GCF_000513875.1 - 13 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_AZUV01000001.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene	63,186	84,028
Region 1.2	NAPAA	756,207	790,319

NZ_KI911319.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	terpene	439,396	462,243	High	gibberellin	terpene

NZ_AZUV01000014.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	terpene-precursor	9,331	30,248

NZ_AZUV01000015.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	redox-cofactor	116,688	138,857

NZ_AZUV01000022.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	hserlactone	55,071	75,700

NZ_AZUV01000004.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	RRE-containing	1	14,838

NZ_AZUV01000036.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 28.1	hserlactone	26,469	44,565

NZ_KI911320.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 35.1	lassopeptide	324,366	347,146
Region 35.2	RRE-containing	352,502	372,789

NZ_AZUV01000009.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 48.1	proteusin	14,785	36,305
Region 48.2	hserlactone	117,618	138,256

NZ_AZUV01000010.1 (Mesorhizobium sp. WSM1293)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 49.1	thioamitides	156,143	178,106

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	terpene	63,186	84,028
Region 1.2	NAPAA	756,207	790,319
Region 2.1	terpene	439,396	462,243	High	gibberellin	terpene
Region 4.1	terpene-precursor	9,331	30,248
Region 5.1	redox-cofactor	116,688	138,857
Region 12.1	hserlactone	55,071	75,700
Region 13.1	RRE-containing	1	14,838
Region 28.1	hserlactone	26,469	44,565
Region 35.1	lassopeptide	324,366	347,146
Region 35.2	RRE-containing	352,502	372,789
Region 48.1	proteusin	14,785	36,305
Region 48.2	hserlactone	117,618	138,256
Region 49.1	thioamitides	156,143	178,106

No secondary metabolite regions were found in these records:: NZ_AZUV01000013.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000016.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000017.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000018.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000019.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000020.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000021.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000023.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000024.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000025.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000026.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000027.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000028.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000029.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000030.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000031.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000032.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000005.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000033.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000034.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000035.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000037.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000038.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000039.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000040.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000041.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000042.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000043.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000044.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000045.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000046.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000047.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000048.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000049.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000050.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000051.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000052.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000008.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000053.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000011.1 (Mesorhizobium sp. WSM1293); NZ_AZUV01000012.1 (Mesorhizobium sp. WSM1293)

Compact view

NZ_AZUV01000001.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 63,186 - 84,028 nt. (total: 20,843 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

M729_RS0100350: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

M729_RS0100440: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002439.3	0.34	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000700.5	0.26	saccharide	istamycin	Streptomyces tenjimariensis
BGC0000698.5	0.25	saccharide	hygromycin A	Streptomyces hygroscopicus
BGC0000001.5	0.23	PKS	abyssomicin C, atrop-abyssomicin C	Verrucosispora maris AB-18-032
BGC0000014.5	0.21	PKS	ambruticin	Sorangium cellulosum
BGC0000078.5	0.18	PKS	incednine	Streptomyces sp. ML694-90F3

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002439.3	0.34	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000700.5	0.26	saccharide	istamycin	Streptomyces tenjimariensis
BGC0000698.5	0.25	saccharide	hygromycin A	Streptomyces hygroscopicus
BGC0000001.5	0.23	PKS	abyssomicin C, atrop-abyssomicin C	Verrucosispora maris AB-18-032
BGC0000014.5	0.21	PKS	ambruticin	Sorangium cellulosum
BGC0000078.5	0.18	PKS	incednine	Streptomyces sp. ML694-90F3

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene		squalene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

M729_RS0100410: PT_phytoene_like

Domain 1 (20 - 272): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → PSPP; FPP → squalene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.29 out of 27.55

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.98 out of 20.97

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.93 out of 26.33

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.19 out of 21.55

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.92 out of 27.78

Confidence: medium

Additional weak hits (11):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.92 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.30 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.90 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.96 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.82 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.51 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.23 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.11 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.57 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.67 out of 31.73

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
ArcA	Repressor of carbon oxidation
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes

NZ_AZUV01000001.1 - Region 2 - NAPAA

Download region GenBank file

Download region SVG

Location: 756,207 - 790,319 nt. (total: 34,113 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

M729_RS0103905: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase

M729_RS0103860: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: hydrolase

M729_RS0103875: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

M729_RS0103850: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.73	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.73	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.92 out of 23.79

