000902.4	0.54	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.51	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0002462.3	0.50	saccharide	coformycin	Streptomyces kaniharaensis
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0001078.5	0.47	PKS, terpene	furaquinocin B	Streptomyces sp. KO-3988
BGC0002007.2	0.46	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

P696_RS0115470: PT_FPPS_like

Domain 1 (61 - 353): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 20.57 out of 25.31

Confidence: medium

Additional weak hits (14):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.14 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.02 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.50 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.19 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.01 out of 30.11

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.24 out of 29.51

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.68 out of 32.74

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.20 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.13 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.13 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.26 out of 27.18

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
OsdR	Development and stress management regulator

NZ_JADG01000010.1 - Region 1 - ectoine,terpene

Download region GenBank file

Download region SVG

Location: 3,418 - 28,167 nt. (total: 24,750 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

P696_RS0116115: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

P696_RS0116125: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: aminotransferase

P696_RS0116195: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase

P696_RS0116150: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

P696_RS0116205: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

P696_RS45900: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	1.12	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	1.12	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.76	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000860.3	0.65	other (other)	ectoine	Methylarcula marina
BGC0000856.3	0.63	other (other)	ectoine	Methylophaga thalassica
BGC0001181.4	0.55	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000854.3	0.45	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000855.3	0.44	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.44	other (other)	ectoine	Methylomicrobium alcaliphilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.82	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.82	other (ectoine)	ectoine	Streptomyces sp.
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000860.3	0.68	other (other)	ectoine	Methylarcula marina
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.65	other (other)	ectoine	Methylophaga thalassica
BGC0000854.3	0.57	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000855.3	0.55	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.55	other (other)	ectoine	Methylomicrobium alcaliphilum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

P696_RS45900: T1TS + T1TS

Domain 1 (7 - 332): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (333 - 713): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.43 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 28.31 out of 30.12

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 28.31 out of 30.12

Confidence: strong

Additional weak hits (10):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.83 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.06 out of 28.19

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.70 out of 30.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.74 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 36.53

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.66 out of 23.43

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.49 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.92 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
OsdR	Development and stress management regulator

NZ_JADG01000010.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 85,635 - 110,544 nt. (total: 24,910 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

P696_RS46000: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: hydratase

P696_RS45985: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.63	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001493.5	0.63	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001548.4	0.62	ribosomal	citrulassin A	Streptomyces albulus
BGC0002053.3	0.62	ribosomal	ulleungdin	Streptomyces sp.
BGC0001655.3	0.61	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001549.3	0.60	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001552.3	0.59	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001507.3	0.59	ribosomal	anantin C	Streptomyces olindensis
BGC0001551.4	0.58	ribosomal	citrulassin E	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001539.4	0.63	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001493.5	0.63	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001548.4	0.62	ribosomal	citrulassin A	Streptomyces albulus
BGC0002053.3	0.62	ribosomal	ulleungdin	Streptomyces sp.
BGC0001655.3	0.61	ribosomal	LP2006	Nocardiopsis alba DSM 43377
BGC0001549.3	0.60	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001506.5	0.60	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001552.3	0.59	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001507.3	0.59	ribosomal	anantin C	Streptomyces olindensis
BGC0001551.4	0.58	ribosomal	citrulassin E	Streptomyces glaucescens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

Additional weak hits (3):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.15 out of 32.74

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.83 out of 29.65

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 24 - 92; Score: 55.6

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JADG01000010.1 - Region 3 - RiPP-like

Download region GenBank file

Download region SVG

Location: 285,457 - 296,449 nt. (total: 10,993 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

P696_RS46275: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.58	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.58	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001201.3	0.53	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.51	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001948.3	0.50	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001224.5	0.43	other (other)	reductasporine	uncultured bacterium
BGC0000902.4	0.43	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001779.5	0.41	ribosomal	siamycin	Streptomyces nodosus
BGC0001336.5	0.40	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002084.4	0.58	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0002099.3	0.58	ribosomal	biarylitide YFH	Planomonospora sp. ID107089
BGC0001201.3	0.53	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.51	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001948.3	0.50	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001224.5	0.43	other (other)	reductasporine	uncultured bacterium
BGC0000902.4	0.43	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000563.4	0.42	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0001779.5	0.41	ribosomal	siamycin	Streptomyces nodosus
BGC0001336.5	0.40	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 19.26

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.09 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.93 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.13 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.63 out of 32.74

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.11 out of 30.22

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.69 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_JADG01000010.1 - Region 4 - NRPS,T1PKS,hglE-KS,lassopeptide,redox-cofactor,terpene

Download region GenBank file

Download region SVG

Location: 302,733 - 420,993 nt. (total: 118,261 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)
redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

P696_RS0117635: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

P696_RS0117765: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS0117785: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

