GCF_000495635.2 - 27 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP106650.1 (Streptomyces sp. GBA 94-10 4N24)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	azoxy-crosslink,T1PKS,butyrolactone	37,777	136,563	Low	griseoviridin/fijimycin A	NRPS:Type I+PKS:Trans-AT type I
Region 1.2	terpene	284,148	306,730
Region 1.3	NRPS-like,T3PKS,NRPS,T1PKS	367,717	470,987	Medium	totopotensamide A/totopotensamide B	NRPS:Type I+PKS
Region 1.4	NRPS,T1PKS	522,713	572,132	High	SGR PTMs/SGR PTM Compound b/SGR PTM Compound c/SGR PTM Compound d	NRPS:Type I+PKS
Region 1.5	terpene	608,189	634,747	High	hopene	terpene
Region 1.6	RiPP-like	701,710	711,925
Region 1.7	T1PKS,PKS-like	731,233	779,148	Medium	Bisenarsan	PKS:Type I
Region 1.8	RiPP-like	1,125,372	1,136,685
Region 1.9	NI-siderophore	1,410,555	1,443,554
Region 1.10	terpene	1,672,181	1,694,466	High	geosmin	terpene:Sesquiterpene
Region 1.11	terpene-precursor	2,051,240	2,072,283
Region 1.12	terpene	2,082,090	2,103,064	Low	julichrome Q3-3/julichrome Q3-5	PKS
Region 1.13	azole-containing-RiPP,RRE-containing	2,566,327	2,601,000
Region 1.14	lanthipeptide-class-iii	2,877,505	2,900,078	High	AmfS	ribosomal:RiPP:Lanthipeptide
Region 1.15	PKS-like	3,034,517	3,075,470
Region 1.16	NRPS	3,726,005	3,788,243	Low	dechlorocuracomycin	NRPS:Type I
Region 1.17	NRPS,azole-containing-RiPP	3,946,144	4,054,959	High	surugamide A/surugamide D	NRPS:Type I
Region 1.18	NRPS	4,542,642	4,587,009	Low	dudomycin A	NRPS:Type I
Region 1.19	NI-siderophore	4,769,415	4,799,235	High	desferrioxamin B	other:other
Region 1.20	NRPS-like	4,891,414	4,933,228	Low	altemicidin/SB-203207/SB-203208	other:other
Region 1.21	ectoine	5,645,530	5,655,928	High	ectoine	other:other
Region 1.22	T2PKS	6,236,855	6,309,346	High	enterocin	PKS:Type II
Region 1.23	terpene	6,424,098	6,452,288	High	isorenieratene	terpene
Region 1.24	RiPP-like	6,531,677	6,543,044	Medium	streptamidine	ribosomal:unmodified
Region 1.25	T3PKS,T1PKS,terpene-precursor,NRPS-like,NRPS,lanthipeptide-class-ii	6,544,917	6,848,481	High	candicidin	NRPS:Type I+PKS
Region 1.26	T1PKS,butyrolactone,azoxy-crosslink	6,888,459	6,987,245	Low	griseoviridin/fijimycin A	NRPS:Type I+PKS:Trans-AT type I

NZ_CP106651.1 (Streptomyces sp. GBA 94-10 4N24)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	linaridin	10,609	31,190

Compact view

NZ_CP106650.1 - Region 1 - T1PKS,azoxy-crosslink,butyrolactone

Download region GenBank file

Download region SVG

Location: 37,777 - 136,563 nt. (total: 98,787 nt) Show pHMM detection rules used

azoxy-crosslink: (azdH and LPG_synthase_C and azdO and vlmB)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

B591_RS00200: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B591_RS00205: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

B591_RS00250: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B591_RS00255: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B591_RS00325: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

B591_RS00365: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B591_RS00410: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase aminotransferase transferase

B591_RS00260: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B591_RS00315: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B591_RS00355: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

B591_RS00430: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: esterase hydrolase

B591_RS00330: thioesterase

smcogs: SMCOG1004: thioesterase

B591_RS00335: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

B591_RS00370: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase

B591_RS00460: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

B591_RS00280: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B591_RS00320: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B591_RS00390: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS00395: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS00400: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS00405: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS00465: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	1.00	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.97	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.74	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001273.3	0.43	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.43	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.41	PKS	oronofacic acid	Pseudomonas syringae
BGC0000204.5	0.39	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0000914.5	0.39	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001065.5	0.36	PKS	herboxidiene	Streptomyces chromofuscus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.73	PKS	oronofacic acid	Pseudomonas syringae
BGC0000850.5	0.70	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.58 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 28.31 out of 30.12

Confidence: strong

Additional weak hits (23):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.70 out of 31.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 26.85

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.49 out of 32.74

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.30 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.71 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.55 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.60 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.93 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.46 out of 36.53

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.96 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.54 out of 23.43

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.18 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.09 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.83 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.13 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 37776 - 136563:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ccmal) + (ccmal) + (Me-ccmal - Me-ohmal - ohmal) + (Me-redmal) + (mal)
Non-colinear ordering:: B591_RS00405 + B591_RS00315 + B591_RS00400 + B591_RS00395 + B591_RS00390

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 44361 - 136563:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ccmal) + (ccmal) + (Me-ccmal - Me-ohmal - ohmal) + (Me-redmal) + (mal)
Non-colinear ordering:: B591_RS00405 + B591_RS00315 + B591_RS00400 + B591_RS00395 + B591_RS00390

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS00315: mal

PKS_AT (547..842): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.9
inactive: 105.9
Methylmalonyl-CoA: 56.1
Methoxymalonyl-CoA: 55.4
Propionyl-CoA: 44.5
Isobutyryl-CoA: 38.2
2-Methylbutyryl-CoA: 26.9
Acetyl-CoA: 18.7
Benzoyl-CoA: 16.6
Ethylmalonyl-CoA: 16.4
CHC-CoA: 12.5
fatty_acid: 10.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

B591_RS00320: X

AMP-binding (21..437): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAMSFGIAGIGLFVAYGAAAQIYASTEAGSVAVC
Nearest Stachelhaus code(s):: Ant GIILFGVGVK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

B591_RS00390: mal

PKS_AT (570..874): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 160.6
inactive: 69.6
Methylmalonyl-CoA: 66.8
Methoxymalonyl-CoA: 64.4
Ethylmalonyl-CoA: 42.8
Isobutyryl-CoA: 25.9
Benzoyl-CoA: 25.9
Propionyl-CoA: 25.8
CHC-CoA: 19.4
Acetyl-CoA: 19.0
fatty_acid: 17.8
trans-1,2-CPDA: 16.8
2-Methylbutyryl-CoA: 11.1
3-Methylbutyryl-CoA: 0.0

B591_RS00395: mmal

PKS_AT (570..868): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.0
Ethylmalonyl-CoA: 191.1
Methoxymalonyl-CoA: 164.1
2-Methylbutyryl-CoA: 112.7
Malonyl-CoA: 110.9
Propionyl-CoA: 105.2
trans-1,2-CPDA: 102.0
CHC-CoA: 86.6
Isobutyryl-CoA: 74.1
Acetyl-CoA: 62.1
Benzoyl-CoA: 60.6
fatty_acid: 47.1
inactive: 46.5
3-Methylbutyryl-CoA: 27.3

B591_RS00400: mmal - mmal - mal

PKS_AT (571..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.9
Ethylmalonyl-CoA: 203.2
Methoxymalonyl-CoA: 167.8
2-Methylbutyryl-CoA: 119.7
trans-1,2-CPDA: 110.5
Propionyl-CoA: 108.6
Malonyl-CoA: 102.3
CHC-CoA: 85.0
Isobutyryl-CoA: 79.9
Benzoyl-CoA: 55.8
Acetyl-CoA: 46.3
fatty_acid: 42.0
inactive: 38.0
3-Methylbutyryl-CoA: 17.3

PKS_AT (2366..2664): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.5
Ethylmalonyl-CoA: 195.2
Methoxymalonyl-CoA: 166.1
2-Methylbutyryl-CoA: 116.9
Malonyl-CoA: 113.2
trans-1,2-CPDA: 107.0
Propionyl-CoA: 106.4
CHC-CoA: 85.7
Isobutyryl-CoA: 77.6
Acetyl-CoA: 61.2
Benzoyl-CoA: 59.9
inactive: 46.9
fatty_acid: 46.4
3-Methylbutyryl-CoA: 28.3

PKS_AT (3915..4205): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.7
inactive: 104.0
Methoxymalonyl-CoA: 69.8
Methylmalonyl-CoA: 59.9
Propionyl-CoA: 35.3
Isobutyryl-CoA: 33.4
Ethylmalonyl-CoA: 26.8
Acetyl-CoA: 19.4
CHC-CoA: 18.6
Benzoyl-CoA: 16.9
trans-1,2-CPDA: 15.6
fatty_acid: 12.2
2-Methylbutyryl-CoA: 11.7
3-Methylbutyryl-CoA: 0.0

B591_RS00405: mmal - mal

PKS_AT (85..383): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 187.7
Ethylmalonyl-CoA: 175.6
Methoxymalonyl-CoA: 151.5
2-Methylbutyryl-CoA: 125.1
Malonyl-CoA: 103.9
Propionyl-CoA: 101.5
trans-1,2-CPDA: 88.4
CHC-CoA: 85.5
Isobutyryl-CoA: 67.7
Benzoyl-CoA: 67.3
inactive: 46.4
Acetyl-CoA: 46.4
3-Methylbutyryl-CoA: 34.8
fatty_acid: 34.6

PKS_AT (1060..1354): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.6
inactive: 112.9
Methoxymalonyl-CoA: 69.9
Methylmalonyl-CoA: 53.8
Isobutyryl-CoA: 36.3
Ethylmalonyl-CoA: 26.8
Benzoyl-CoA: 20.4
2-Methylbutyryl-CoA: 15.4
CHC-CoA: 11.1
fatty_acid: 9.4
trans-1,2-CPDA: 8.5
3-Methylbutyryl-CoA: 0.0
Propionyl-CoA: -0.8
Acetyl-CoA: -2.2

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator

NZ_CP106650.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 284,148 - 306,730 nt. (total: 22,583 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

B591_RS01170: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

B591_RS01175: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B591_RS01185: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS01200: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: deacetylase

B591_RS01195: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002318.2	0.42	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001858.2	0.39	PKS	alternapyrone B, alternapyrone C, alternapyrone D, alternapyrone E, alternapyrone F	Parastagonospora nodorum SN15
BGC0001768.4	0.39	NRPS	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0000012.3	0.39	PKS	alternapyrone	Alternaria solani
BGC0000194.5	0.39	PKS	actinorhodin	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.56	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002318.2	0.42	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0000234.5	0.41	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000616.4	0.40	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000678.5	0.39	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001858.2	0.39	PKS	alternapyrone B, alternapyrone C, alternapyrone D, alternapyrone E, alternapyrone F	Parastagonospora nodorum SN15
BGC0001768.4	0.39	NRPS	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0000012.3	0.39	PKS	alternapyrone	Alternaria solani
BGC0000194.5	0.39	PKS	actinorhodin	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		PSPP	C30	acyclic	PP
triterpene		squalene	C30	acyclic	none
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

B591_RS01205: PT_phytoene_like

Domain 1 (279 - 513): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.75 out of 23.05

Confidence: medium

Additional weak hits (4):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.65 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.61 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.05 out of 33.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_CP106650.1 - Region 3 - NRPS,NRPS-like,T1PKS,T3PKS

Download region GenBank file

Download region SVG

Location: 367,717 - 470,987 nt. (total: 103,271 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

B591_RS01575: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

B591_RS01585: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS01640: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

B591_RS01670: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

B591_RS01680: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B591_RS01710: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B591_RS01755: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase halogenase methyltransferase sulfotransferase

B591_RS01620: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

B591_RS01650: aminotransferase

smcogs: SMCOG1019: aminotransferase

B591_RS01675: Sulfotransferase domain

extras: Sulfotransfer_1: Sulfotransferase domain

B591_RS01690: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: esterase

B591_RS01715: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: hydratase lyase