Confidence: medium

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.28 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.03 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.43 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.79 out of 25.88

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.00 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.22 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.23 out of 27.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 756206 - 790319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

M729_RS0103850: X

AMP-binding (61..458): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FVAMFDFSSEEVACLVGGELNTYGPTEATVTATM
Nearest Stachelhaus code(s):: OH-Orn DGEAVGGVTK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KI911319.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 439,396 - 462,243 nt. (total: 22,848 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

M729_RS0132390: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

M729_RS0132395: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

M729_RS0132405: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

M729_RS0132410: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

M729_RS0132425: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Ligases: synthetase

M729_RS0132385: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001605.3	0.88	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001198.3	0.54	terpene	(+)-O-methylkolavelool	Herpetosiphon aurantiacus DSM 785
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002400.2	0.50	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001223.5	0.48	other (other)	hydroxysporine	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000642.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0002218.2	0.47	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001605.3	0.88	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0001198.3	0.54	terpene	(+)-O-methylkolavelool	Herpetosiphon aurantiacus DSM 785
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0002400.2	0.50	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000677.5	0.49	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001223.5	0.48	other (other)	hydroxysporine	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000642.3	0.47	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0002218.2	0.47	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

M729_RS0132375: T2TS

Domain 1 (4 - 499): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

M729_RS0132385: PT_FPPS_like

Domain 1 (62 - 328): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.83 out of 30.22

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.51 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.41 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.10 out of 25.88

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.68 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.78 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.19 out of 24.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.28 out of 39.62

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
ClgR	Caseinolytic protease gene regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_AZUV01000014.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 9,331 - 30,248 nt. (total: 20,918 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

M729_RS0118555: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: methyltransferase sulfotransferase

M729_RS0118575: glutathione S-transferase

smcogs: SMCOG1193: glutathione S-transferase

M729_RS0118620: methyltransferase

smcogs: SMCOG1089: methyltransferase

M729_RS0118630: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

M729_RS0118580: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthetase

M729_RS0118615: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001616.3	0.50	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000665.5	0.41	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001605.3	0.41	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000666.5	0.41	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0002227.3	0.40	NRPS	AKML B, AKML D, AKML A, AKML C	Aspergillus luchuensis IFO 4308

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001616.3	0.50	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000902.4	0.42	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002007.2	0.42	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000665.5	0.41	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002496.3	0.41	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0001605.3	0.41	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000666.5	0.41	terpene	xiamycin A	Streptomyces sp. SCSIO 02999
BGC0002227.3	0.40	NRPS	AKML B, AKML D, AKML A, AKML C	Aspergillus luchuensis IFO 4308

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

M729_RS0118615: PT_FPPS_like

Domain 1 (43 - 304): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 26.12 out of 26.12

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.91 out of 26.33

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (7):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.49 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 19.06 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.80 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.15 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.44 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.60 out of 20.97

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
LuxO	Repressor of luminescence
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_AZUV01000015.1 - Region 1 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 116,688 - 138,857 nt. (total: 22,170 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

M729_RS0120130: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000582.4	0.37	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000398.5	0.35	NRPS	orfamide B	Pseudomonas sp. CMR12a
BGC0001100.5	0.35	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000399.5	0.32	NRPS	orfamide A, orfamide C	Pseudomonas protegens Pf-5
BGC0000526.5	0.28	ribosomal	macedocin	Streptococcus macedonicus
BGC0002470.2	0.27	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001715.4	0.27	NRPS	octapeptin C4	Bacillus circulans
BGC0001763.5	0.26	NRPS, PKS	rufomycin	Streptomyces atratus
BGC0001620.5	0.26	NRPS, PKS	ilamycin B1, ilamycin B2, ilamycin C1, ilamycin C2, ilamycin D, ilamycin E1	Streptomyces atratus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000582.4	0.37	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0001210.5	0.36	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000398.5	0.35	NRPS	orfamide B	Pseudomonas sp. CMR12a
BGC0001100.5	0.35	NRPS, PKS	lankacidin C	Streptomyces rochei
BGC0000399.5	0.32	NRPS	orfamide A, orfamide C	Pseudomonas protegens Pf-5
BGC0000526.5	0.28	ribosomal	macedocin	Streptococcus macedonicus
BGC0002470.2	0.27	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001715.4	0.27	NRPS	octapeptin C4	Bacillus circulans
BGC0001763.5	0.26	NRPS, PKS	rufomycin	Streptomyces atratus
BGC0001620.5	0.26	NRPS, PKS	ilamycin B1, ilamycin B2, ilamycin C1, ilamycin C2, ilamycin D, ilamycin E1	Streptomyces atratus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