P696_RS0118050: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

P696_RS0118055: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS46320: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

P696_RS46395: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase glycosyltransferase kinase methyltransferase

P696_RS0117630: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

P696_RS0117705: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

P696_RS0117725: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

P696_RS0117920: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: dehalogenase hydrolase

P696_RS0117850: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

P696_RS0117970: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

P696_RS46340: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: racemase

P696_RS0117760: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

P696_RS0117650: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS0117675: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS0118035: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

P696_RS46335: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS58780: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	1.24	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	1.14	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	1.14	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001273.3	1.10	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	1.09	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	1.09	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	1.09	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001135.5	1.08	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	1.07	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	1.05	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.75	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001552.3	0.71	ribosomal	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001050.5	0.71	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

P696_RS46390: TS_Pyr4

Domain 1 (11 - 209): Pyr4 type terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.91 out of 23.43

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (38):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.60 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.11 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.70 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.33 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.57 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.25 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.10 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.38 out of 20.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.00 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.40 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.45 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.50 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.97 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.85 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.52 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.91 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.73 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.01 out of 39.62

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.42 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.93 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.23 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.99 out of 36.53

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.21 out of 27.04

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.47 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.06 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.95 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.91 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.78 out of 23.43

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.17 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.79 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.09 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.35 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.99 out of 36.53

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lasso peptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

Terpene

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 6, location 302732 - 420993:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X - X) + (Asp - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 302732 - 355703:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X - X) + (Asp - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 324163 - 375420:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X - X) + (Asp - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS0117650: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (5..397): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: FALPLPDLMAQWIGLYGGTMQNYGSSEAALIATL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

P696_RS46335: Asp - X

Search NORINE for peptide: strict or relaxed

AMP-binding (469..841): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YAVSADLGLLNGKCVLAGEQVHYGPTETTVSVLG
Nearest Stachelhaus code(s):: OH-Asp DLTKVGHVGK (71% 8Å match); Asp DLTKVGHVGK (68% 8Å match); Glu DLVKVASVNK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1456..1839): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YGVSADLGMLNGKCVLAGEQVHYGPTETTVAVLT
Nearest Stachelhaus code(s):: Asp DLTKVGHVGK (74% 8Å match); Glu DLVKVASVNK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

P696_RS0117675: X - X

AMP-binding (7..382): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWLTFDPSVMEGGGYSGGEFNCYGPTECTTQVLV
Nearest Stachelhaus code(s):: Ile DAMFMGCTFK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1024..1407): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAVAFDMSSFEAIALIGGEWNVYGPSEVTVVSTV
Nearest Stachelhaus code(s):: Ile DGFFLGVVYK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

P696_RS58780: mal

PKS_AT (609..826): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 20.0
Methylmalonyl-CoA: 10.2
inactive: 9.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

P696_RS0117725: mal

PKS_AT (1203..1496): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 59.0
Methoxymalonyl-CoA: 33.7
Methylmalonyl-CoA: 29.3
trans-1,2-CPDA: 19.4
Propionyl-CoA: 16.7
CHC-CoA: 10.8
inactive: 8.8
Ethylmalonyl-CoA: 8.3
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

RRE predictions

: RRE type: PqqD_RRE; Location: 40 - 122; Score: 67.8; RRE type: Stand_Alone_Lasso_RRE; Location: 3 - 80; Score: 73.2
: RRE type: Stand_Alone_Lasso_RRE; Location: 3 - 80; Score: 73.2

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
BldD	Development and antibiotic global regulator
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_JADG01000011.1 - Region 1 - azole-containing-RiPP,other,thioamitides

Download region GenBank file

Download region SVG

Location: 150,792 - 219,256 nt. (total: 68,465 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
thioamitides: ((YcaO or TIGR03604) and TfuA)
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

P696_RS0118925: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

P696_RS0119120: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS46620: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS59080: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: acetyltransferase

P696_RS0119175: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: protease

P696_RS46695: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: dehydratase

P696_RS58210: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000613.5	0.59	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001640.3	0.55	ribosomal	kocurin	Kocuria rosea
BGC0001860.4	0.53	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0001145.5	0.52	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001155.5	0.48	ribosomal	GE2270	Planobispora rosea
BGC0000603.5	0.48	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000604.4	0.47	ribosomal	GE2270A	Nonomuraea sp. WU8817
BGC0001849.4	0.45	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0000625.5	0.44	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0001928.2	0.44	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000613.5	0.63	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001640.3	0.62	ribosomal	kocurin	Kocuria rosea
BGC0001860.4	0.60	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0001145.5	0.60	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001849.4	0.59	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0001155.5	0.58	ribosomal	GE2270	Planobispora rosea
BGC0000604.4	0.58	ribosomal	GE2270A	Nonomuraea sp. WU8817
BGC0000605.5	0.56	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002560.3	0.54	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 26.85

Confidence: medium

Additional weak hits (10):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.63 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.52 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.25 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.24 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.45 out of 35.63

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.18 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 0 - 80; Score: 75.8
: RRE type: Thiopeptide_F_RRE; Location: 0 - 80; Score: 75.8

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism

Core peptide predictions

No core peptides found.