B591_RS01630: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

B591_RS01655: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

B591_RS01660: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase synthase

B591_RS01605: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

B591_RS01635: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B591_RS01665: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

B591_RS01685: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B591_RS01695: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS01700: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	1.43	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	1.35	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001132.4	1.08	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	1.08	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	1.06	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001807.4	1.02	NRPS, PKS	totopotensamide A, totopotensamide B	Streptomyces pactum
BGC0001833.4	1.02	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	1.00	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.97	NRPS	AbT1	Aureobasidium pullulans
BGC0000342.4	0.96	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.77	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.75	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.23 out of 29.72

Confidence: medium

Additional weak hits (11):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.04 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.43 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.22 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.34 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.86 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.47 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.09 out of 31.73

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 39.62

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.07 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 367716 - 470987:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal - Me-ohmal - Me-redmal) + (Me-redmal - ohmal) + (Thr - Ala - Dab - X - X) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 367716 - 410938:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly) + (Thr - Ala - Dab - X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 375576 - 416719:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly) + (Thr - Ala - Dab - X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 379997 - 438735:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal - Me-ohmal - Me-redmal) + (Me-redmal - ohmal) + (Thr - Ala - Dab - X - X) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 400152 - 470987:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal - Me-ohmal - Me-redmal) + (Me-redmal - ohmal) + (Thr - Ala - Dab - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS01640: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (146..549): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISLWQSQLAVTGEVNCYGLTEVSDDSHH
Nearest Stachelhaus code(s):: Gly DIWQATCDDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

B591_RS01685: Thr - Ala - Dab - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (472..888): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LAAHFDFSVWEGSQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1576..1977): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LFRAFDVATWETQLLVAGEGNAYGPTEVSVIATA
Nearest Stachelhaus code(s):: Ala DVWQLAAVIK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3290..3684): Dab

nrpys: Dab

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDRAFDGSTVEVHLLTGADRSSYGPTEATVIATQ
Nearest Stachelhaus code(s):: Dab DGVHLGSVIK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4348..4751): X

nrpys: Dhpg, cl-me-dHpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LPAGFDSTTFDALLLTGGEMNGYGPTESITYTHT
Nearest Stachelhaus code(s):: Dhpg or cl-me-dHpg DSFLLGGTYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5416..5826): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: QWMAFDASVWEWQFLCLGEHNLYGPTEASIAVTA
Nearest Stachelhaus code(s):: Ile DAWQLLLVAK (97% 8Å match)
Stachelhaus code match:: 90% (moderate)

B591_RS01695: mmal - mal

PKS_AT (567..861): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 217.1
Ethylmalonyl-CoA: 202.5
Methoxymalonyl-CoA: 181.0
2-Methylbutyryl-CoA: 161.8
trans-1,2-CPDA: 132.7
Propionyl-CoA: 122.3
Malonyl-CoA: 114.9
CHC-CoA: 102.9
Isobutyryl-CoA: 77.5
Benzoyl-CoA: 66.9
inactive: 47.4
3-Methylbutyryl-CoA: 47.4
Acetyl-CoA: 44.2
fatty_acid: 29.4

PKS_AT (2683..2981): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.5
Methoxymalonyl-CoA: 72.2
inactive: 67.3
Methylmalonyl-CoA: 66.6
Ethylmalonyl-CoA: 49.3
Propionyl-CoA: 39.0
2-Methylbutyryl-CoA: 25.9
Isobutyryl-CoA: 22.4
Benzoyl-CoA: 15.1
Acetyl-CoA: 14.9
CHC-CoA: 12.8
trans-1,2-CPDA: 11.4
fatty_acid: 11.1
3-Methylbutyryl-CoA: 0.0

B591_RS01700: mal - mmal - mmal - mmal

PKS_AT (551..784): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 22.2
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (1566..1856): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 203.0
Ethylmalonyl-CoA: 190.3
Methoxymalonyl-CoA: 150.5
2-Methylbutyryl-CoA: 125.3
trans-1,2-CPDA: 117.2
Propionyl-CoA: 108.5
CHC-CoA: 98.1
Malonyl-CoA: 97.8
Isobutyryl-CoA: 65.9
Benzoyl-CoA: 59.5
Acetyl-CoA: 52.3
fatty_acid: 38.3
3-Methylbutyryl-CoA: 32.3
inactive: 32.2

PKS_AT (3339..3634): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 193.1
Ethylmalonyl-CoA: 177.8
Methoxymalonyl-CoA: 138.3
trans-1,2-CPDA: 104.1
2-Methylbutyryl-CoA: 103.4
Propionyl-CoA: 102.7
Malonyl-CoA: 100.0
CHC-CoA: 79.4
Benzoyl-CoA: 49.7
Isobutyryl-CoA: 46.8
Acetyl-CoA: 44.6
fatty_acid: 30.3
inactive: 29.1
3-Methylbutyryl-CoA: 25.2

PKS_AT (4887..5182): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.0
Ethylmalonyl-CoA: 197.1
Methoxymalonyl-CoA: 160.9
2-Methylbutyryl-CoA: 134.2
trans-1,2-CPDA: 118.2
Propionyl-CoA: 117.4
CHC-CoA: 95.2
Malonyl-CoA: 94.8
Benzoyl-CoA: 55.6
Acetyl-CoA: 54.7
Isobutyryl-CoA: 54.0
3-Methylbutyryl-CoA: 37.5
fatty_acid: 31.7
inactive: 27.1

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C

NZ_CP106650.1 - Region 4 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 522,713 - 572,132 nt. (total: 49,420 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxygenase

B591_RS02100: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B591_RS02105: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B591_RS02110: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B591_RS02115: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B591_RS02135: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: acetyltransferase kinase

B591_RS02090: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

B591_RS02185: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Ligases: synthase

B591_RS02120: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	1.21	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	1.21	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0000996.5	0.90	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001273.3	0.90	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.90	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.89	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002075.3	0.83	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001726.4	0.75	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001556.5	0.69	NRPS, PKS	combamide	Streptomyces sp.
BGC0002509.3	0.69	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	0.84	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	0.84	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0000996.5	0.75	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001726.4	0.70	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0001556.5	0.68	NRPS, PKS	combamide	Streptomyces sp.
BGC0002509.3	0.68	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (16):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.69 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.27 out of 19.26

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.97 out of 33.14

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.95 out of 27.04

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.70 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.86 out of 23.43

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.14 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.79 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.68 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.25 out of 28.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.08 out of 27.04

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.62 out of 29.65

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.06 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 522712 - 572132:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS02120: pk - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (558..854): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; CE-Malonyl-CoA: 54.2%; Acetyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 103.7
Methoxymalonyl-CoA: 96.6
Malonyl-CoA: 92.4
Ethylmalonyl-CoA: 85.6
Propionyl-CoA: 63.6
Isobutyryl-CoA: 60.5
Benzoyl-CoA: 57.2
Acetyl-CoA: 48.6
trans-1,2-CPDA: 48.1
2-Methylbutyryl-CoA: 46.3
CHC-CoA: 31.9
fatty_acid: 29.2
inactive: 21.9
3-Methylbutyryl-CoA: 13.6

AMP-binding (2314..2727): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: ASWAFDVFTGDRELIVGSDLNSYGVTEATIDSAC
Nearest Stachelhaus code(s):: Orn DVGEIGSIDK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein

NZ_CP106650.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 608,189 - 634,747 nt. (total: 26,559 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B591_RS02450: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B591_RS02485: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

B591_RS02425: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B591_RS02490: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthetase

B591_RS02445: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000859.3	0.47	other (other)	ectoine	Methylomicrobium alcaliphilum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

B591_RS02440: T2TS

Domain 1 (25 - 656): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

B591_RS02445: PT_FPPS_like

Domain 1 (57 - 351): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

B591_RS02455: PT_phytoene_like

Domain 1 (17 - 299): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

B591_RS02460: PT_phytoene_like

Domain 1 (17 - 293): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

Additional weak hits (6):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.67 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.44 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.96 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.94 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.26 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP106650.1 - Region 6 - RiPP-like

Download region GenBank file

Download region SVG

Location: 701,710 - 711,925 nt. (total: 10,216 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

B591_RS02785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000504.5	0.43	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000518.3	0.42	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001555.4	0.47	ribosomal	colicin V	Escherichia coli chi7122
BGC0000590.5	0.46	ribosomal	microcin N	Escherichia coli
BGC0000588.5	0.45	ribosomal	microcin L	Escherichia coli
BGC0000554.4	0.45	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000504.5	0.43	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0000500.5	0.42	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002306.2	0.42	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000518.3	0.42	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.07 out of 21.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.98 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.97 out of 27.04

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_CP106650.1 - Region 7 - PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 731,233 - 779,148 nt. (total: 47,916 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxidase

B591_RS02930: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B591_RS02970: flavodoxin

smcogs: SMCOG1134: flavodoxin

B591_RS02980: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS03005: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Hydrolases: hydrolase

B591_RS02950: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthase

B591_RS02995: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B591_RS03000: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.55	PKS	FR901512	fungal sp. No.14919
BGC0001258.3	0.52	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000013.3	0.32	PKS	alternariol	Aspergillus nidulans FGSC A4
BGC0002496.3	0.32	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001258.3	0.59	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002504.2	0.47	PKS	nocardiopsistin A, nocardiopsistin B, nocardiopsistin C	Nocardiopsis sp.
BGC0000013.3	0.47	PKS	alternariol	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

Additional weak hits (8):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.65 out of 27.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.96 out of 27.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.33 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.16 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.09 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.27 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 14, location 731232 - 779148:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS02995: mmal

PKS_AT (557..853): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Malonyl-CoA: 83.3%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 173.4
Methoxymalonyl-CoA: 140.3
Ethylmalonyl-CoA: 133.0
2-Methylbutyryl-CoA: 121.2
Malonyl-CoA: 101.9
trans-1,2-CPDA: 101.8
Propionyl-CoA: 97.2
Isobutyryl-CoA: 82.9
Benzoyl-CoA: 82.1
CHC-CoA: 63.6
Acetyl-CoA: 53.7
3-Methylbutyryl-CoA: 48.6
inactive: 36.2
fatty_acid: 30.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NZ_CP106650.1 - Region 8 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,125,372 - 1,136,685 nt. (total: 11,314 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B591_RS04705: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase

B591_RS04680: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001868.4	0.41	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001221.5	0.33	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001596.3	0.31	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001377.5	0.30	PKS	uncialamycin	Streptomyces uncialis
BGC0002788.2	0.29	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001984.3	0.27	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0001060.5	0.27	PKS	dynemicin A	Micromonospora chersina
BGC0000241.5	0.24	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0000029.5	0.23	PKS	BE-14106	Streptomyces sp. DSM 21069
BGC0001693.3	0.23	PKS	nenestatin	Micromonospora echinospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001868.4	0.41	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001221.5	0.33	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509
BGC0001596.3	0.31	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001377.5	0.30	PKS	uncialamycin	Streptomyces uncialis
BGC0002788.2	0.29	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001984.3	0.27	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0001060.5	0.27	PKS	dynemicin A	Micromonospora chersina
BGC0000241.5	0.24	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0000029.5	0.23	PKS	BE-14106	Streptomyces sp. DSM 21069
BGC0001693.3	0.23	PKS	nenestatin	Micromonospora echinospora

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.23 out of 32.74

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CP106650.1 - Region 9 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1,410,555 - 1,443,554 nt. (total: 33,000 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B591_RS05880: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

B591_RS05935: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

B591_RS05875: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 25.90 out of 27.18

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.14 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (12):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.90 out of 30.22

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.37 out of 25.88

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.32 out of 27.18

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.85 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.07 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.85 out of 26.06

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.89 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NZ_CP106650.1 - Region 10 - terpene

Download region GenBank file

Download region SVG

Location: 1,672,181 - 1,694,466 nt. (total: 22,286 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: transferase