Additional weak hits (12):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.47 out of 30.25

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.65 out of 29.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.42 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.44 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.56 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.06 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.72 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.50 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 7 - 96; Score: 85.5; RRE type: Thurincin_rSAM_RRE; Location: 34 - 90; Score: 27.2; RRE type: Stand_Alone_Lasso_RRE; Location: 43 - 96; Score: 25.5

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_AZUV01000022.1 - Region 1 - hserlactone

Download region GenBank file

Download region SVG

Location: 55,071 - 75,700 nt. (total: 20,630 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

M729_RS0124045: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Ligases: synthase

M729_RS0123940: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001238.3	0.58	other (other)	biotin	Aspergillus nidulans
BGC0001239.3	0.55	other (other)	biotin	Aspergillus nidulans
BGC0002362.3	0.38	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002282.2	0.32	other (other)	formycin A	Streptomyces kaniharaensis
BGC0001575.4	0.32	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0002040.3	0.32	other (other)	coformycin, formycin A	Streptomyces kaniharaensis
BGC0001588.3	0.31	saccharide	exopolysaccharides	Burkholderia pseudomallei 1026b
BGC0002177.2	0.30	PKS	ustilaginoidin N, ustilaginoidin O, ustilaginoidin M, ustilaginoidin A, ustilaginoidin F, ustilaginoidin E, ustilaginoidin D, ustilaginoidin G	Ustilaginoidea virens
BGC0002039.3	0.30	other (other)	coformycin, formycin A	Nocardia interforma ATCC 21072
BGC0001589.3	0.30	saccharide	exopolysaccharides	Burkholderia cenocepacia J2315

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001238.3	0.58	other (other)	biotin	Aspergillus nidulans
BGC0001239.3	0.55	other (other)	biotin	Aspergillus nidulans
BGC0002362.3	0.38	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002282.2	0.32	other (other)	formycin A	Streptomyces kaniharaensis
BGC0001575.4	0.32	NRPS	PZN5, PZN6, PZN7, PZN9, PZN10, PZN11	Ruminococcus sp. 5_1_39BFAA
BGC0002040.3	0.32	other (other)	coformycin, formycin A	Streptomyces kaniharaensis
BGC0001588.3	0.31	saccharide	exopolysaccharides	Burkholderia pseudomallei 1026b
BGC0002177.2	0.30	PKS	ustilaginoidin N, ustilaginoidin O, ustilaginoidin M, ustilaginoidin A, ustilaginoidin F, ustilaginoidin E, ustilaginoidin D, ustilaginoidin G	Ustilaginoidea virens
BGC0002039.3	0.30	other (other)	coformycin, formycin A	Nocardia interforma ATCC 21072
BGC0001589.3	0.30	saccharide	exopolysaccharides	Burkholderia cenocepacia J2315

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.35 out of 20.97

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.39 out of 29.72

Confidence: medium

Additional weak hits (5):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.35 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.64 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
NtrC	Nitrogen regulatory protein C

NZ_AZUV01000004.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1 - 14,838 nt. (total: 14,838 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

M729_RS0105520: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000737.3	0.47	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000741.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000740.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000748.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000789.3	0.43	saccharide	O-antigen	Escherichia coli
BGC0000762.3	0.38	saccharide	exopolysaccharide	Rhizobium leguminosarum bv. viciae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000737.3	0.47	saccharide	capsular polysaccharide	Pasteurella multocida
BGC0000741.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000744.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000745.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000740.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000748.3	0.46	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000789.3	0.43	saccharide	O-antigen	Escherichia coli
BGC0000762.3	0.38	saccharide	exopolysaccharide	Rhizobium leguminosarum bv. viciae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.38 out of 20.97

Confidence: medium

Additional weak hits (3):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.37 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.38 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.55 out of 35.63

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 10 - 79; Score: 39.5

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A

NZ_AZUV01000036.1 - Region 1 - hserlactone

Download region GenBank file

Download region SVG

Location: 26,469 - 44,565 nt. (total: 18,097 nt) Show pHMM detection rules used

Region on contig edge.