NZ_JADG01000011.1 - Region 2 - NRPS,T1PKS,other,polyhalogenated-pyrrole

Download region GenBank file

Download region SVG

Location: 245,133 - 346,701 nt. (total: 101,569 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
polyhalogenated-pyrrole: (Abhydrolase_6 and Trp_halogenase and (Acyl-CoA_dh_N or Acyl-CoA_dh_M or Acyl-CoA_dh_1) and AMP-binding)
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxidoreductase oxygenase

P696_RS0119320: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

P696_RS0119410: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

P696_RS0119420: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

P696_RS0119475: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

P696_RS0119490: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

P696_RS0119495: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

P696_RS0119515: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

P696_RS0119570: flavodoxin

smcogs: SMCOG1134: flavodoxin

P696_RS0119585: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

P696_RS0119625: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

P696_RS0119645: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

P696_RS46725: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

P696_RS46760: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

Transferases: acylase aminotransferase glycosyltransferase halogenase kinase transferase

P696_RS0119340: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

P696_RS0119385: flavin-dependent tyrosine-like hpg halogenase

halogenases: flavin-dependent tyrosine-like hpg halogenase
MITE: MITE0000040Halogenation (identity: 61.70%)
smcogs: SMCOG1119: halogenase

P696_RS0119415: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

P696_RS0119430: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

P696_RS0119440: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

P696_RS0119540: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

P696_RS0119605: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

P696_RS0119650: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: dehalogenase hydrolase

P696_RS0119445: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

P696_RS0119575: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: dehydratase

P696_RS0119500: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

P696_RS0119480: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

P696_RS0119525: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

P696_RS0119530: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS46740: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

P696_RS0119535: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	1.34	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	1.19	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	1.16	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001268.4	1.10	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002135.2	0.99	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001275.3	0.97	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.97	PKS	asperlactone	Aspergillus ochraceus
BGC0002341.2	0.96	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001244.3	0.95	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001240.4	0.91	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.78	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.78	PKS	asperlactone	Aspergillus ochraceus
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001244.3	0.77	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001276.3	0.68	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001268.4	0.65	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.13 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 21.84 out of 21.84

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.89 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 30.11

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.76 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.58 out of 23.79

Confidence: medium

Additional weak hits (32):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.22 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.10 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.93 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.16 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.73 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.24 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.35 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.12 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.47 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.91 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.29 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 25.75

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.17 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.40 out of 32.74

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.54 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.99 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.96 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.81 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.12 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.55 out of 18.57

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.21 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.94 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.93 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.49 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.64 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.11 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 245132 - 346701:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 245132 - 289474:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 276801 - 346701:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS46740: X

AMP-binding (439..845): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWMVHDPSLCEAQTVLMGEFNAYGPTE-TIAATW
Nearest Stachelhaus code(s):: bTyr or bTyr DPAQLMLIAK (85% 8Å match)
Stachelhaus code match:: 70% (weak)

P696_RS0119525: pk

PKS_AT (531..821): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 124.1
Methoxymalonyl-CoA: 103.7
Ethylmalonyl-CoA: 100.8
Malonyl-CoA: 84.3
Isobutyryl-CoA: 67.4
2-Methylbutyryl-CoA: 58.9
Propionyl-CoA: 54.5
3-Methylbutyryl-CoA: 54.5
trans-1,2-CPDA: 50.6
Acetyl-CoA: 38.9
Benzoyl-CoA: 37.5
fatty_acid: 36.5
inactive: 33.6
CHC-CoA: 29.5

P696_RS0119530: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (60..474): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NRILFPLANPGGSAQVGGSQQMYGMAEGLICCMP
Nearest Stachelhaus code(s):: meSal PLPSHGVVCK (76% 8Å match); diOH-Bz PLPSQGVVNK (62% 8Å match); n-oh-nitropheBut TLPSQGVVCK (59% 8Å match); Sal PLPGQGIILK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

P696_RS0119605: mal

PKS_AT (657..887): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 91.4
Methoxymalonyl-CoA: 51.4
Methylmalonyl-CoA: 45.0
inactive: 35.8
Propionyl-CoA: 25.9
Ethylmalonyl-CoA: 19.7
trans-1,2-CPDA: 15.2
Isobutyryl-CoA: 13.4
fatty_acid: 11.9
CHC-CoA: 9.1
Benzoyl-CoA: 8.2
Acetyl-CoA: 7.8
2-Methylbutyryl-CoA: 7.3
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_JADG01000011.1 - Region 3 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 401,935 - 425,123 nt. (total: 23,189 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: glucosidase