B591_RS06990: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: cyclase

B591_RS07050: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase

B591_RS07060: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000122.5	0.36	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0002284.3	0.34	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001562.5	0.31	NRPS	curacomycin	Streptomyces curacoi
BGC0002477.3	0.31	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0000727.3	0.30	saccharide	indigoidine	Streptomyces aureofaciens
BGC0001940.3	0.30	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0002081.3	0.29	PKS	streptoketide A, streptoketide B, streptoketide C, S2502, S2507, UWM5	Streptomyces sp. Tue6314
BGC0000248.5	0.29	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737
BGC0000253.4	0.29	PKS	oviedomycin	Streptomyces antibioticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000122.5	0.36	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0002284.3	0.34	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0001562.5	0.31	NRPS	curacomycin	Streptomyces curacoi
BGC0002477.3	0.31	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0000727.3	0.30	saccharide	indigoidine	Streptomyces aureofaciens
BGC0001940.3	0.30	PKS	pyxidicycline A, pyxidicycline B	Pyxidicoccus fallax
BGC0002081.3	0.29	PKS	streptoketide A, streptoketide B, streptoketide C, S2502, S2507, UWM5	Streptomyces sp. Tue6314
BGC0000248.5	0.29	PKS	α naphtocyclinoic acid, fogacin	Streptomyces arenae DSM 40737
BGC0000253.4	0.29	PKS	oviedomycin	Streptomyces antibioticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

B591_RS07050: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (351 - 717): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP106650.1 - Region 11 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 2,051,240 - 2,072,283 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

B591_RS08660: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

B591_RS08705: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000340.5	0.38	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000561.5	0.38	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001364.3	0.41	ribosomal	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000678.5	0.41	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001605.3	0.40	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0000340.5	0.38	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0000498.5	0.38	ribosomal	bovicin HJ50	Streptococcus equinus
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000561.5	0.38	ribosomal	thermophilin 1277	Streptococcus thermophilus
BGC0000665.5	0.38	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

B591_RS08705: PT_FPPS_like

Domain 1 (61 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.14 out of 32.93

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.70 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.10 out of 30.98

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.69 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_CP106650.1 - Region 12 - terpene

Download region GenBank file

Download region SVG

Location: 2,082,090 - 2,103,064 nt. (total: 20,975 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B591_RS08835: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: deformylase

B591_RS08845: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

Lyases: cyclase

B591_RS08840: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.81	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.81	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.49	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0000677.5	0.46	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001911.3	0.41	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000650.3	0.36	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0002181.3	0.36	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0000286.3	0.36	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000706.3	0.35	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

B591_RS08840: T1TS

Domain 1 (2 - 303): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.29 out of 27.04

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.01 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.21 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.14 out of 24.78

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.17 out of 25.88

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.73 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.28 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.57 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.46 out of 20.01

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
PsrA	Oleic acid responsive regulator

NZ_CP106650.1 - Region 13 - RRE-containing,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 2,566,327 - 2,601,000 nt. (total: 34,674 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase

B591_RS11010: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: amidase hydrolase

B591_RS10920: amidase

smcogs: SMCOG1105: amidase

B591_RS10935: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

B591_RS11025: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

B591_RS10970: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.42	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.37	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001146.5	0.37	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000628.4	0.34	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0000605.5	0.34	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0001640.3	0.33	ribosomal	kocurin	Kocuria rosea
BGC0001472.5	0.33	ribosomal	berninamycin A	Streptomyces bernensis
BGC0000569.5	0.32	ribosomal	plantazolicin	Bacillus velezensis FZB42
BGC0001860.4	0.32	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0002316.2	0.32	ribosomal	cebulantin	Saccharopolyspora cebuensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001145.5	0.54	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.51	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000628.4	0.51	ribosomal	lactocillin	Lactobacillus paragasseri JV-V03
BGC0001146.5	0.51	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000613.5	0.49	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0001860.4	0.49	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000605.5	0.48	ribosomal	GE37468	Streptomyces sp. ATCC 55365
BGC0001640.3	0.48	ribosomal	kocurin	Kocuria rosea
BGC0001174.4	0.47	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001472.5	0.47	ribosomal	berninamycin A	Streptomyces bernensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.79 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 16.83 out of 30.25

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.21 out of 32.74

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.62 out of 21.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.71 out of 25.88

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 24 - 102; Score: 59.7; RRE type: Heterocycloanthracin_C_RRE; Location: 23 - 107; Score: 37.3
: RRE type: Thiopeptide_F_RRE; Location: 24 - 102; Score: 59.7; RRE type: Heterocycloanthracin_C_RRE; Location: 23 - 107; Score: 37.3

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_CP106650.1 - Region 14 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 2,877,505 - 2,900,078 nt. (total: 22,574 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B591_RS12430: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B591_RS12435: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: hydrolase

B591_RS12415: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.81	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.80	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.66	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.62	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.56	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.81	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.80	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000553.3	0.66	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000546.3	0.62	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.56	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.55	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for B591_RS12390

B591_RS12385

Leader:

MALLDLQAMDTPQEEAVGDLAT

Core:

GSQISLLICEYSSLSVTLCTP

Core with dehydrations:

GDhaQIDhaLLICysEYDhaDhaLDhaVDhbLCysDhbP

antiSMASH-DB 4.0 matches for B591_RS12385

100.0%

NC_020990.1and 26 others:

NZ_AMPN02000002.1 Lanthipeptides: SM8_RS12785_lanthipeptideNZ_AP025692.1 Lanthipeptides: MTP06_RS18190_lanthipeptideNZ_CM002273.1 Lanthipeptides: B590_RS12280_lanthipeptideNZ_CP009802.1 Lanthipeptides: SFR_RS12925_lanthipeptideNZ_CP014485.1 Lanthipeptides: Salbus254_RS12710_lanthipeptideNZ_CP016824.1 Lanthipeptides: BEN82_RS18165_lanthipeptideNZ_CP026490.1 Lanthipeptides: C3K23_RS19520_lanthipeptideNZ_CP031742.1 Lanthipeptides: D0C37_RS13445_lanthipeptideNZ_CP047147.1 Lanthipeptides: GR131_RS18520_lanthipeptideNZ_CP053539.1 Lanthipeptides: HN026_RS11800_lanthipeptideNZ_CP056773.1 Lanthipeptides: HWN34_RS12245_lanthipeptideNZ_CP063844.1 Lanthipeptides: IPZ55_RS12410_lanthipeptideNZ_CP064783.1 Lanthipeptides: IT782_RS12060_lanthipeptideNZ_CP076385.1 Lanthipeptides: KNZ81_RS12450_lanthipeptideNZ_CP079112.1 Lanthipeptides: STALF2_RS18135_lanthipeptideNZ_CP091820.1 Lanthipeptides: L2I08_RS02835_lanthipeptideNZ_CP106650.1 Lanthipeptides: B591_RS12385_lanthipeptideNZ_CP113103.1 Lanthipeptides: OSU72_RS17905_lanthipeptideNZ_JAHUVY010000001.1 Lanthipeptides: STALF3_RS17905_lanthipeptideNZ_JALLPQ010000001.1 Lanthipeptides: MWG58_RS12385_lanthipeptideNZ_KB890715.1 Lanthipeptides: B048_RS0115750_lanthipeptideNZ_KN549183.1 Lanthipeptides: D076_RS30740_lanthipeptideNZ_KZ195583.1 Lanthipeptides: B9W68_RS12440_lanthipeptideNZ_MNPQ01000004.1 Lanthipeptides: BGV78_RS11170_lanthipeptideNZ_OX371412.1 Lanthipeptides: OZE77_RS18215_lanthipeptideNZ_VOGX01000092.1 Lanthipeptides: FRZ02_RS31600_lanthipeptide

Lanthipeptides: XNR_RS11575_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQISLLICEYSSLSVTLCTP

1

GSQISLLICEYSSLSVTLCTP

21

95.2%

NZ_CM001165.1and 4 others:

NZ_CP021118.1 Lanthipeptides: CAC01_RS28155_lanthipeptideNZ_CP049945.1 Lanthipeptides: G9U55_RS17850_lanthipeptideNZ_CP119149.1 Lanthipeptides: P0D76_RS02270_lanthipeptideNZ_RWGV01000033.1 Lanthipeptides: EJA11_RS20985_lanthipeptide

Lanthipeptides: STTU_RS29395_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICEYSSLSVTLCTP

1

GSQVSLLICEYSSLSVTLCTP

21

90.5%

NZ_BDHJ01000008.1and 4 others:

NZ_CP032543.1 Lanthipeptides: D6270_RS22715_lanthipeptideNZ_CP076457.1 Lanthipeptides: KME66_RS09945_lanthipeptideNZ_CP077652.1 Lanthipeptides: KRR37_RS22855_lanthipeptideNZ_WUEJ01000001.1 Lanthipeptides: GRQ63_RS04560_lanthipeptide

Lanthipeptides: BHQ08_RS03045_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSVTLCTP

1

GSQVSLLVCEYSSLSVTLCTP

21

with 70 more sequence matches

Only the first 10 are displayed here.

90.5%

NZ_CP045178.1:

Lanthipeptides: GBW32_RS28450_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICEYSSLSV LCTP

1

GSQVSLLICEYSSLSVVLCTP

21

90.5%

NZ_ML123034.1:

Lanthipeptides: EES43_RS19795_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICE+SSLSVTLCTP

1

GSQVSLLICEFSSLSVTLCTP

21

85.7%

NC_010572.1and 60 others:

NC_021177.1 Lanthipeptides: SFUL_RS24355_lanthipeptideNZ_AQRK01000102.1 Lanthipeptides: YUW_RS30025_lanthipeptideNZ_ARPF01000003.1 Lanthipeptides: B083_RS0107255_lanthipeptideNZ_BMRY01000001.1 Lanthipeptides: IE140_RS02070_lanthipeptideNZ_BMSP01000003.1 Lanthipeptides: IE150_RS06495_lanthipeptideNZ_BMSZ01000003.1 Lanthipeptides: IE135_RS07550_lanthipeptideNZ_BMTW01000017.1 Lanthipeptides: IE134_RS28550_lanthipeptideNZ_BMUG01000009.1 Lanthipeptides: IE264_RS25430_lanthipeptideNZ_BMVK01000002.1 Lanthipeptides: IE272_RS07115_lanthipeptideNZ_BNBJ01000002.1 Lanthipeptides: IE304_RS05195_lanthipeptideNZ_CM003601.1 Lanthipeptides: JI76_RS25200_lanthipeptideNZ_CP010833.1 Lanthipeptides: TK78_RS10875_lanthipeptideNZ_CP011522.1 Lanthipeptides: ABE83_RS11805_lanthipeptideNZ_CP013738.1 Lanthipeptides: WQO_RS23525_lanthipeptideNZ_CP015362.1 Lanthipeptides: A6E92_RS09975_lanthipeptideNZ_CP020563.1 Lanthipeptides: B7C62_RS24450_lanthipeptideNZ_CP020570.1 Lanthipeptides: B1H20_RS34690_lanthipeptideNZ_CP024957.1 Lanthipeptides: CVT27_RS22730_lanthipeptideNZ_CP029361.1 Lanthipeptides: DIJ69_RS10225_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS22865_lanthipeptideNZ_CP061072.1 Lanthipeptides: HYC88_RS10560_lanthipeptideNZ_CP079114.1 Lanthipeptides: KV381_RS24895_lanthipeptideNZ_CP084357.1 Lanthipeptides: LEL86_RS29435_lanthipeptideNZ_CP086102.1 Lanthipeptides: LK895_RS11660_lanthipeptideNZ_CP090837.1 Lanthipeptides: LZ559_RS24025_lanthipeptideNZ_CP096281.1 Lanthipeptides: MWG59_RS25685_lanthipeptideNZ_CP101397.1 Lanthipeptides: NLU04_RS06465_lanthipeptideNZ_CP110539.1 Lanthipeptides: OH133_RS12690_lanthipeptideNZ_CP112880.1 Lanthipeptides: N7925_RS11185_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS22935_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS24530_lanthipeptideNZ_DS999644.1 Lanthipeptides: SSGG_RS09925_lanthipeptideNZ_GL877172.1 Lanthipeptides: SACT1_RS12960_lanthipeptideNZ_JAAWWP010000002.1 Lanthipeptides: HFV08_RS04115_lanthipeptideNZ_JAGGOV010000004.1 Lanthipeptides: J7E92_RS02930_lanthipeptideNZ_JAHHWT010000009.1 Lanthipeptides: KM153_RS24430_lanthipeptideNZ_JALDPQ010000064.1 Lanthipeptides: MQC87_RS23965_lanthipeptideNZ_JAMFLF010000002.1 Lanthipeptides: M1212_RS07295_lanthipeptideNZ_JANRMN010000004.1 Lanthipeptides: NW249_RS08610_lanthipeptideNZ_JNLT01000003.1 Lanthipeptides: CD02_RS0108685_lanthipeptideNZ_KB890925.1 Lanthipeptides: B053_RS0113845_lanthipeptideNZ_KL573549.1 Lanthipeptides: BG84_RS0119125_lanthipeptideNZ_KQ257779.1 Lanthipeptides: IQ60_RS22540_lanthipeptideNZ_KZ195572.1 Lanthipeptides: B9W61_RS11940_lanthipeptideNZ_KZ679082.1 Lanthipeptides: C6W96_RS24050_lanthipeptideNZ_KZ819154.1 Lanthipeptides: DBP12_RS10285_lanthipeptideNZ_KZ819178.1 Lanthipeptides: DBP20_RS23960_lanthipeptideNZ_KZ819182.1 Lanthipeptides: DBP21_RS24660_lanthipeptideNZ_LACR01000009.1 Lanthipeptides: YW5_RS12280_lanthipeptideNZ_LIPB01000001.1 Lanthipeptides: AMK17_RS03280_lanthipeptideNZ_LIPE01000001.1 Lanthipeptides: AMK12_RS03355_lanthipeptideNZ_LIVT01000001.1 Lanthipeptides: AMK24_RS01700_lanthipeptideNZ_LIVW01000001.1 Lanthipeptides: AMK28_RS03165_lanthipeptideNZ_LIXK01000001.1 Lanthipeptides: AMK23_RS04085_lanthipeptideNZ_LMEL01000012.1 Lanthipeptides: ASD29_RS10010_lanthipeptideNZ_LZRD01000054.1 Lanthipeptides: A3Q37_RS33745_lanthipeptideNZ_ML123117.1 Lanthipeptides: EES46_RS10300_lanthipeptideNZ_NNBN01000004.1 Lanthipeptides: CG717_RS12310_lanthipeptideNZ_VEHK01000004.1 Lanthipeptides: FS984_RS13530_lanthipeptideNZ_WWGD01000029.1 Lanthipeptides: GTY72_RS23245_lanthipeptide

Lanthipeptides: SGR_RS11800_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSV LCTP

1

GSQVSLLVCEYSSLSVVLCTP

21

85.7%

NZ_LWLE01000019.1:

Lanthipeptides: A6A29_RS44250_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLLICE+SSLS+TLCTP

1

GSQVSLLICEHSSLSLTLCTP

21

81.0%

NZ_CP010519.1and 1 other:

NZ_CP092644.1 Lanthipeptides: MID12_RS21330_lanthipeptide

Lanthipeptides: SLNWT_RS22370_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSV LC+P

1

GSQVSLLVCEYSSLSVVLCSP

21

81.0%

NZ_CP045702.1:

Lanthipeptides: F0344_RS33200_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CE+SSLS+TLCTP

1

GSQVSLLVCEHSSLSLTLCTP

21

81.0%

NZ_CP054926.1and 11 others:

NZ_CP068598.1 Lanthipeptides: IFE09_RS23820_lanthipeptideNZ_CP071044.1 Lanthipeptides: JHY03_RS23495_lanthipeptideNZ_CP080029.1 Lanthipeptides: KZO11_RS24935_lanthipeptideNZ_JAJUKK010000008.1 Lanthipeptides: LXH09_RS27635_lanthipeptideNZ_JOJC01000009.1 Lanthipeptides: IO23_RS0108435_lanthipeptideNZ_KB891296.1 Lanthipeptides: B061_RS0103425_lanthipeptideNZ_KZ268499.1 Lanthipeptides: CE422_RS23450_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS22830_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS10975_lanthipeptideNZ_LZQS01000001.1 Lanthipeptides: STIB_RS05225_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS24840_lanthipeptide

Lanthipeptides: HUT09_RS23550_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CE+SSLSV LCTP

1

GSQVSLLVCEFSSLSVVLCTP

21

81.0%

NZ_CP058556.1and 5 others:

NZ_CP059898.1 Lanthipeptides: H3V39_RS22935_lanthipeptideNZ_CP070242.1 Lanthipeptides: I6J39_RS23755_lanthipeptideNZ_CP070260.1 Lanthipeptides: I6J40_RS10935_lanthipeptideNZ_JAJDST010000047.1 Lanthipeptides: LJC81_RS16960_lanthipeptideNZ_WWGL01000003.1 Lanthipeptides: GTY38_RS03410_lanthipeptide

Lanthipeptides: HXS80_RS11105_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+S+L+CEYSSLSV LCTP

1

GSQVSVLVCEYSSLSVVLCTP

21

76.2%

NZ_AQRJ01000051.1and 1 other:

NZ_LFBV01000002.1 Lanthipeptides: AB852_RS09920_lanthipeptide

Lanthipeptides: YW7_RS14945_lanthipeptide

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SL++CEYSSLS LCTP

1

GSQVSLIVCEYSSLSALLCTP

21

66.7%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

1

GSQISLLICEYSSLSVTLCT

20

GSQ SLL+C SSLSVT C

2

GSQASLLLCGDSSLSVTTCN

21

MIBiG 4.0 matches for B591_RS12385

81.8%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

GSQISLLICEYSSLSVTLCTP

21

GSQ+SLL+CEYSSLSV LCTP

2

GSQVSLLVCEYSSLSVVLCTP

22

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.02 out of 25.31

Confidence: medium

Additional weak hits (4):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.30 out of 18.57

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.75 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.70 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.71 out of 26.06

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

B591_RS12385 - Class III

Cleavage pHMM score: 30.10

RODEO score: 0

Monoisotopic mass: 2087.1 Da

Molecular weight: 2088.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2106.4 Da N = 1; 2124.5 Da N = 2; 2142.5 Da N = 3; 2160.5 Da N = 4; 2178.5 Da N = 5

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_CP106650.1 - Region 15 - PKS-like

Download region GenBank file

Download region SVG

Location: 3,034,517 - 3,075,470 nt. (total: 40,954 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

B591_RS13275: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

B591_RS13295: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Hydrolases: phosphatase

B591_RS13285: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Lyases: lyase

B591_RS13235: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

B591_RS13260: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthase

B591_RS13290: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: permease

B591_RS13210: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002313.3	0.51	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000387.5	0.48	NRPS	mangotoxin	Pseudomonas syringae pv. syringae
BGC0002294.3	0.45	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0001985.4	0.44	other (other)	Pyrazofurin	Streptomyces candidus
BGC0002536.3	0.44	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699
BGC0002039.3	0.42	other (other)	coformycin, formycin A	Nocardia interforma ATCC 21072
BGC0000131.5	0.42	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000700.5	0.41	saccharide	istamycin	Streptomyces tenjimariensis
BGC0001747.3	0.41	other (other)	pseudaminic acid	Tannerella forsythia
BGC0002443.3	0.41	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002313.3	0.51	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0000387.5	0.48	NRPS	mangotoxin	Pseudomonas syringae pv. syringae
BGC0002294.3	0.45	other (other)	streptozotocin	Streptomyces achromogenes subsp. streptozoticus
BGC0001985.4	0.44	other (other)	Pyrazofurin	Streptomyces candidus
BGC0002536.3	0.44	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699
BGC0002039.3	0.42	other (other)	coformycin, formycin A	Nocardia interforma ATCC 21072
BGC0000131.5	0.42	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000700.5	0.41	saccharide	istamycin	Streptomyces tenjimariensis
BGC0001747.3	0.41	other (other)	pseudaminic acid	Tannerella forsythia
BGC0002443.3	0.41	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.38 out of 23.79

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.92 out of 27.04

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

Additional weak hits (10):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.60 out of 29.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.77 out of 27.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.99 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.83 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.65 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.01 out of 32.93

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 26.85

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP106650.1 - Region 16 - NRPS

Download region GenBank file

Download region SVG

Location: 3,726,005 - 3,788,243 nt. (total: 62,239 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B591_RS16525: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase aminotransferase methyltransferase

B591_RS16465: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

B591_RS16580: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

B591_RS16585: aminotransferase

smcogs: SMCOG1019: aminotransferase

B591_RS16615: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Hydrolases: hydrolase

B591_RS16470: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

B591_RS16490: isochorismatase

smcogs: SMCOG1027: isochorismatase

B591_RS16555: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase

B591_RS16545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B591_RS16550: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.71	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.68	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.05 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.68 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.28 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.67 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.34 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.38 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.60 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.84 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.05 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.43 out of 29.65

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.28 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.51 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.01 out of 29.25

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 23, location 3726004 - 3788243:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - D-Val - Trp) + (D-Thr - X - D-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS16545: Thr - X - X

Search NORINE for peptide: strict or relaxed

AMP-binding (513..932): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LQTHFDFSVWEGNQVFGGEVNMYGITETTVHVTQ
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2054..2460): X

nrpys: Orn, Lys, Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IAWTVDLFFADRELSVGSEVNAYGSTEVTIDATV
Nearest Stachelhaus code(s):: Arg DVADVGAIDK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (3117..3508): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TDFLFDGGVSDCMTGAAGDRNIYGPSETTLVATL
Nearest Stachelhaus code(s):: Phe DGWTGAILSK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

B591_RS16550: Ile - Val - Trp

Search NORINE for peptide: strict or relaxed

AMP-binding (28..428): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LGQAWDGFAIEGFLMTGGELHVYGPMENGGYTTW
Nearest Stachelhaus code(s):: Leu DGFFLGVVYK (47% 8Å match); Ile DGFFLGVVYK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1096..1494): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: VGQAWDAFSLEGWLITGGEINGYGPVESMVFATA
Nearest Stachelhaus code(s):: Val DALWIGGVFK (62% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2620..3016): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asn (Asn)

Stachelhaus prediction details:

Stachelhaus sequence:: YWASFDLTVTSPKAVLGGEVNEYGPTEATVGCME
Nearest Stachelhaus code(s):: Trp DLTKVGEVGK (85% 8Å match); Asn DLTKVGEVGK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
OsdR	Development and stress management regulator

NZ_CP106650.1 - Region 17 - NRPS,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 3,946,144 - 4,054,959 nt. (total: 108,816 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B591_RS17625: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acyltransferase

B591_RS17575: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

B591_RS17580: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: hydrolase

B591_RS17585: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

B591_RS17620: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

B591_RS17565: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B591_RS17570: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001792.5	0.78	NRPS	surugamide A, surugamide D	Streptomyces albidoflavus
BGC0001135.5	0.44	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.44	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.41	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.40	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.40	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.39	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.39	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.38	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001792.5	0.86	NRPS	surugamide A, surugamide D	Streptomyces albidoflavus
BGC0001135.5	0.75	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.72	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.16 out of 23.43

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (18):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.72 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.30 out of 27.78

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.08 out of 19.26

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.35 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.79 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 13.90 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.81 out of 30.25

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 16.30 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.31 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.02 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.82 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 15.82 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.49 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.34 out of 29.65