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: lyase

M729_RS0128755: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Similar gene clusters

Analysis type:

Reference	hserlactone	Similarity score	Type	Compound(s)	Organism
BGC0002284.3		0.26	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000354.5		0.18	NRPS	friulimicin A, friulimicin B, friulimicin C, friulimicin D	Actinoplanes friuliensis

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0002284.3		0.26	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000354.5		0.18	NRPS	friulimicin A, friulimicin B, friulimicin C, friulimicin D	Actinoplanes friuliensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.60 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.69 out of 26.85

Confidence: medium

Additional weak hits (7):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.56 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.27 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.28 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.95 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.54 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 23.20 out of 30.12

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KI911320.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 324,366 - 347,146 nt. (total: 22,781 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

M729_RS0134245: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

Transferases: acyltransferase glycosyltransferase

M729_RS0134170: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

M729_RS0134185: sugar transferase

smcogs: SMCOG1146: sugar transferase

M729_RS0134260: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

M729_RS0134205: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001548.4	0.51	ribosomal	citrulassin A	Streptomyces albulus
BGC0001356.4	0.50	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0000572.5	0.48	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0000800.5	0.48	saccharide	xanthan	Xanthomonas campestris
BGC0000868.5	0.48	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000740.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000748.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001634.3	0.53	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001548.4	0.51	ribosomal	citrulassin A	Streptomyces albulus
BGC0001356.4	0.50	ribosomal	paeninodin	Paenibacillus dendritiformis C454
BGC0000572.5	0.48	ribosomal	capistruin	Burkholderia thailandensis E444
BGC0000800.5	0.48	saccharide	xanthan	Xanthomonas campestris
BGC0000868.5	0.48	other (other)	teichuronic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0000740.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000746.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000747.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000748.3	0.48	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for M729_RS1000000138215

M729_RS1000000138215

Leader:

MEQNVEKHEYETPSLTVHGSIETITQ

Full core:

GGGGSTAIDASFPAHTPIGDLTFS

Putative macrolactam:

GGGGSTAID

antiSMASH-DB 4.0 matches for M729_RS1000000138215

100.0%

NC_002678.2and 27 others:

NC_014923.1 Lassopeptides: MESCI_RS01205_lassopeptideNC_019973.1 Lassopeptides: MESAU_RS01210_lassopeptideNZ_AP023242.1 Lassopeptides: JN279_RS01270_lassopeptideNZ_AP023243.1 Lassopeptides: JG746_RS01220_lassopeptideNZ_AP023246.1 Lassopeptides: MesoLj_RS01255_lassopeptideNZ_AP023254.1 Lassopeptides: JG747_RS01230_lassopeptideNZ_AXAE01000013.1 Lassopeptides: A3AU_RS1000000137730_lassopeptideNZ_AXAL01000027.1 Lassopeptides: A3A9_RS43075_lassopeptideNZ_CP015062.1 Lassopeptides: A4R28_RS34150_lassopeptideNZ_CP015064.1 Lassopeptides: A4R29_RS32555_lassopeptideNZ_CP021070.1 Lassopeptides: A9K65_RS01210_lassopeptideNZ_CP033361.1 Lassopeptides: EB233_RS01335_lassopeptideNZ_CP033365.1 Lassopeptides: EB231_RS01220_lassopeptideNZ_CP033507.1 Lassopeptides: EB229_RS01240_lassopeptideNZ_CP034453.1 Lassopeptides: EJ076_RS07385_lassopeptideNZ_CP050296.1 Lassopeptides: HB778_RS17925_lassopeptideNZ_CP080525.1 Lassopeptides: BPNPMPFG_RS25760_lassopeptideNZ_CP088147.1 Lassopeptides: LRP29_RS01210_lassopeptideNZ_CP097252.1 Lassopeptides: M5D98_RS01245_lassopeptideNZ_JALJRL010000001.1 Lassopeptides: NR193_RS01610_lassopeptideNZ_KB913026.1 Lassopeptides: MESLO3_RS1000000141745_lassopeptideNZ_KI632510.1 Lassopeptides: MESLO_RS32475_lassopeptideNZ_KI911320.1 Lassopeptides: M729_RS1000000138215_lassopeptideNZ_KI912159.1 Lassopeptides: MESLO2_RS1000000139130_lassopeptideNZ_KI912610.1 Lassopeptides: MESCI2_RS1000000137645_lassopeptideNZ_QGGH01000004.1 Lassopeptides: C8D77_RS17730_lassopeptideNZ_RZRU01000003.1 Lassopeptides: EOA16_RS05930_lassopeptide