P696_RS0119990: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Lyases: cyclase

P696_RS0120035: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Ligases: synthase

P696_RS0120070: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Translocases: transporter

P696_RS0120000: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001660.3	0.72	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001535.3	0.69	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001579.4	0.66	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002346.3	0.63	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.59	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001576.3	0.59	ribosomal	divamide A	Prochloron didemni
BGC0001364.3	0.59	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002285.2	0.53	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000528.5	0.51	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001534.3	0.51	other (other)	branched-chain fatty acids	Streptomyces filamentosus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001660.3	0.72	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001535.3	0.69	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001579.4	0.66	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002346.3	0.63	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.59	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001576.3	0.59	ribosomal	divamide A	Prochloron didemni
BGC0001364.3	0.59	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0002285.2	0.53	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000528.5	0.51	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001534.3	0.51	other (other)	branched-chain fatty acids	Streptomyces filamentosus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for P696_RS0120035

P696_RS0120030

Leader:

MTATSILRHAAADADFRSELLERPTDFGVTAVPAG

Core:

VEQPDAEQLGYWTEGVAAVDIYACSSTCSFGPFTIVCDGTTKGQ

Core with dehydrations:

VEQPDAEQLGYWDhbEGVAAVDIYACysDhaDhaDhbCysDhaFGPFDhbIVCysDGDhbDhbKGQ

antiSMASH-DB 4.0 matches for P696_RS0120030

100.0%

NZ_JADG01000011.1:

Lanthipeptides: P696_RS0120030_lanthipeptide

1

VEQPDAEQLGYWTEGVAAVDIYACSSTCSFGPFTIVCDGTTKGQ

44

VEQPDAEQLGYWTEGVAAVDIYACSSTCSFGPFTIVCDGTTKGQ

1

VEQPDAEQLGYWTEGVAAVDIYACSSTCSFGPFTIVCDGTTKGQ

44

72.7%

NZ_JANBBD010000039.1:

Lanthipeptides: BS35_RS35910_lanthipeptide

1

VEQPDAEQLGYWTEGVAAVDIYACSSTCSFGPFTIVCDGTTK

42

V QPD LGYWTEGVAAVD YAC+STCS GPFT CDG+TK

1

VAQPDTASLGYWTEGVAAVDAYACASTCSSGPFTFACDGSTK

42

63.6%

NZ_FUWS01000010.1:

Lanthipeptides: B5D66_RS17810_lanthipeptide

1

VEQPDAEQLGYWTEGVAAVDIYACSSTCSFGPFTIVCDGTTK

42

VE+ D E + +TE V A +IYAC+STCSFGPFTI CDGTTK

1

VERQDHEAIEAFTEAVVASEIYACASTCSFGPFTIACDGTTK

42

with 9 more sequence matches

56.4%

NZ_BMRD01000003.1:

Lanthipeptides: IEZ14_RS08160_lanthipeptide

3

QPDAEQLGYWTEGVAAVDIYACSSTCSFGPFTIVCDGTTK

42

QPD LGYWTEGVAAVD YAC+STCS GPFT CDG+TK

16

QPDTASLGYWTEGVAAVDAYACASTCSSGPFTFACDGSTK

55

34.1%

NZ_JAPFGB010000043.1:

Lanthipeptides: OOZ19_RS28825_lanthipeptide

24

CSSTCSFGPFTIVCDGTTK

42

C+STCS GPFTI+CDG+TK

1

CASTCSSGPFTILCDGSTK

19

29.5%

NZ_CP073318.1:

Lanthipeptides: JJ691_RS07165_lanthipeptide

24

CSSTCSFGPFTIVCDGTTK

42

C +CS+GPFT VCDG TK

1

CVQSCSWGPFTAVCDGNTK

19

27.3%

NZ_CP059557.1:

Lanthipeptides: H2Q94_RS19875_lanthipeptide

24

CSSTCSFGPFTIVCDGTTK

42

C +CS+GP T VCDG TK

1

CVQSCSWGPVTAVCDGNTK

19

19.6%

NZ_KZ857173.1:

Lanthipeptides: DVJ77_RS03090_lanthipeptide

12

WTEGVAAVDIYACSSTCSFGPFT

34

+ EG AA + SST FT

8

YIEGAAATEAALTSSTAGMNMFT

30

18.2%

NZ_BDDE01000019.1and 1 other:

NZ_CP044407.1 Lanthipeptides: F7P10_RS09640_lanthipeptide

Lanthipeptides: K4S16_RS30760_lanthipeptide

21

IYACSSTCSFGPFTIVC

37

++ C ST S+ PFT C

6

VWECCSTGSWVPFTCGC

22

18.2%

NZ_CP035495.1and 1 other:

NZ_CP035495.1 Lanthipeptides: allorf_0930927_0931019_lanthipeptide

Lanthipeptides: allorf_0930927_0931019_lanthipeptide

9

LGYWTEGVAAVDIYAC

24

LG W V VD+ AC

3

LGRWRTLVTRVDVTAC

18

18.2%

NZ_JABBWU010000018.1:

Lanthipeptides: allorf_000769_000960_lanthipeptide

13

TEGVAAVDIYACSSTCSFG

31

+ G V I CS +CS G

3

SPGRLLVTIRTCSGSCSPG

21

15.9%

NZ_JALAPU010000003.1and 7 others:

NZ_JALAPU010000003.1 Lanthipeptides: MOD17_RS07925_lanthipeptideNZ_JALATU010000001.1 Lanthipeptides: MOE27_RS00585_lanthipeptideNZ_JALATU010000001.1 Lanthipeptides: MOE27_RS00585_lanthipeptideNZ_JALAUG010000006.1 Lanthipeptides: MOE44_RS17010_lanthipeptideNZ_JALAUG010000006.1 Lanthipeptides: MOE44_RS17010_lanthipeptideNZ_JALAVR010000001.1 Lanthipeptides: MOE47_RS04640_lanthipeptideNZ_JALAVR010000001.1 Lanthipeptides: MOE47_RS04640_lanthipeptide

Lanthipeptides: MOD17_RS07925_lanthipeptide

12

WTEGVAAVDIYACSSTC

28

WT ++ V Y S+TC

1

WTPALSVVTAYISSNTC

17

MIBiG 4.0 matches for P696_RS0120030

31.8%

BGC0000503.5 (cinA):

Lanthipeptide: cinnamycin

24

CSSTCSFGPFTIVCDGTTK

42

C +CSFGPFT VCDG TK

1

CRQSCSFGPFTFVCDGNTK

19

9.1%

BGC0000517.4 (BAB04173.1):

Lanthipeptide: haloduracin β or haloduracin α

33

FTIVCDGTTKG

43

+ I C KG

4

YNISCRLGNKG

14

P696_RS0120080

Leader:

MRISSVVLLLWLVIGAVAAGQRHYYDRPVKDQVKDCSRSGTIAVTVVAG

Core:

PLNYLGVNPKISCKDLPEPSK

Core with dehydrations:

PLNYLGVNPKIDhaCysKDLPEPDhaK

antiSMASH-DB 4.0 matches for P696_RS0120080

100.0%

NZ_JADG01000011.1:

Lanthipeptides: P696_RS0120080_lanthipeptide

1

PLNYLGVNPKISCKDLPEPSK

21

PLNYLGVNPKISCKDLPEPSK

1

PLNYLGVNPKISCKDLPEPSK

21

20.7%

NZ_CP076356.1:

Lanthipeptides: allorf_0461671_0461832_lanthipeptide

6

GVNPKISCKD

15

GVN +SC D

20

GVNSAVSCLD

29

11.6%

NZ_JACWFH010000015.1:

Lanthipeptides: H0185_RS13725_lanthipeptide

1

PLNYLGVNPKISCK

14

+ Y GV +SC

14

AVAYYGVQSSVSCA

27

allorf_404962_405171

Leader:

MGPSRSFVGGSVGA

Core:

LPRSKERDPAHCQSSATQPLSTRTPRSRRIGAFGELPRAGRRPARGLVGEVPGIS

Core with dehydrations:

LPRDhaKERDPAHCysQDhaDhaADhbQPLDhaDhbRDhbPRDhaRRIGAFGELPRAGRRPARGLVGEVPGIDha

antiSMASH-DB 4.0 matches for allorf_404962_405171

100.0%

NZ_JADG01000011.1:

Lanthipeptides: allorf_404962_405171_lanthipeptide

1

LPRSKERDPAHCQSSATQPLSTRTPRSRRIGAFGELPRAGRRPARGLVGEVPGIS

55

LPRSKERDPAHCQSSATQPLSTRTPRSRRIGAFGELPRAGRRPARGLVGEVPGIS

1

LPRSKERDPAHCQSSATQPLSTRTPRSRRIGAFGELPRAGRRPARGLVGEVPGIS

55

MIBiG 4.0 matches for allorf_404962_405171

9.1%

BGC0000580.3 (EGD17354.1):

Lasso peptide: xanthomonin II or xanthomonin I

51

VPGIS

55

VPGIS

14

VPGIS

18

allorf_410874_411095

Leader:

MSISVGLSGG

Core:

FQPGSPWPCARLTTPNDTGEGVGGRGFYRAQRRLPCELSSNSRTCGSERLGPIYRGPGAHMRR

Core with dehydrations:

FQPGDhaPWPCysARLDhbDhbPNDDhbGEGVGGRGFYRAQRRLPCysELDhaDhaNDhaRDhbCysGDhaERLGPIYRGPGAHMRR

antiSMASH-DB 4.0 matches for allorf_410874_411095

100.0%

NZ_JADG01000011.1:

Lanthipeptides: allorf_410874_411095_lanthipeptide

1

FQPGSPWPCARLTTPNDTGEGVGGRGFYRAQRRLPCELSSNSRTCGSERLGPIYRGPGAHMRR

63

FQPGSPWPCARLTTPNDTGEGVGGRGFYRAQRRLPCELSSNSRTCGSERLGPIYRGPGAHMRR

1

FQPGSPWPCARLTTPNDTGEGVGGRGFYRAQRRLPCELSSNSRTCGSERLGPIYRGPGAHMRR

63

17.5%

NZ_BNBI01000017.1:

Lanthipeptides: allorf_039973_040194_lanthipeptide

7

WPCARLTTPNDTGEGVGGRG

26

WPC T TGEGVG +G

11

WPCGHRTF---TGEGVGRKG

27

14.3%

NZ_JAAPAV010000001.1and 1 other:

NZ_QNSC01000013.1 Lanthipeptides: DET47_RS16520_lanthipeptide

Lanthipeptides: HUB64_RS17000_lanthipeptide

37

ELSSNSRTCGSERLGPIYR

55

EL++N+ TC S+R G +R

12

ELTANAYTCPSDRTGSTHR

30

with 3 more sequence matches

14.3%

NZ_KB235948.1and 1 other:

NZ_KB235948.1 Lanthipeptides: allorf_4821767_4821901_lanthipeptide

Lanthipeptides: allorf_4821767_4821901_lanthipeptide

13

TTPNDTGEGVGGRGFYRAQRR

33

+TP +G GG+ + AQRR

2

STPEPSGSTCGGKSLFWAQRR

22

12.7%

NZ_CP104900.1and 1 other:

NZ_CP104900.1 Lanthipeptides: allorf_3429438_3429629_lanthipeptide

Lanthipeptides: allorf_3429438_3429629_lanthipeptide

37

ELSSNSRTCGSERLGPIYR

55

E+++N+ TC S+R G R

12

EITANAYTCPSDRTGSTLR

30

11.1%

NZ_CP069338.1:

Lanthipeptides: allorf_07271223_07271444_lanthipeptide

39

SSNSRTCGSERLGPIY

54

S SR C +R GP++

18

SPESRPCSLDRTGPVH

33

MIBiG 4.0 matches for allorf_410874_411095

6.3%

BGC0002150.2 (MBO0654592.1):

Lasso peptide: triculamin

19

GEGVGGRG

26

G+G+ G+G

7

GDGIRGKG

14

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.18 out of 27.04

Confidence: strong

Additional weak hits (5):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.17 out of 25.88

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.88 out of 20.97

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.76 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

P696_RS0120030 - Class II

Cleavage pHMM score: -6.80

RODEO score: 0

Monoisotopic mass: 4499.1 Da

Molecular weight: 4501.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4519.9 Da N = 1; 4537.9 Da N = 2; 4556.0 Da N = 3; 4574.0 Da N = 4; 4592.0 Da N = 5

P696_RS0120080 - Class II

Cleavage pHMM score: -2.60

RODEO score: 0

Monoisotopic mass: 2275.2 Da

Molecular weight: 2276.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2294.7 Da N = 1

allorf_404962_405171 - Class II

Cleavage pHMM score: -5.70

RODEO score: 0

Monoisotopic mass: 5769.2 Da

Molecular weight: 5772.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 5790.5 Da N = 1; 5808.5 Da N = 2; 5826.6 Da N = 3; 5844.6 Da N = 4; 5862.6 Da N = 5; 5880.6 Da N = 6; 5898.6 Da N = 7; 5916.7 Da N = 8

allorf_410874_411095 - Class II

Cleavage pHMM score: -6.50

RODEO score: 0

Monoisotopic mass: 6753.4 Da

Molecular weight: 6757.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 6775.5 Da N = 1; 6793.6 Da N = 2; 6811.6 Da N = 3; 6829.6 Da N = 4; 6847.6 Da N = 5; 6865.6 Da N = 6

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor
DasR	N-acetylglucosamine dependent repressor

NZ_JADG01000012.1 - Region 1 - NI-siderophore,terpene

Download region GenBank file

Download region SVG

Location: 150,595 - 183,044 nt. (total: 32,450 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