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 24, location 3946143 - 4054959:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - D-Ala - Ile - D-X - Lys) + (Trp - D-Leu - Val - Thr) + (Ile - D-Leu - Val - D-Ala - Val - D-Ala) + (X - D-Phe - D-Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 25, location 3946143 - 4051848:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - D-Ala - Ile - D-X - Lys) + (Trp - D-Leu - Val - Thr) + (Ile - D-Leu - Val - D-Ala - Val - D-Ala) + (X - D-Phe - D-Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS17565: X - Phe - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (504..890): X

nrpys: Ile, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDAATYEAFLWTGGEVHVYGPTETTTFAIS
Nearest Stachelhaus code(s):: Ile or aIle DAYFWGVTFK (97% 8Å match); Ile or Val DAYFWGVTFK (85% 8Å match); Leu DAYFWGVTFK (82% 8Å match); Val DAYFWGVTFK (82% 8Å match); Ile DAYFWGVTFK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1536..1941): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDASWWEMTLVVAGEVNAYGPTETSVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3081..3478): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSLAFDASVLELLIFTGGEVNAYGPTETTVVATM
Nearest Stachelhaus code(s):: Leu DALLFGAVVK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

B591_RS17570: Ile - Leu - Val - Ala - Val - Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (525..926): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWFSFLDSVTEGTLVSSGELNLYGSSEISADSLA
Nearest Stachelhaus code(s):: Ile LDTTVSLADK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1587..1964): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FALAFDASVMEMLIATGGELNAYGPTEITVAASI
Nearest Stachelhaus code(s):: Leu DAMLAGAVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3090..3478): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHSFDAATYEVWIWTGGDVNGYGPTETTTFAVS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4138..4508): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWASFDVSVFEGSAVLAGEANIYGPTEATVYATG
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5634..6025): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDGSFDAATYEVWIWTGGDVNGYGPTETTTFAVT
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (6686..7059): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWASFDVSVFEGSGVLAGEANIYGPTEATVYATG
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

B591_RS17575: Trp - Leu - Val - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (43..432): Trp

nrpys: Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Polar aromatic ring (Tyr, bOH-Tyr)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAHVFDVAMADMMVVIGGEVNAYGPTEATVCTTL
Nearest Stachelhaus code(s):: Trp DVAMVGAVCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1104..1481): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FALAFDASVMEMLIATGGELNAYGPTEITVAASI
Nearest Stachelhaus code(s):: Leu DAMLAGAVAK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2622..3011): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHSFDAATYEVWIWTGGDVNGYGPTETTTFAVS
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3660..4072): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFTVWEGNQVFGGEVNMYGITETTVHVTS
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

B591_RS17580: Ile - Ala - Ile - X - Lys

Search NORINE for peptide: strict or relaxed

AMP-binding (19..406): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDAATYEVFLWTGGEVHVYGPTETTTFAVC
Nearest Stachelhaus code(s):: Ile DAYFWGVTFK (97% 8Å match); Ile or aIle DAYFWGVTFK (94% 8Å match); Ile or Val DAYFWGVTFK (88% 8Å match); Val DAYFWGVTFK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1059..1431): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWASFDVSVFEGSAVLAGEANIYGPTEATVYATG
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2567..2960): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDAATYEVFLWTGGEVHVYGPTEATTFALC
Nearest Stachelhaus code(s):: Ile DAYFWGVTFK (100% 8Å match); Ile or Val DAYFWGVTFK (88% 8Å match); Val DAYFWGVTFK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3624..4010): X

nrpys: Ile, aIle

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSSFDAATYEAFLWTGGEVHVYGPTETTTFAIS
Nearest Stachelhaus code(s):: Ile or aIle DAYFWGVTFK (94% 8Å match); Ile or Val DAYFWGVTFK (85% 8Å match); Leu DAYFWGVTFK (82% 8Å match); Val DAYFWGVTFK (82% 8Å match); Ile DAYFWGVTFK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5135..5545): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: GSWAFDVFVSDHDTAGGADVNGYGVTEATVESCV
Nearest Stachelhaus code(s):: Lys DVSDAGGVEK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 17 - 113; Score: 71.4; RRE type: NHLP_CD_RRE; Location: 18 - 110; Score: 51.9; RRE type: Cyanobactin_D_RRE; Location: 17 - 94; Score: 39.4

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C

Core peptide predictions

No core peptides found.

NZ_CP106650.1 - Region 18 - NRPS

Download region GenBank file

Download region SVG

Location: 4,542,642 - 4,587,009 nt. (total: 44,368 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B591_RS20110: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS20115: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS20140: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Hydrolases: esterase hydrolase

B591_RS20070: putative esterase

smcogs: SMCOG1104: putative esterase

B591_RS20185: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: lyase

B591_RS20100: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

B591_RS20105: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

B591_RS20080: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

B591_RS20120: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B591_RS20160: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.67	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.67	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0000342.4	0.63	NRPS	enniatin	Fusarium equiseti
BGC0001261.3	0.63	NRPS	AM-toxin	Alternaria alternata
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae
BGC0002276.2	0.63	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.63	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (13):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.32 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.74 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.18 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.00 out of 18.57

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.65 out of 19.26

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.47 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.58 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.99 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.16 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.44 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.31 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 27, location 4542641 - 4587009:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Asp)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS20120: Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (6..422): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YSLTADLGNTCLKTLLGGEVNHYGPTETTVGVAA
Nearest Stachelhaus code(s):: Asp DLTKVGHVGK (71% 8Å match); OH-Asp DLTKVGHVGK (68% 8Å match); Asn DLTKLGEVGK (59% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_CP106650.1 - Region 19 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 4,769,415 - 4,799,235 nt. (total: 29,821 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B591_RS21185: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

B591_RS21205: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS21230: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: carboxylase

B591_RS21240: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Lyases: decarboxylase

B591_RS21190: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Ligases: synthase

B591_RS21235: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Translocases: transporter

B591_RS21105: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.78	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.71	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.71	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002284.3	0.57	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.83	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.78	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.71	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.71	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.63	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002284.3	0.57	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.91 out of 26.85

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 36.53 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.62 out of 36.53

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.65 out of 23.43

Confidence: medium

Additional weak hits (8):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.45 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.87 out of 20.97

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.23 out of 36.54

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.57 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.10 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.78 out of 27.18

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.67 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
BldD	Development and antibiotic global regulator
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP106650.1 - Region 20 - NRPS-like

Download region GenBank file

Download region SVG

Location: 4,891,414 - 4,933,228 nt. (total: 41,815 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

B591_RS21705: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B591_RS21735: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: aminotransferase glycosyltransferase

B591_RS21675: aminotransferase

smcogs: SMCOG1019: aminotransferase

B591_RS21710: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: ligase

B591_RS21665: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B591_RS21700: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B591_RS21760: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.70	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.65	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.70	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.65	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.60	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.54 out of 23.79

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.88 out of 29.72

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (9):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.35 out of 25.88

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.56 out of 29.51

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.31 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.08 out of 20.97

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.71 out of 27.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.18 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.90 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 29, location 4891413 - 4933228:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS21665: X

AMP-binding (5..404): X

nrpys: Val, Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FHLTFDATTFEALVFVGGEVNAYGPTETTTFVTR
Nearest Stachelhaus code(s):: Val DAFFFGGTFK (65% 8Å match); Ile or Val DAFWIGATFK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

B591_RS21700: X

AMP-binding (34..438): X

nrpys: Sma

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAVLNGVHLT-ASVVSAAALQGYGLTETTNFSTT
Nearest Stachelhaus code(s):: Sma GLTSVAGNFK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

B591_RS21760: X

AMP-binding (8..407): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YHVAFDASVFEADTMFSGEENNYGPTEAGVCVSY
Nearest Stachelhaus code(s):: Phe DAFVLSAVCK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_CP106650.1 - Region 21 - ectoine

Download region GenBank file

Download region SVG

Location: 5,645,530 - 5,655,928 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

B591_RS25000: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase

B591_RS24990: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

B591_RS25015: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B591_RS25025: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.86	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.67	other (other)	ectoine	Methylobacter marinus
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (9):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.91 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.12 out of 26.12

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.04 out of 31.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.88 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.78 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.95 out of 29.65

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_CP106650.1 - Region 22 - T2PKS

Download region GenBank file

Download region SVG

Location: 6,236,855 - 6,309,346 nt. (total: 72,492 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

B591_RS27885: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B591_RS27910: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

B591_RS27935: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase acylase sulfhydrylase

B591_RS27805: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

B591_RS27915: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B591_RS27945: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

B591_RS27990: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: dehalogenase

B591_RS28010: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: hydratase lyase

B591_RS27950: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

B591_RS28040: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

B591_RS27905: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B591_RS27925: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B591_RS27930: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS27955: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000220.4	0.88	PKS	enterocin	Streptomyces maritimus
BGC0002366.2	0.88	PKS	enterocin, neoenterocin A, neoenterocin B	Streptomyces sp. SCSIO 11863
BGC0000231.5	0.69	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0001723.5	0.58	PKS	oviedomycin	Streptomyces antibioticus
BGC0000221.5	0.58	PKS	erdacin	uncultured soil bacterium V167
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000220.4	0.88	PKS	enterocin	Streptomyces maritimus
BGC0002366.2	0.88	PKS	enterocin, neoenterocin A, neoenterocin B	Streptomyces sp. SCSIO 11863
BGC0000231.5	0.69	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000272.3	0.61	PKS	spore pigment	Streptomyces collinus
BGC0001723.5	0.58	PKS	oviedomycin	Streptomyces antibioticus
BGC0000221.5	0.58	PKS	erdacin	uncultured soil bacterium V167
BGC0000234.5	0.58	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001641.4	0.58	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.73 out of 26.85

Confidence: medium

Additional weak hits (23):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.64 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 26.33

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.00 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.48 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.57 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.89 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.01 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.06 out of 32.74

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.37 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.82 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.53 out of 26.06

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.97 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.00 out of 24.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 19.65 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.23 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.82 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.57 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.97 out of 27.04

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.29 out of 26.06

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.53 out of 32.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

B591_RS27905: X

AMP-binding (20..415): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AHYTHAYGLGSFFSISAAELDGVGSTEMLHIYCS
Nearest Stachelhaus code(s):: pNH2-Bz AYNFIAGSTK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

B591_RS27915: mal

PKS_AT (18..298): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 53.1
Methoxymalonyl-CoA: 26.6
Methylmalonyl-CoA: 22.9
Propionyl-CoA: 18.1
inactive: 17.2
Benzoyl-CoA: 13.3
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

B591_RS27955: X

AMP-binding (36..422): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TMIQYMDPQWKMYVVLCSDREVYGSTESGLDLIM
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 6236854 to 6309346
Starter unit(s):: benzoyl-CoA (Score: 2670.0; E-value: 0)
Malonyl elongations:: 7 (Score: 729.6; E-value: 2e-222)
Product molecular weight(s):: benzoyl-CoA_7: 416 Da

B591_RS27905: LIG (Score: 660.2; E-value: 4e-201); LIG AAF81733.1_Enterocin_benzoyl-CoA (Score: 1008.0; E-value: 0.0)
B591_RS27910: OXY (Score: 35.5; E-value: 1.3e-11)
B591_RS27915: AT (Score: 413.6; E-value: 1.4e-126); AT AAF81731.1_Enterocin_benzoyl-CoA (Score: 635.0; E-value: 0.0)
B591_RS27920: ACP (Score: 89.8; E-value: 2e-28)
B591_RS27925: CLF 7 (Score: 729.6; E-value: 2e-222)
B591_RS27930: KS (Score: 720.3; E-value: 1.6e-219)
B591_RS27935: KR C9 (Score: 409.1; E-value: 1.7e-125)
B591_RS27940: MET (Score: 83.7; E-value: 3e-26)
B591_RS27955: LIG (Score: 650.6; E-value: 3.3e-198); LIG AAF81723.1_Enterocin_benzoyl-CoA (Score: 1027.0; E-value: 0.0)
B591_RS27960: CYC C1-C18|C2-C19 (Score: 174.2; E-value: 2.9e-54)

TFBS definitions

Regulator	Description
RutR	Regulator of the pyrimidine and purine metabolism

NZ_CP106650.1 - Region 23 - terpene

Download region GenBank file

Download region SVG

Location: 6,424,098 - 6,452,288 nt. (total: 28,191 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