Lassopeptides: MAFF_RS37875_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTAIDASFPAHTPIGDLTFS

1

GGGGSTAIDASFPAHTPIGDLTFS

24

95.8%

NC_015675.1and 4 others:

NZ_CP034779.1 Lassopeptides: EJ079_RS03975_lassopeptideNZ_JANIFC010000015.1 Lassopeptides: NP503_RS29205_lassopeptideNZ_LMCP01000023.1 Lassopeptides: ASD12_RS33300_lassopeptideNZ_LMHO01000001.1 Lassopeptides: ASD99_RS31725_lassopeptide

Lassopeptides: MESOP_RS33200_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TAIDASFPAHTPIGDLTFS

1

GGGGNTAIDASFPAHTPIGDLTFS

24

95.8%

NZ_CP033334.1and 4 others:

NZ_CP033364.1 Lassopeptides: EB230_RS01250_lassopeptideNZ_CP034454.1 Lassopeptides: EJ077_RS27505_lassopeptideNZ_CP083952.1 Lassopeptides: FJ970_RS01240_lassopeptideNZ_LMHP01000012.1 Lassopeptides: ASE05_RS13255_lassopeptide

Lassopeptides: EB815_RS01225_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTA DASFPAHTPIGDLTFS

1

GGGGSTATDASFPAHTPIGDLTFS

24

with 87 more sequence matches

Only the first 10 are displayed here.

95.8%

NZ_JACHEF010000002.1:

Lassopeptides: HNQ71_RS14800_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTAID SFPAHTPIGDLTFS

1

GGGGSTAIDVSFPAHTPIGDLTFS

24

91.7%

NZ_CP015318.1:

Lassopeptides: A6B35_RS34290_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTA+DASFPAHTPIG+LTFS

1

GGGGSTALDASFPAHTPIGELTFS

24

91.7%

NZ_ML703270.1:

Lassopeptides: C7I87_RS19195_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TA+DASFPAHTPIGDLTFS

1

GGGGNTALDASFPAHTPIGDLTFS

24

87.5%

NZ_CP080524.1:

Lassopeptides: LHFGNBLO_RS06050_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGGSTA+DA+FPAHTPIG+LTFS

1

GGGGSTALDAAFPAHTPIGELTFS

24

87.5%

NZ_CP083950.1:

Lassopeptides: FJW03_RS26870_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TA D SFPAHTPIGDLTFS

1

GGGGNTATDVSFPAHTPIGDLTFS

24

87.5%

NZ_CP083954.1:

Lassopeptides: FJ972_RS01095_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TA+DA+FPAHTPIGDLTFS

1

GGGGNTALDAAFPAHTPIGDLTFS

24

87.5%

NZ_CP085135.1:

Lassopeptides: LGH82_RS15665_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GGGG+TAIDASFPAHTPI LTFS

1

GGGGNTAIDASFPAHTPISQLTFS

24

83.3%

NZ_CP083951.1:

Lassopeptides: FJ430_RS01235_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GG G+TA+DASFPAHTPIG+LTFS

1

GGAGTTALDASFPAHTPIGELTFS

24

79.2%

NZ_AP024109.1and 2 others:

NZ_CP083956.1 Lassopeptides: FJ974_RS01165_lassopeptideNZ_FOVT01000001.1 Lassopeptides: F3H96_RS01735_lassopeptide

Lassopeptides: MJ8_RS02965_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GG G+TA+DASFPAHTP+G+LTFS

1

GGAGTTALDASFPAHTPVGELTFS

24

79.2%

NZ_ATYO01000004.1:

Lassopeptides: YU3_RS40500_lassopeptide

1

GGGGSTAIDASFPAHTPIGDLTFS

24

GG G TA+DASFPAHTP+G+LTFS

1

GGAGVTALDASFPAHTPVGELTFS

24

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.31 out of 27.78

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.63 out of 28.19

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.06 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.66 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.25 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.86 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.71 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.00 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.17 out of 25.88

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

M729_RS1000000138215 - Class II: Cleavage pHMM score: -0.30; RODEO score: 25; Monoisotopic mass: 2257.1 Da; Molecular weight: 2258.4 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 14 - 98; Score: 100.8