P696_RS0120925: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase protease

P696_RS0120895: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

P696_RS0120950: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

P696_RS47015: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

P696_RS54630: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.38	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.37	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000946.5	0.35	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0002633.2	0.26	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0000947.5	0.24	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0002470.2	0.24	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000943.5	0.22	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002138.2	0.21	PKS	fuelimycin A, fuelimicin B, fuelimicin C	Streptomyces albireticuli NRRL B-1670
BGC0001776.3	0.21	terpene	shearinine D	Penicillium janthinellum
BGC0002466.3	0.19	NRPS	peucechelin	Streptomyces peucetius subsp. caesius ATCC 27952

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002527.2	0.51	other (other)	vibrioferrin	Azotobacter vinelandii CA
BGC0001408.5	0.51	other (other)	xanthoferrin	Xanthomonas oryzae pv. oryzae KACC 10331
BGC0000946.5	0.49	other (other)	vibrioferrin	Vibrio parahaemolyticus
BGC0000597.4	0.47	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0002633.2	0.43	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002470.2	0.41	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0000947.5	0.40	other (other)	vibrioferrin	Vibrio alginolyticus
BGC0001407.5	0.38	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0001776.3	0.38	terpene	shearinine D	Penicillium janthinellum
BGC0000943.5	0.38	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

P696_RS47000: TS_Pyr4

Domain 1 (3 - 210): Pyr4 type terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.98 out of 36.53

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.26 out of 24.78

Confidence: medium

Additional weak hits (8):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.45 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.33 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.92 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.17 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.23 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.37 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
LexA variant 2	Repressor of DNA damage response

NZ_KI912412.1 - Region 1 - T1PKS,hglE-KS

Download region GenBank file

Download region SVG

Location: 112,066 - 164,024 nt. (total: 51,959 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

P696_RS0140780: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

P696_RS51545: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase

P696_RS0140685: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: dehalogenase hydrolase

P696_RS0140695: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

P696_RS51535: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: mutase

P696_RS0140650: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

P696_RS51540: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

P696_RS51550: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.57	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.56	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.55	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000863.3	0.52	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.65	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.65	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.65	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000863.3	0.59	other (other)	eicosapentaenoic acid	Pseudoalteromonas sp. DS-12

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.58 out of 24.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (28):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.86 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.28 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.35 out of 18.57

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.18 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.82 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.04 out of 21.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.65 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.06 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.18 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.95 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.95 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.39 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.79 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 19.96 out of 27.18

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.52 out of 29.65

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.91 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.13 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 112065 - 164024:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal)
Non-colinear ordering:: P696_RS51540 + P696_RS0140700

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 112065 - 156523:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal)
Non-colinear ordering:: P696_RS51540 + P696_RS0140700

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 118066 - 164024:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal)
Non-colinear ordering:: P696_RS51540 + P696_RS0140700

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS51540: mal

PKS_AT (654..872): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 19.4
inactive: 9.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

P696_RS51550: mal

PKS_AT (1233..1526): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 79.1
Methoxymalonyl-CoA: 32.6
Methylmalonyl-CoA: 29.3
inactive: 21.8
Isobutyryl-CoA: 18.4
Propionyl-CoA: 13.3
Ethylmalonyl-CoA: 4.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0
CHC-CoA: -0.9

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_JADG01000020.1 - Region 1 - CDPS,NRPS

Download region GenBank file

Download region SVG

Location: 53,332 - 116,018 nt. (total: 62,687 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
CDPS: CDPS

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

P696_RS0128030: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

P696_RS0128155: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

P696_RS0128160: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

P696_RS0128180: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

P696_RS48665: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase kinase

P696_RS0128210: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

P696_RS48660: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: deaminase esterase

P696_RS0128075: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

P696_RS0128095: thioesterase

smcogs: SMCOG1004: thioesterase

P696_RS0128135: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: hydratase

P696_RS0128200: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

P696_RS0128115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS0128120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS0128125: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

P696_RS0128130: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

P696_RS48680: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001948.3	0.74	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001986.3	0.58	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0001641.4	0.57	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.57	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0000307.4	0.55	NRPS	AbT1	Aureobasidium pullulans
BGC0002075.3	0.42	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001948.3	0.69	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001133.4	0.69	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 21.80 out of 23.43

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.47 out of 23.79

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 22.35 out of 25.88

Confidence: medium

Additional weak hits (23):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.88 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.92 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.66 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.29 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.77 out of 21.55

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.24 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.76 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.43 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.02 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 39.62

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.16 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.68 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.67 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 39.62

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.36 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.46 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.59 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.31 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.15 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 53331 - 116018:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-Thr) + (X - D-Thr) + (Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 92336 - 113044:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

P696_RS48680: Val

Search NORINE for peptide: strict or relaxed

AMP-binding (473..871): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDPSFDASTYEVFILTGGEGHVYGPTESTTYATH
Nearest Stachelhaus code(s):: Val or aIle DAYFLGVTFK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

P696_RS0128115: X - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (458..845): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YAHAFDTSWMGWNTLIGGERNFYGPTEATIDTMS
Nearest Stachelhaus code(s):: Lys DTDDMGFIDK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1503..1891): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

P696_RS0128120: X - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (461..885): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FDSSFDASTLERFADFGGELNVYGPTEVTTYTTL
Nearest Stachelhaus code(s):: Ile DALFMGCTYK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2607..2995): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

P696_RS0128125: X

AMP-binding (58..472): X

nrpys: Dpr, Dab

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKSFDISVWQCELIATGELNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWELTADDK (88% 8Å match); Dab DIWELTADDK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism
PsrA	Oleic acid responsive regulator

NZ_JADG01000021.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 31,163 - 52,521 nt. (total: 21,359 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002026.3	0.27	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139
BGC0002007.2	0.27	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002439.3	0.20	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000080.5	0.20	PKS	jerangolid A, jerangolid D	Sorangium cellulosum
BGC0002044.2	0.20	NRPS	empedopeptin	Massilia sp. YMA4
BGC0000845.5	0.19	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000997.4	0.19	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0002288.2	0.18	NRPS	ashimide A, ashimide B	Streptomyces sp. NA03103

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002026.3	0.27	NRPS, PKS	thaxteramide A1, thaxteramide A2, thaxteramide B1, thaxteramide B2	Jahnella sp. MSr9139
BGC0002007.2	0.27	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0002439.3	0.20	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000080.5	0.20	PKS	jerangolid A, jerangolid D	Sorangium cellulosum
BGC0002044.2	0.20	NRPS	empedopeptin	Massilia sp. YMA4
BGC0000845.5	0.19	other (non-nrp beta-lactam)	clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000997.4	0.19	NRPS, PKS	glidobactin, glidobactin B, glidobactin C	[Polyangium] brachysporum
BGC0002288.2	0.18	NRPS	ashimide A, ashimide B	Streptomyces sp. NA03103

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.24 out of 29.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.32 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.32 out of 23.43

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_JADG01000023.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1 - 14,176 nt. (total: 14,176 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

P696_RS0129735: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

P696_RS0129740: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

P696_RS0129765: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: aminotransferase

P696_RS0129725: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

Lyases: cyclase

P696_RS0129720: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001224.5	0.45	other (other)	reductasporine	uncultured bacterium
BGC0001660.3	0.43	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000285.5	0.41	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001336.5	0.41	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001223.5	0.41	other (other)	hydroxysporine	uncultured bacterium
BGC0001335.5	0.40	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001374.5	0.38	other (other)	thienodolin	Streptomyces albogriseolus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0001224.5	0.45	other (other)	reductasporine	uncultured bacterium
BGC0001660.3	0.43	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000554.4	0.43	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000285.5	0.41	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001336.5	0.41	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001223.5	0.41	other (other)	hydroxysporine	uncultured bacterium
BGC0001335.5	0.40	other (other)	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0001483.4	0.39	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001374.5	0.38	other (other)	thienodolin	Streptomyces albogriseolus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for P696_RS0129720

allorf_000674_000886

Leader:

MAVVGARGRVGGGFLGGMRCGLVRTRRWSRTGIAGS

Core:

APRTRLSRLLTRRRRSRGTGCLLTWGFLRWRGHC

Core with dehydrations:

APRDhbRLDhaRLLDhbRRRRDhaRGDhbGCysLLDhbWGFLRWRGHCys

antiSMASH-DB 4.0 matches for allorf_000674_000886

100.0%

NZ_JADG01000023.1:

Lanthipeptides: allorf_000674_000886_lanthipeptide

1

APRTRLSRLLTRRRRSRGTGCLLTWGFLRWRGHC

34

APRTRLSRLLTRRRRSRGTGCLLTWGFLRWRGHC

1

APRTRLSRLLTRRRRSRGTGCLLTWGFLRWRGHC

34

28.6%

NZ_LT985747.1:

Lanthipeptides: C8268_RS22865_lanthipeptide

7

SRLLTRRRRSRGTGCLLTWGFLRWRG

32

SRL+ G C+LT WRG

4

SRLICTPGSCSGNNCVLT----TWRG

25

MIBiG 4.0 matches for allorf_000674_000886

14.7%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

19

TGCLLTWGFLRWRGHC

34

TG L+ HC

13

TGALMGCNMKTATCHC

28

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.32 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.72 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.02 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.48 out of 24.78

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_000674_000886 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 4002.3 Da

Molecular weight: 4004.7 Da

Number of bridges: 2

Additional modifications: OH

Alternative weights: (assuming N unmodified Ser/Thr residues); 4022.7 Da N = 1; 4040.7 Da N = 2; 4058.7 Da N = 3; 4076.8 Da N = 4

TFBS definitions

Regulator	Description