B591_RS28655: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

B591_RS28690: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B591_RS28715: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B591_RS28775: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Ligases: synthase synthetase

B591_RS28685: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

B591_RS28740: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.73	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.67	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.64	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.64	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.64	terpene	isorenieratene	Streptomyces argillaceus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000645.3	0.50	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.73	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.67	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.64	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.64	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0001456.3	0.64	terpene	isorenieratene	Streptomyces argillaceus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000645.3	0.50	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

B591_RS28685: PT_FPPS_like

Domain 1 (70 - 366): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

B591_RS28695: PT_phytoene_like

Domain 1 (16 - 313): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

B591_RS28720: Lycopene_cycl

Domain 1 (5 - 382): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.48 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.85 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.67 out of 28.19

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.34 out of 27.04

Confidence: strong

Additional weak hits (9):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.55 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.79 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.26 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.73 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.17 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.02 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_CP106650.1 - Region 24 - RiPP-like

Download region GenBank file

Download region SVG

Location: 6,531,677 - 6,543,044 nt. (total: 11,368 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.86	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000513.3	0.43	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002005.2	0.41	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.86	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000513.3	0.43	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000519.4	0.42	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001555.4	0.42	ribosomal	colicin V	Escherichia coli chi7122
BGC0000501.3	0.42	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0002005.2	0.41	ribosomal	RaxX	Xanthomonas oryzae pv. oryzae
BGC0000554.4	0.41	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001843.2	0.41	NRPS	tridecaptin M	Paenibacillus sp. M-152

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_CP106650.1 - Region 25 - NRPS,NRPS-like,T1PKS,T3PKS,lanthipeptide-class-ii,terpene-precursor

Download region GenBank file

Download region SVG

Location: 6,544,917 - 6,848,481 nt. (total: 303,565 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
terpene-precursor: (PT_FPPS_like and not PT_HPP)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B591_RS29310: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B591_RS29350: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B591_RS29355: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B591_RS29360: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B591_RS29425: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS29520: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B591_RS29605: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS29645: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B591_RS29755: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS29855: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: acetyltransferase acylase acyltransferase aminotransferase formyltransferase glycosyltransferase halogenase

B591_RS29480: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B591_RS29485: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

B591_RS29525: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

B591_RS29530: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B591_RS29650: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B591_RS29655: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

B591_RS29770: halogenase

smcogs: SMCOG1119: halogenase

B591_RS29780: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Hydrolases: esterase protease

B591_RS29510: thioesterase

smcogs: SMCOG1004: thioesterase

B591_RS29740: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

B591_RS29815: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase dehydratase

B591_RS29460: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B591_RS29685: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Isomerases: isomerase

B591_RS29505: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase synthetase

B591_RS29305: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

B591_RS29435: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

B591_RS29465: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS29470: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS29475: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS29500: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS29640: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B591_RS29660: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B591_RS29675: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS29785: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS29790: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS29800: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Translocases: permease

B591_RS29235: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000958.5	2.20	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0001273.3	2.20	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	1.88	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	1.80	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.79	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001216.5	1.76	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0002191.2	1.75	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	1.75	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	1.75	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001284.4	1.72	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000958.5	0.96	NRPS, PKS	antimycin	Streptomyces sp. S4
BGC0000034.5	0.95	NRPS, PKS	candicidin	Streptomyces sp. FR-008
BGC0001216.5	0.87	NRPS, PKS	splenocin C	Streptomyces sp. CNQ431
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001455.6	0.81	NRPS, PKS	antimycin A1B	Streptomyces argillaceus
BGC0001273.3	0.76	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.76	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.76	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.72	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for B591_RS29685

allorf_6778006_6778191

Leader:

MGDGGTWGSGPHLSWRARRGPGG

Core:

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

Core with dehydrations:

RAGDhbARPHPRAAGQVHRRAADhbQVRGCysRCysARALDhbRVDhaGP

antiSMASH-DB 4.0 matches for allorf_6778006_6778191

100.0%

NZ_CM002273.1and 3 others:

NZ_CM002273.1 Lanthipeptides: allorf_6788528_6788713_lanthipeptideNZ_CP106650.1 Lanthipeptides: allorf_6778006_6778191_lanthipeptideNZ_CP106650.1 Lanthipeptides: allorf_6778006_6778191_lanthipeptide

Lanthipeptides: allorf_6788528_6788713_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

97.4%

NC_020990.1and 1 other:

NC_020990.1 Lanthipeptides: allorf_6768184_6768369_lanthipeptide

Lanthipeptides: allorf_6768184_6768369_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPHPRAAG VHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

94.7%

NZ_CP113103.1and 1 other:

NZ_CP113103.1 Lanthipeptides: allorf_0072598_0072783_lanthipeptide

Lanthipeptides: allorf_0072598_0072783_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPH RAAG VHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHLRAAGHVHRRAATQVRGCRCARALTRVSGP

38

with 8 more sequence matches

86.8%

NZ_MNPQ01000024.1and 1 other:

NZ_MNPQ01000024.1 Lanthipeptides: allorf_033269_033448_lanthipeptide

Lanthipeptides: allorf_033269_033448_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

RAGTA PRAAG +HRRAATQVRGCRCARALTRVSGP

1

RAGTA--SPRAAGHLHRRAATQVRGCRCARALTRVSGP

36

57.9%

NZ_CP026490.1:

Lanthipeptides: allorf_0208403_0208621_lanthipeptide

5

ARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

ARP+PRAA V RA TQV +C +ALTRVSGP

5

ARPYPRAARHVRLRATTQVPVRQCPKALTRVSGP

38

55.3%

NZ_CP076385.1:

Lanthipeptides: allorf_6932531_6932749_lanthipeptide

5

ARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

ARP+PRAA V A TQV +C +ALTRVSGP

5

ARPYPRAARHVRLPATTQVPVRQCPKALTRVSGP

38

50.0%

NZ_CP009802.1and 1 other:

NZ_CP009802.1 Lanthipeptides: allorf_7024728_7024922_lanthipeptide

Lanthipeptides: allorf_7024728_7024922_lanthipeptide

20

ATQVRGCRCARALTRVSGP

38

ATQVRGCRCARALTRVSGP

1

ATQVRGCRCARALTRVSGP

19

26.3%

NZ_CP012109.1:

Lanthipeptides: A176_RS40855_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCR

27

RAG + A G V RA+ GC

4

RAGGSDSASVAGGSVSSRASDSDVGCD

30

15.8%

NZ_CP061274.1:

Lanthipeptides: allorf_2084980_2085063_lanthipeptide

16

HRRAATQVRGC

26

HRR ++RGC

7

HRRLGGEMRGC

17

14.5%

NZ_CP067395.1and 1 other:

NZ_CP072597.1 Lanthipeptides: J5226_RS17500_lanthipeptide

Lanthipeptides: JHW38_RS03590_lanthipeptide

19

AATQVRGCRCARALTRVSG

37

AATQ +GC C+ +G

6

AATQSQGCFCSTIYYNDAG

24

14.5%

NZ_FNOG01000005.1:

Lanthipeptides: BLU84_RS14530_lanthipeptide

19

AATQVRGCRCARALTRVSGP

38

AATQ +GC C+ +G

6

AATQSQGCFCSTIYYNDAGD

25

Lanthipeptide(s) for B591_RS29705

allorf_6778006_6778191

Leader:

MGDGGTWGSGPHLSWRARRGPGG

Core:

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

Core with dehydrations:

RAGDhbARPHPRAAGQVHRRAADhbQVRGCysRCysARALDhbRVDhaGP

antiSMASH-DB 4.0 matches for allorf_6778006_6778191

100.0%

NZ_CM002273.1and 3 others:

NZ_CM002273.1 Lanthipeptides: allorf_6788528_6788713_lanthipeptideNZ_CP106650.1 Lanthipeptides: allorf_6778006_6778191_lanthipeptideNZ_CP106650.1 Lanthipeptides: allorf_6778006_6778191_lanthipeptide

Lanthipeptides: allorf_6788528_6788713_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

97.4%

NC_020990.1and 1 other:

NC_020990.1 Lanthipeptides: allorf_6768184_6768369_lanthipeptide

Lanthipeptides: allorf_6768184_6768369_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPHPRAAG VHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHPRAAGHVHRRAATQVRGCRCARALTRVSGP

38

94.7%

NZ_CP113103.1and 1 other:

NZ_CP113103.1 Lanthipeptides: allorf_0072598_0072783_lanthipeptide

Lanthipeptides: allorf_0072598_0072783_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

RAGTARPH RAAG VHRRAATQVRGCRCARALTRVSGP

1

RAGTARPHLRAAGHVHRRAATQVRGCRCARALTRVSGP

38

with 8 more sequence matches

86.8%

NZ_MNPQ01000024.1and 1 other:

NZ_MNPQ01000024.1 Lanthipeptides: allorf_033269_033448_lanthipeptide

Lanthipeptides: allorf_033269_033448_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

RAGTA PRAAG +HRRAATQVRGCRCARALTRVSGP

1

RAGTA--SPRAAGHLHRRAATQVRGCRCARALTRVSGP

36

57.9%

NZ_CP026490.1:

Lanthipeptides: allorf_0208403_0208621_lanthipeptide

5

ARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

ARP+PRAA V RA TQV +C +ALTRVSGP

5

ARPYPRAARHVRLRATTQVPVRQCPKALTRVSGP

38

55.3%

NZ_CP076385.1:

Lanthipeptides: allorf_6932531_6932749_lanthipeptide

5

ARPHPRAAGQVHRRAATQVRGCRCARALTRVSGP

38

ARP+PRAA V A TQV +C +ALTRVSGP

5

ARPYPRAARHVRLPATTQVPVRQCPKALTRVSGP

38

50.0%

NZ_CP009802.1and 1 other:

NZ_CP009802.1 Lanthipeptides: allorf_7024728_7024922_lanthipeptide

Lanthipeptides: allorf_7024728_7024922_lanthipeptide

20

ATQVRGCRCARALTRVSGP

38

ATQVRGCRCARALTRVSGP

1

ATQVRGCRCARALTRVSGP

19

26.3%

NZ_CP012109.1:

Lanthipeptides: A176_RS40855_lanthipeptide

1

RAGTARPHPRAAGQVHRRAATQVRGCR

27

RAG + A G V RA+ GC

4

RAGGSDSASVAGGSVSSRASDSDVGCD

30

15.8%

NZ_CP061274.1:

Lanthipeptides: allorf_2084980_2085063_lanthipeptide

16

HRRAATQVRGC

26

HRR ++RGC

7

HRRLGGEMRGC

17

14.5%

NZ_CP067395.1and 1 other:

NZ_CP072597.1 Lanthipeptides: J5226_RS17500_lanthipeptide

Lanthipeptides: JHW38_RS03590_lanthipeptide

19

AATQVRGCRCARALTRVSG

37

AATQ +GC C+ +G

6

AATQSQGCFCSTIYYNDAG

24

14.5%

NZ_FNOG01000005.1:

Lanthipeptides: BLU84_RS14530_lanthipeptide

19

AATQVRGCRCARALTRVSGP

38

AATQ +GC C+ +G

6

AATQSQGCFCSTIYYNDAGD

25

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

B591_RS29435: PT_FPPS_like

Domain 1 (80 - 367): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.29 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 27.49 out of 30.12

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (35):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.64 out of 30.97

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.84 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.66 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.14 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.02 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.88 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 13.96 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.43 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.86 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.49 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.35 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.40 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 12.89 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.11 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.77 out of 27.55

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.72 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.63 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.63 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.41 out of 27.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.72 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.20 out of 30.11

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.65 out of 29.65

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.09 out of 30.11

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.49 out of 23.43

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.76 out of 21.84

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.96 out of 28.14

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.77 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Core peptide predictions

allorf_6778006_6778191 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 3975.2 Da