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
RpoN	Regulator of nitrogen assimilation and virulence
ZuR variant 1	Zinc-responsive repressor

NZ_KI911320.1 - Region 2 - RRE-containing

Download region GenBank file

Download region SVG

Location: 352,502 - 372,789 nt. (total: 20,288 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acyltransferase transferase

M729_RS0134295: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

M729_RS0134310: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Ligases: ligase

M729_RS0134315: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000749.3	0.55	saccharide	capsular polysaccharide	Escherichia coli
BGC0001549.3	0.44	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0002825.2	0.42	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0000728.5	0.42	saccharide	capsular polysaccharide	Klebsiella pneumoniae subsp. ozaenae
BGC0000729.3	0.42	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0002711.2	0.41	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000592.5	0.40	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000786.3	0.40	saccharide	O-antigen	Edwardsiella ictaluri 93-146

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000749.3	0.55	saccharide	capsular polysaccharide	Escherichia coli
BGC0001549.3	0.44	ribosomal	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0002825.2	0.42	ribosomal	nocapeptin A	Nocardia terpenica IFM 0406
BGC0000728.5	0.42	saccharide	capsular polysaccharide	Klebsiella pneumoniae subsp. ozaenae
BGC0000729.3	0.42	saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0002711.2	0.41	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000592.5	0.40	ribosomal	microviridin B	Microcystis aeruginosa NIES-298
BGC0001638.4	0.40	ribosomal	klebsazolicin	Klebsiella pneumoniae subsp. ozaenae
BGC0002674.2	0.40	ribosomal	enterocin F4-9	Enterococcus faecalis
BGC0000786.3	0.40	saccharide	O-antigen	Edwardsiella ictaluri 93-146

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

Additional weak hits (2):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.23 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.60 out of 29.65

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 7 - 90; Score: 47.2; RRE type: PqqD_RRE; Location: 25 - 90; Score: 29.2

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NZ_AZUV01000009.1 - Region 1 - proteusin

Download region GenBank file

Download region SVG

Location: 14,785 - 36,305 nt. (total: 21,521 nt) Show pHMM detection rules used

proteusin: (PoyD or TIGR03793)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002330.2	0.30	ribosomal	landornamide A	Kamptonema sp. PCC 6506
BGC0000598.5	0.27	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0000523.3	0.23	ribosomal	lactocin S	Lactobacillus sakei

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002330.2	0.30	ribosomal	landornamide A	Kamptonema sp. PCC 6506
BGC0000598.5	0.27	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0000523.3	0.23	ribosomal	lactocin S	Lactobacillus sakei

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.73 out of 20.97

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (9):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.73 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.94 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 22.00 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.26 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.70 out of 29.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.35 out of 29.51

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.07 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 20.08 out of 33.14

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Proteusin_Epimerase_RRE; Location: 409 - 502; Score: 66.5

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A

NZ_AZUV01000009.1 - Region 2 - hserlactone

Download region GenBank file

Download region SVG

Location: 117,618 - 138,256 nt. (total: 20,639 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase aminotransferase carbamoyltransferase

M729_RS0112315: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

M729_RS0112320: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

M729_RS0112395: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: hydratase

M729_RS0112350: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

M729_RS0112390: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000895.5	0.47	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.46	other (other)	ectoine	Methylophaga alcalica
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002052.3	0.46	other (ectoine)	ectoine	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.47	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.47	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000895.5	0.47	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.46	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.46	other (other)	ectoine	Methylophaga alcalica
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002052.3	0.46	other (ectoine)	ectoine	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

Additional weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.35 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.07 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.67 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.98 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.64 out of 18.57

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_AZUV01000010.1 - Region 1 - thioamitides

Download region GenBank file

Download region SVG

Location: 156,143 - 178,106 nt. (total: 21,964 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.43	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002120.3	0.28	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001474.4	0.25	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001473.4	0.23	ribosomal	Sch 18640	Micromonospora arborensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.43	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002120.3	0.28	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001474.4	0.25	ribosomal	thiopeptin	Streptomyces tateyamensis
BGC0001473.4	0.23	ribosomal	Sch 18640	Micromonospora arborensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.73 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.20 out of 25.88

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 28.19

Confidence: medium

Additional weak hits (4):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.13 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 21.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.59 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.86 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
IolR	Regulator of the inositol catabolism
PsrA	Oleic acid responsive regulator
ZuR variant 1	Zinc-responsive repressor