Molecular weight: 3977.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3995.6 Da N = 1; 4013.6 Da N = 2

allorf_6778006_6778191 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 3975.2 Da

Molecular weight: 3977.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3995.6 Da N = 1; 4013.6 Da N = 2

Predicted core structure(s)

For candidate cluster 34, location 6544916 - 6848481:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - pk - ohmal - ohmal - ohmal) + (redmal - redmal - ohmal - redmal) + (ccmal) + (Me-ohmal - Me-redmal - Me-ccmal) + (ccmal - ccmal - ccmal - ccmal - ccmal - ccmal) + (X - mal) + (mal) + (Thr - fatty_acid) + (Acetyl-CoA - mal - Pro) + (Gly - ccmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 36, location 6576235 - 6731471:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ohmal - pk - ohmal - ohmal - ohmal) + (redmal - redmal - ohmal - redmal) + (ccmal) + (Me-ohmal - Me-redmal - Me-ccmal) + (ccmal - ccmal - ccmal - ccmal - ccmal - ccmal) + (X - mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 38, location 6730061 - 6796403:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Acetyl-CoA - mal - Pro) + (Thr - fatty_acid) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 40, location 6784132 - 6848481:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - ccmal) + (mal - ohmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS29465: mal - mal - pk - mal - mal - mal

PKS_AT (558..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.0
inactive: 89.9
Methoxymalonyl-CoA: 53.9
Methylmalonyl-CoA: 44.2
Isobutyryl-CoA: 29.8
Propionyl-CoA: 28.2
Ethylmalonyl-CoA: 23.4
2-Methylbutyryl-CoA: 23.0
Acetyl-CoA: 18.1
Benzoyl-CoA: 16.6
CHC-CoA: 13.7
trans-1,2-CPDA: 8.7
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2314..2621): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 217.0
inactive: 103.4
Methoxymalonyl-CoA: 60.8
Methylmalonyl-CoA: 48.3
Propionyl-CoA: 39.2
Acetyl-CoA: 22.2
Isobutyryl-CoA: 20.7
2-Methylbutyryl-CoA: 19.3
Benzoyl-CoA: 16.7
Ethylmalonyl-CoA: 10.5
trans-1,2-CPDA: 9.3
CHC-CoA: 8.3
fatty_acid: 8.2
3-Methylbutyryl-CoA: 0.0

PKS_AT (3873..4170): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 222.6
Methylmalonyl-CoA: 220.9
Methoxymalonyl-CoA: 179.9
2-Methylbutyryl-CoA: 158.5
trans-1,2-CPDA: 135.2
Propionyl-CoA: 114.8
CHC-CoA: 113.7
Malonyl-CoA: 107.6
Isobutyryl-CoA: 79.9
Benzoyl-CoA: 63.4
Acetyl-CoA: 52.3
3-Methylbutyryl-CoA: 34.7
fatty_acid: 31.5
inactive: 29.2

PKS_AT (5407..5716): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 219.6
inactive: 116.2
Methoxymalonyl-CoA: 66.7
Methylmalonyl-CoA: 59.0
Isobutyryl-CoA: 29.0
Propionyl-CoA: 21.9
Benzoyl-CoA: 13.9
CHC-CoA: 11.6
Acetyl-CoA: 10.5
fatty_acid: 9.5
3-Methylbutyryl-CoA: 7.6
trans-1,2-CPDA: 0.0
2-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -3.1

PKS_AT (6936..7236): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.3
inactive: 104.8
Methoxymalonyl-CoA: 58.2
Methylmalonyl-CoA: 48.7
Propionyl-CoA: 26.4
Acetyl-CoA: 19.1
Benzoyl-CoA: 19.0
CHC-CoA: 14.3
Isobutyryl-CoA: 12.8
Ethylmalonyl-CoA: 11.5
2-Methylbutyryl-CoA: 10.8
fatty_acid: 7.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (8465..8766): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.2
inactive: 108.5
Methoxymalonyl-CoA: 64.4
Methylmalonyl-CoA: 58.4
Isobutyryl-CoA: 34.8
Ethylmalonyl-CoA: 32.3
Propionyl-CoA: 22.3
CHC-CoA: 21.0
Benzoyl-CoA: 17.7
Acetyl-CoA: 14.7
2-Methylbutyryl-CoA: 12.5
fatty_acid: 11.9
trans-1,2-CPDA: 11.5
3-Methylbutyryl-CoA: 0.0

B591_RS29470: mal - mal - mal - mal

PKS_AT (550..845): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 233.6
inactive: 116.5
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 56.6
Isobutyryl-CoA: 26.6
Benzoyl-CoA: 24.2
Propionyl-CoA: 23.7
Acetyl-CoA: 21.0
Ethylmalonyl-CoA: 13.3
fatty_acid: 11.4
CHC-CoA: 11.0
2-Methylbutyryl-CoA: 4.5
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2592..2891): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 203.6
inactive: 93.9
Methoxymalonyl-CoA: 61.5
Methylmalonyl-CoA: 51.7
Benzoyl-CoA: 23.4
Ethylmalonyl-CoA: 20.0
Isobutyryl-CoA: 18.8
Acetyl-CoA: 18.7
fatty_acid: 15.9
Propionyl-CoA: 14.8
CHC-CoA: 12.2
2-Methylbutyryl-CoA: 10.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4635..4931): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.2
inactive: 115.8
Methoxymalonyl-CoA: 70.5
Methylmalonyl-CoA: 62.9
Propionyl-CoA: 36.0
Isobutyryl-CoA: 28.6
Ethylmalonyl-CoA: 23.2
Benzoyl-CoA: 22.7
fatty_acid: 21.1
Acetyl-CoA: 19.7
2-Methylbutyryl-CoA: 18.8
CHC-CoA: 17.9
trans-1,2-CPDA: 9.8
3-Methylbutyryl-CoA: 0.0

PKS_AT (6161..6459): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.3
inactive: 102.1
Methoxymalonyl-CoA: 61.1
Methylmalonyl-CoA: 52.0
Propionyl-CoA: 25.0
Acetyl-CoA: 21.1
2-Methylbutyryl-CoA: 19.7
CHC-CoA: 19.1
Benzoyl-CoA: 19.1
Ethylmalonyl-CoA: 16.0
fatty_acid: 14.5
Isobutyryl-CoA: 14.2
trans-1,2-CPDA: 9.4
3-Methylbutyryl-CoA: 0.0

B591_RS29475: mal

PKS_AT (547..843): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 220.5
inactive: 115.3
Methoxymalonyl-CoA: 59.1
Methylmalonyl-CoA: 54.5
Propionyl-CoA: 23.1
Isobutyryl-CoA: 20.0
Benzoyl-CoA: 18.1
Acetyl-CoA: 17.9
fatty_acid: 9.7
Ethylmalonyl-CoA: 8.4
CHC-CoA: 8.0
2-Methylbutyryl-CoA: 7.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

B591_RS29480: mmal - mmal - mmal

PKS_AT (573..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.4
Ethylmalonyl-CoA: 211.4
Methoxymalonyl-CoA: 166.9
2-Methylbutyryl-CoA: 153.3
trans-1,2-CPDA: 128.3
Propionyl-CoA: 118.6
Malonyl-CoA: 96.1
CHC-CoA: 94.2
Isobutyryl-CoA: 67.9
Benzoyl-CoA: 67.0
Acetyl-CoA: 53.3
fatty_acid: 42.4
inactive: 32.7
3-Methylbutyryl-CoA: 32.2

PKS_AT (2141..2438): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.4
Ethylmalonyl-CoA: 211.4
Methoxymalonyl-CoA: 166.9
2-Methylbutyryl-CoA: 153.3
trans-1,2-CPDA: 128.3
Propionyl-CoA: 118.6
Malonyl-CoA: 96.1
CHC-CoA: 94.2
Isobutyryl-CoA: 67.9
Benzoyl-CoA: 67.0
Acetyl-CoA: 53.3
fatty_acid: 42.4
inactive: 32.7
3-Methylbutyryl-CoA: 32.2

PKS_AT (4248..4545): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Malonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.1
Ethylmalonyl-CoA: 202.9
Methoxymalonyl-CoA: 169.3
2-Methylbutyryl-CoA: 131.7
trans-1,2-CPDA: 129.8
Propionyl-CoA: 108.2
Malonyl-CoA: 103.0
CHC-CoA: 98.2
Isobutyryl-CoA: 71.5
Benzoyl-CoA: 57.5
Acetyl-CoA: 41.0
inactive: 38.2
fatty_acid: 30.1
3-Methylbutyryl-CoA: 28.7

B591_RS29485: mal - mal - mal - mal - mal - mal

PKS_AT (578..870): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 227.6
inactive: 106.4
Methoxymalonyl-CoA: 54.7
Methylmalonyl-CoA: 50.9
Propionyl-CoA: 31.3
Acetyl-CoA: 22.1
Ethylmalonyl-CoA: 20.1
Benzoyl-CoA: 17.4
Isobutyryl-CoA: 14.8
trans-1,2-CPDA: 12.7
fatty_acid: 12.2
2-Methylbutyryl-CoA: 9.8
CHC-CoA: 4.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (2320..2612): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 224.5
inactive: 106.8
Methoxymalonyl-CoA: 58.5
Methylmalonyl-CoA: 55.2
Propionyl-CoA: 32.4
Benzoyl-CoA: 24.4
Acetyl-CoA: 23.9
Isobutyryl-CoA: 22.2
Ethylmalonyl-CoA: 19.5
trans-1,2-CPDA: 17.2
2-Methylbutyryl-CoA: 11.3
fatty_acid: 10.6
CHC-CoA: 3.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (4060..4350): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.9
inactive: 98.2
Methoxymalonyl-CoA: 53.0
Methylmalonyl-CoA: 47.6
Acetyl-CoA: 27.8
Propionyl-CoA: 19.2
Benzoyl-CoA: 16.5
Isobutyryl-CoA: 14.2
Ethylmalonyl-CoA: 12.5
CHC-CoA: 10.9
2-Methylbutyryl-CoA: 10.8
fatty_acid: 10.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (5776..6068): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 229.5
inactive: 111.7
Methoxymalonyl-CoA: 54.8
Methylmalonyl-CoA: 54.0
Propionyl-CoA: 31.4
Acetyl-CoA: 24.0
Ethylmalonyl-CoA: 19.0
Benzoyl-CoA: 18.6
trans-1,2-CPDA: 18.0
Isobutyryl-CoA: 17.6
fatty_acid: 13.1
2-Methylbutyryl-CoA: 12.3
CHC-CoA: 3.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (7491..7782): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 83.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 221.2
inactive: 95.5
Methoxymalonyl-CoA: 54.3
Methylmalonyl-CoA: 47.9
Propionyl-CoA: 29.8
Acetyl-CoA: 20.9
Ethylmalonyl-CoA: 19.1
Isobutyryl-CoA: 17.8
Benzoyl-CoA: 13.3
fatty_acid: 9.9
trans-1,2-CPDA: 9.6
2-Methylbutyryl-CoA: 7.7
3-Methylbutyryl-CoA: 0.0
CHC-CoA: -0.6

PKS_AT (9332..9621): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 210.5
inactive: 88.7
Methoxymalonyl-CoA: 41.1
Methylmalonyl-CoA: 38.9
Propionyl-CoA: 28.5
Acetyl-CoA: 25.0
Ethylmalonyl-CoA: 15.9
Isobutyryl-CoA: 11.1
Benzoyl-CoA: 9.9
2-Methylbutyryl-CoA: 6.7
CHC-CoA: 6.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

B591_RS29500: X - mal

AMP-binding (30..440): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NAALF--GLQSSVALTAGAVVVWGMSEAGNGTSS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

PKS_AT (1204..1498): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 198.6
inactive: 90.5
Methoxymalonyl-CoA: 67.2
Methylmalonyl-CoA: 57.1
Isobutyryl-CoA: 48.8
Ethylmalonyl-CoA: 32.4
Acetyl-CoA: 31.4
Propionyl-CoA: 31.1
2-Methylbutyryl-CoA: 23.2
Benzoyl-CoA: 20.3
fatty_acid: 18.9
CHC-CoA: 11.6
trans-1,2-CPDA: 11.0
3-Methylbutyryl-CoA: 7.1

B591_RS29640: X

AMP-binding (7..402): X

nrpys: Pyv, Ant

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: IGWCHGSMVVSTWMLYGAARQVYGMTEVGGFVTL
Nearest Stachelhaus code(s):: Pyv or Ant GSVWLGVGFK (100% 8Å match); Ant GSVWLGVGFK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

B591_RS29650: mal

PKS_AT (543..825): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 125.5
inactive: 68.7
Methoxymalonyl-CoA: 59.2
Methylmalonyl-CoA: 39.2
Ethylmalonyl-CoA: 23.7
Propionyl-CoA: 23.3
Isobutyryl-CoA: 15.1
Benzoyl-CoA: 13.3
Acetyl-CoA: 10.3
fatty_acid: 9.4
2-Methylbutyryl-CoA: 3.8
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

B591_RS29655: Thr - fatty_acid

Search NORINE for peptide: strict or relaxed

AMP-binding (461..875): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LASHFDFSVWEGNQVLGGEVNMYGITETTVHVTF
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

CAL_domain (1710..2121): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 16.7
Acetyl-CoA: 13.3
AHBA: 6.5
NH2: 1.5
shikimic_acid: 0.0

B591_RS29675: Acetyl-CoA - mal - Pro

Search NORINE for peptide: strict or relaxed

CAL_domain (54..488): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 22.3
AHBA: 16.0
fatty_acid: 14.9
NH2: 10.7
shikimic_acid: 0.0

PKS_AT (1197..1479): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 102.4
inactive: 54.5
Methylmalonyl-CoA: 46.9
Methoxymalonyl-CoA: 38.8
Propionyl-CoA: 37.1
fatty_acid: 24.5
CHC-CoA: 19.4
Ethylmalonyl-CoA: 18.4
2-Methylbutyryl-CoA: 16.8
trans-1,2-CPDA: 15.4
Benzoyl-CoA: 14.7
Isobutyryl-CoA: 12.7
3-Methylbutyryl-CoA: 8.6
Acetyl-CoA: 7.9

AMP-binding (2584..2978): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: pro (Pro)
Single AA prediction:: pro (Pro)

Stachelhaus prediction details:

Stachelhaus sequence:: LGHTFDVSVQETFMYSAGEYNQYGPTETSVIVTS
Nearest Stachelhaus code(s):: Pro DVQFIAQVVK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

B591_RS29780: Gly - mal

Search NORINE for peptide: strict or relaxed

AMP-binding (567..948): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FGITFDISLLELQALSGGEWNLYGPTEATVWASS
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (76% 8Å match)
Stachelhaus code match:: 100% (strong)

PKS_AT (2717..3006): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 119.4
inactive: 71.1
Methylmalonyl-CoA: 56.2
Methoxymalonyl-CoA: 55.5
Propionyl-CoA: 28.2
Ethylmalonyl-CoA: 26.3
Isobutyryl-CoA: 24.6
Benzoyl-CoA: 17.1
fatty_acid: 15.8
2-Methylbutyryl-CoA: 9.0
CHC-CoA: 8.0
trans-1,2-CPDA: 4.8
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

B591_RS29790: mal

PKS_AT (1674..1970): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%; Isobutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 138.1
Methoxymalonyl-CoA: 58.0
inactive: 54.5
Methylmalonyl-CoA: 53.4
Propionyl-CoA: 42.5
fatty_acid: 29.3
Isobutyryl-CoA: 23.8
Ethylmalonyl-CoA: 21.4
2-Methylbutyryl-CoA: 9.3
trans-1,2-CPDA: 9.2
CHC-CoA: 9.0
Benzoyl-CoA: 9.0
Acetyl-CoA: 7.1
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator

NZ_CP106650.1 - Region 26 - T1PKS,azoxy-crosslink,butyrolactone

Download region GenBank file

Download region SVG

Location: 6,888,459 - 6,987,245 nt. (total: 98,787 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
butyrolactone: AfsA
azoxy-crosslink: (azdH and LPG_synthase_C and azdO and vlmB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

B591_RS30135: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B591_RS30180: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B591_RS30220: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

B591_RS30290: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B591_RS30295: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B591_RS30340: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

B591_RS30345: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: PPTase acylase aminotransferase transferase

B591_RS30115: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

B591_RS30190: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

B591_RS30230: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B591_RS30285: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: esterase hydrolase

B591_RS30175: thioesterase

smcogs: SMCOG1004: thioesterase

B591_RS30210: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

B591_RS30215: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: cyclase

B591_RS30085: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

B591_RS30080: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B591_RS30140: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS30145: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS30150: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS30155: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B591_RS30225: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B591_RS30265: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	1.00	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.97	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.74	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001273.3	0.43	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.43	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.41	PKS	oronofacic acid	Pseudomonas syringae
BGC0000204.5	0.39	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0000914.5	0.39	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0002578.2	0.38	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001065.5	0.36	PKS	herboxidiene	Streptomyces chromofuscus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.78	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.73	PKS	oronofacic acid	Pseudomonas syringae
BGC0000850.5	0.70	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.58 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 28.31 out of 30.12

Confidence: strong

Additional weak hits (23):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.83 out of 26.85

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.13 out of 29.65

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.09 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.18 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.13 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.54 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.48 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.93 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.60 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.70 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.96 out of 35.63

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.46 out of 36.53

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.49 out of 32.74

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.30 out of 18.57

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.55 out of 20.01

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.71 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 41, location 6888458 - 6987245:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ccmal) + (Me-ccmal - Me-ohmal - ohmal) + (Me-redmal) + (ccmal) + (mal)
Non-colinear ordering:: B591_RS30140 + B591_RS30145 + B591_RS30150 + B591_RS30230 + B591_RS30155

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 42, location 6888458 - 6980660:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - ccmal) + (Me-ccmal - Me-ohmal - ohmal) + (Me-redmal) + (ccmal) + (mal)
Non-colinear ordering:: B591_RS30140 + B591_RS30145 + B591_RS30150 + B591_RS30230 + B591_RS30155

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B591_RS30140: mmal - mal

PKS_AT (85..383): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 187.7
Ethylmalonyl-CoA: 175.6
Methoxymalonyl-CoA: 151.5
2-Methylbutyryl-CoA: 125.1
Malonyl-CoA: 103.9
Propionyl-CoA: 101.5
trans-1,2-CPDA: 88.4
CHC-CoA: 85.5
Isobutyryl-CoA: 67.7
Benzoyl-CoA: 67.3
inactive: 46.4
Acetyl-CoA: 46.4
3-Methylbutyryl-CoA: 34.8
fatty_acid: 34.6

PKS_AT (1060..1354): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.6
inactive: 112.9
Methoxymalonyl-CoA: 69.9
Methylmalonyl-CoA: 53.8
Isobutyryl-CoA: 36.3
Ethylmalonyl-CoA: 26.8
Benzoyl-CoA: 20.4
2-Methylbutyryl-CoA: 15.4
CHC-CoA: 11.1
fatty_acid: 9.4
trans-1,2-CPDA: 8.5
3-Methylbutyryl-CoA: 0.0
Propionyl-CoA: -0.8
Acetyl-CoA: -2.2

B591_RS30145: mmal - mmal - mal

PKS_AT (571..870): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 210.9
Ethylmalonyl-CoA: 203.2
Methoxymalonyl-CoA: 167.8
2-Methylbutyryl-CoA: 119.7
trans-1,2-CPDA: 110.5
Propionyl-CoA: 108.6
Malonyl-CoA: 102.3
CHC-CoA: 85.0
Isobutyryl-CoA: 79.9
Benzoyl-CoA: 55.8
Acetyl-CoA: 46.3
fatty_acid: 42.0
inactive: 38.0
3-Methylbutyryl-CoA: 17.3

PKS_AT (2366..2664): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 207.5
Ethylmalonyl-CoA: 195.2
Methoxymalonyl-CoA: 166.1
2-Methylbutyryl-CoA: 116.9
Malonyl-CoA: 113.2
trans-1,2-CPDA: 107.0
Propionyl-CoA: 106.4
CHC-CoA: 85.7
Isobutyryl-CoA: 77.6
Acetyl-CoA: 61.2
Benzoyl-CoA: 59.9
inactive: 46.9
fatty_acid: 46.4
3-Methylbutyryl-CoA: 28.3

PKS_AT (3915..4205): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 222.7
inactive: 104.0
Methoxymalonyl-CoA: 69.8
Methylmalonyl-CoA: 59.9
Propionyl-CoA: 35.3
Isobutyryl-CoA: 33.4
Ethylmalonyl-CoA: 26.8
Acetyl-CoA: 19.4
CHC-CoA: 18.6
Benzoyl-CoA: 16.9
trans-1,2-CPDA: 15.6
fatty_acid: 12.2
2-Methylbutyryl-CoA: 11.7
3-Methylbutyryl-CoA: 0.0

B591_RS30150: mmal

PKS_AT (570..868): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.0
Ethylmalonyl-CoA: 191.1
Methoxymalonyl-CoA: 164.1
2-Methylbutyryl-CoA: 112.7
Malonyl-CoA: 110.9
Propionyl-CoA: 105.2
trans-1,2-CPDA: 102.0
CHC-CoA: 86.6
Isobutyryl-CoA: 74.1
Acetyl-CoA: 62.1
Benzoyl-CoA: 60.6
fatty_acid: 47.1
inactive: 46.5
3-Methylbutyryl-CoA: 27.3

B591_RS30155: mal

PKS_AT (570..874): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 160.6
inactive: 69.6
Methylmalonyl-CoA: 66.8
Methoxymalonyl-CoA: 64.4
Ethylmalonyl-CoA: 42.8
Isobutyryl-CoA: 25.9
Benzoyl-CoA: 25.9
Propionyl-CoA: 25.8
CHC-CoA: 19.4
Acetyl-CoA: 19.0
fatty_acid: 17.8
trans-1,2-CPDA: 16.8
2-Methylbutyryl-CoA: 11.1
3-Methylbutyryl-CoA: 0.0

B591_RS30225: X

AMP-binding (21..437): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAMSFGIAGIGLFVAYGAAAQIYASTEAGSVAVC
Nearest Stachelhaus code(s):: Ant GIILFGVGVK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

B591_RS30230: mal

PKS_AT (547..842): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 174.9
inactive: 105.9
Methylmalonyl-CoA: 56.1
Methoxymalonyl-CoA: 55.4
Propionyl-CoA: 44.5
Isobutyryl-CoA: 38.2
2-Methylbutyryl-CoA: 26.9
Acetyl-CoA: 18.7
Benzoyl-CoA: 16.6
Ethylmalonyl-CoA: 16.4
CHC-CoA: 12.5
fatty_acid: 10.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
OsdR	Development and stress management regulator

NZ_CP106651.1 - Region 1 - linaridin

Download region GenBank file

Download region SVG

Location: 10,609 - 31,190 nt. (total: 20,582 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B591_RS30590: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: methyltransferase

B591_RS30630: methyltransferase

smcogs: SMCOG1248: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001735.5	0.48	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002701.2	0.39	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0000517.4	0.38	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001210.5	0.37	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001188.3	0.37	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0000551.5	0.36	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002698.2	0.35	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002110.3	0.35	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001735.5	0.48	other (other)	pentostatine, vidarabine	Streptomyces antibioticus
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0002701.2	0.39	ribosomal	paenithipeptin	Paenibacillus thiaminolyticus
BGC0000517.4	0.38	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001210.5	0.37	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001188.3	0.37	ribosomal	legonaridin	Streptomyces sp. CT34
BGC0000551.5	0.36	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0002698.2	0.35	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002110.3	0.35	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 21.57 out of 26.33

Confidence: medium

Additional weak hits (6):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 21.26 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.15 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.63 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.39 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.44 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.61 out of 33.14

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems