GCF_000382065.1 - 6 region(s) - antiSMASH results

Identified secondary metabolite regions using strictness 'relaxed'

NZ_KB907498.1 ([Pseudomonas] hibiscicola ATCC 19867)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RiPP-like	357,535	368,410
Region 1.2	RiPP-like	686,982	697,827

NZ_KB907499.1 ([Pseudomonas] hibiscicola ATCC 19867)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	NRP-metallophore,NRPS	409,210	457,577	High	2,3-dihydroxybenzoylserine	NRPS:Type I

NZ_KB907502.1 ([Pseudomonas] hibiscicola ATCC 19867)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	lanthipeptide-class-ii	6,666	29,563

NZ_KB907503.1 ([Pseudomonas] hibiscicola ATCC 19867)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	arylpolyene	256,008	299,610	Low	APE Vf	other:other

NZ_KB907506.1 ([Pseudomonas] hibiscicola ATCC 19867)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	terpene-precursor	1	12,794

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RiPP-like	357,535	368,410
Region 1.2	RiPP-like	686,982	697,827
Region 2.1	NRP-metallophore,NRPS	409,210	457,577	High	2,3-dihydroxybenzoylserine	NRPS:Type I
Region 5.1	lanthipeptide-class-ii	6,666	29,563
Region 6.1	arylpolyene	256,008	299,610	Low	APE Vf	other:other
Region 9.1	terpene-precursor	1	12,794

No secondary metabolite regions were found in these records:: NZ_KB907500.1 ([Pseudomonas] hibiscicola ATCC 19867); NZ_KB907501.1 ([Pseudomonas] hibiscicola ATCC 19867); NZ_KB907504.1 ([Pseudomonas] hibiscicola ATCC 19867); NZ_KB907505.1 ([Pseudomonas] hibiscicola ATCC 19867); NZ_KB907507.1 ([Pseudomonas] hibiscicola ATCC 19867); NZ_KB907508.1 ([Pseudomonas] hibiscicola ATCC 19867); NZ_KB907509.1 ([Pseudomonas] hibiscicola ATCC 19867); NZ_KB907510.1 ([Pseudomonas] hibiscicola ATCC 19867); NZ_KB907511.1 ([Pseudomonas] hibiscicola ATCC 19867)

Compact view

NZ_KB907498.1 - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 357,535 - 368,410 nt. (total: 10,876 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001962.3	0.27	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000188.5	0.24	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001650.4	0.23	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0000452.5	0.21	NRPS	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0000651.5	0.20	terpene	KS-505a	Streptomyces argenteolus
BGC0001283.3	0.18	PKS	Bisenarsan	Streptomyces lividans 1326

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001962.3	0.27	PKS	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0000188.5	0.24	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0001650.4	0.23	NRPS	Le-pyrrolopyrazines	Lysobacter enzymogenes
BGC0000452.5	0.21	NRPS	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0000651.5	0.20	terpene	KS-505a	Streptomyces argenteolus
BGC0001283.3	0.18	PKS	Bisenarsan	Streptomyces lividans 1326

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.64 out of 26.85

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.19 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.64 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (3):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.37 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB907498.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 686,982 - 697,827 nt. (total: 10,846 nt) Show pHMM detection rules used

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0001484.3	0.33	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0002000.4	0.32	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000527.5	0.31	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002571.2	0.31	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000453.5	0.31	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0000536.3	0.31	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.31	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000537.3	0.31	ribosomal	nisin U	Streptococcus uberis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0001484.3	0.33	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0002000.4	0.32	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000527.5	0.31	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002571.2	0.31	NRPS	pyoverdine DC3000	Pseudomonas syringae pv. tomato str. DC3000
BGC0001789.3	0.31	ribosomal	suicin 90-1330	Streptococcus suis
BGC0000453.5	0.31	NRPS	valinomycin	Streptomyces tsusimaensis
BGC0000536.3	0.31	ribosomal	nisin Q	Lactococcus lactis
BGC0000535.4	0.31	ribosomal	nisin A	Lactococcus lactis subsp. lactis
BGC0000537.3	0.31	ribosomal	nisin U	Streptococcus uberis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.48 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (1):

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.64 out of 32.93

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism

NZ_KB907499.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 409,210 - 457,577 nt. (total: 48,368 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

G370_RS0106835: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

G370_RS0106875: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

G370_RS0106895: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

G370_RS0106950: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: hydrolase

G370_RS0106850: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

G370_RS0106860: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

G370_RS0106840: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

G370_RS0106855: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002689.2	1.32	NRPS	2,3-dihydroxybenzoylserine	Stenotrophomonas maltophilia K279a
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000343.5	0.63	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002689.2	0.87	NRPS	2,3-dihydroxybenzoylserine	Stenotrophomonas maltophilia K279a
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.66	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000343.5	0.65	NRPS	enterobactin	Pseudomonas sp. J465
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.56 out of 23.79

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.12 out of 23.79

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.67 out of 20.01

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

Additional weak hits (25):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.75 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.44 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.65 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.56 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.81 out of 26.06

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.98 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.08 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.16 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.59 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 26.18 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 23.91 out of 30.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.58 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.91 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 17.56 out of 28.14

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 29.70 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.14 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.56 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.01 out of 20.97

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.05 out of 26.85

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.26 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.57 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.87 out of 24.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.36 out of 20.01

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.73 out of 24.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 409209 - 457577:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

G370_RS0106840: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (457..845): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFFTSGEHNLYGPTEAAVDVSY
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

G370_RS0106855: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (39..444): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SASLFPMSSPGGGLQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PMPAQGVVNK (94% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
ArgR	Regulator of arginine biosynthesis genes
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_KB907502.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 6,666 - 29,563 nt. (total: 22,898 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

G370_RS0114175: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.52	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002346.3	0.47	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.46	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001579.4	0.46	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001576.3	0.43	ribosomal	divamide A	Prochloron didemni
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002316.2	0.41	ribosomal	cebulantin	Saccharopolyspora cebuensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.52	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0002703.2	0.49	ribosomal	archalan α	Halorussus salinus
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002346.3	0.47	ribosomal	kyamicin	Saccharopolyspora sp.
BGC0000503.5	0.46	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001579.4	0.46	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0001576.3	0.43	ribosomal	divamide A	Prochloron didemni
BGC0000500.5	0.41	ribosomal	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0002316.2	0.41	ribosomal	cebulantin	Saccharopolyspora cebuensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for G370_RS0114175

G370_RS0114170

Leader:

MDLNDDVVSGWLNGSDDVDGCANPAGSLFIYGAAATEAALTGASDTMITGG

Core:

TNECTTTVSVINHCLCC

Core with dehydrations:

DhbNECysDhbDhbDhbVDhaVINHCysLCysCys

antiSMASH-DB 4.0 matches for G370_RS0114170

100.0%

NZ_CP011305.1and 19 others:

NZ_CP031058.1 Lanthipeptides: DUW70_RS15590_lanthipeptideNZ_CP031167.1 Lanthipeptides: MG068_RS07815_lanthipeptideNZ_CP040436.1 Lanthipeptides: FEO91_RS08085_lanthipeptideNZ_CP046588.1 Lanthipeptides: GOC52_RS08100_lanthipeptideNZ_CP060259.1 Lanthipeptides: H7F32_RS08235_lanthipeptideNZ_CP071784.1 Lanthipeptides: J3U96_RS13765_lanthipeptideNZ_CP077679.1 Lanthipeptides: KS456_RS07940_lanthipeptideNZ_CP096975.1 Lanthipeptides: M1L61_RS08375_lanthipeptideNZ_CP104071.1 Lanthipeptides: K7565_RS07800_lanthipeptideNZ_CP104287.1 Lanthipeptides: K7567_RS07875_lanthipeptideNZ_CP104324.1 Lanthipeptides: K7569_RS08320_lanthipeptideNZ_JACLBK010000002.1 Lanthipeptides: ID844_RS05155_lanthipeptideNZ_JAEDVP010000027.1 Lanthipeptides: JAK38_RS15550_lanthipeptideNZ_JAEDVW010000007.1 Lanthipeptides: JAK53_RS03160_lanthipeptideNZ_JAEDWD010000009.1 Lanthipeptides: JAK45_RS02000_lanthipeptideNZ_JAFLWT010000006.1 Lanthipeptides: J1F00_RS06425_lanthipeptideNZ_JAQQGI010000014.1 Lanthipeptides: PQS91_RS16925_lanthipeptideNZ_KB907502.1 Lanthipeptides: G370_RS0114170_lanthipeptideNZ_RHPZ01000014.1 Lanthipeptides: EGJ03_RS16365_lanthipeptide

Lanthipeptides: YH67_RS07965_lanthipeptide

TNECTTTVSVINHCLCC

24.1%

NZ_CP089924.1:

Lanthipeptides: LVB77_RS02735_lanthipeptide

CTTTVSVINHC

CT+ SV NHC

CTSGSSVSNHC

22.9%

NZ_CP011010.1and 27 others:

NZ_CP015612.1 Lanthipeptides: A7326_RS08120_lanthipeptideNZ_CP027562.1 Lanthipeptides: C6Y55_RS08375_lanthipeptideNZ_CP028358.1 Lanthipeptides: C9J74_RS08630_lanthipeptideNZ_CP040435.1 Lanthipeptides: FEO92_RS08800_lanthipeptideNZ_CP040438.1 Lanthipeptides: FEO89_RS08350_lanthipeptideNZ_CP040439.1 Lanthipeptides: FEO88_RS08780_lanthipeptideNZ_CP043578.1 Lanthipeptides: F0Q13_RS08255_lanthipeptideNZ_CP047310.1 Lanthipeptides: GS396_RS07720_lanthipeptideNZ_CP056088.1 Lanthipeptides: HUZ96_RS08220_lanthipeptideNZ_CP067993.1 Lanthipeptides: JJL50_RS07700_lanthipeptideNZ_CP090418.1 Lanthipeptides: LYZ64_RS08310_lanthipeptideNZ_CP104169.1 Lanthipeptides: NDR96_RS06465_lanthipeptideNZ_CP109812.1 Lanthipeptides: FQS62_RS08595_lanthipeptideNZ_DS999412.1 Lanthipeptides: SSKA14_RS15505_lanthipeptideNZ_JABDRV010000001.1 Lanthipeptides: HRL60_RS01085_lanthipeptideNZ_JAEDUZ010000008.1 Lanthipeptides: JAK52_RS03215_lanthipeptideNZ_JAEDVS010000025.1 Lanthipeptides: JAK50_RS15965_lanthipeptideNZ_JAEDWK010000010.1 Lanthipeptides: JAK51_RS04155_lanthipeptideNZ_JAJNMF010000022.1 Lanthipeptides: LQ423_RS11465_lanthipeptideNZ_JVHP01000063.1 Lanthipeptides: ADI44_RS21105_lanthipeptideNZ_JVPM01000038.1 Lanthipeptides: ADH50_RS19075_lanthipeptideNZ_JVUI01000059.1 Lanthipeptides: ADG58_RS15825_lanthipeptideNZ_LR134301.1 Lanthipeptides: EL200_RS07985_lanthipeptideNZ_OBEE01000002.1 Lanthipeptides: CRO53_RS02030_lanthipeptideNZ_OU943334.1 Lanthipeptides: LNN95_RS09005_lanthipeptideNZ_RHQE01000015.1 Lanthipeptides: EGJ89_RS13150_lanthipeptideNZ_SOCO01000001.1 Lanthipeptides: N440_RS05690_lanthipeptide

Lanthipeptides: VN11_RS08230_lanthipeptide

VSVINHCLCC

+SV+NHCLCC

MSVVNHCLCC

with 1 more sequence matches

13.8%

NZ_CP007597.1:

Lanthipeptides: DX03_RS09815_lanthipeptide

VSVINHCLCC

+SVINHC+CC

MSVINHCMCC

allorf_016175_016288

Leader:

MPMQRIRVPAAAQLDYA

Core:

WRANAVCMGGCTCHPVSLAA

Core with dehydrations:

WRANAVCysMGGCysDhbCysHPVDhaLAA

antiSMASH-DB 4.0 matches for allorf_016175_016288

100.0%

NZ_CP040436.1and 8 others:

NZ_CP071784.1 Lanthipeptides: allorf_3040363_3040476_lanthipeptideNZ_CP104071.1 Lanthipeptides: allorf_1671217_1671393_lanthipeptideNZ_CP104287.1 Lanthipeptides: allorf_1684276_1684389_lanthipeptideNZ_CP104324.1 Lanthipeptides: allorf_1768103_1768216_lanthipeptideNZ_JACLBK010000002.1 Lanthipeptides: allorf_262851_262964_lanthipeptideNZ_JAEDWD010000009.1 Lanthipeptides: allorf_029791_029967_lanthipeptideNZ_JAFLWT010000006.1 Lanthipeptides: allorf_148855_148968_lanthipeptideNZ_KB907502.1 Lanthipeptides: allorf_016175_016288_lanthipeptide

Lanthipeptides: allorf_1728172_1728348_lanthipeptide

WRANAVCMGGCTCHPVSLAA

69.2%

NZ_CP040438.1and 1 other:

NZ_JVUI01000059.1 Lanthipeptides: allorf_017163_017279_lanthipeptide

Lanthipeptides: allorf_1797077_1797235_lanthipeptide

RANAVCMGGCTCHPVSLAA

RANAVC GGCTCHPVSLAA

RANAVCTGGCTCHPVSLAA

50.0%

NZ_CP040439.1:

Lanthipeptides: allorf_1871764_1871973_lanthipeptide

CTCHPVSLAA

with 9 more sequence matches

45.0%

NZ_CP011010.1and 3 others:

NZ_DS999412.1 Lanthipeptides: allorf_3459447_3459623_lanthipeptideNZ_JAJNMF010000022.1 Lanthipeptides: allorf_02257_02373_lanthipeptideNZ_SOCO01000001.1 Lanthipeptides: allorf_1184819_1184995_lanthipeptide

Lanthipeptides: allorf_1772540_1772716_lanthipeptide

TCHPVSLAA

36.4%

NZ_CP045572.1:

Lanthipeptides: GBF35_RS40730_lanthipeptide

ANAVCMGGCTCHPVSLA

+N VC+ C HP S A

SNCVCITVCATHPWSCA

23.1%

NZ_AUFR01000008.1and 1 other:

NZ_CP033719.1 Lanthipeptides: allorf_1493428_1493565_lanthipeptide

Lanthipeptides: allorf_101055_101192_lanthipeptide

TCHPVSLAA

TC+PVS A+

TCNPVSFAS

17.0%

NZ_KQ948355.1:

Lanthipeptides: allorf_079160_079387_lanthipeptide

WRANAVCM---GGCTCH

WRA+A C+ GG H

WRADAACLHADGGKRQH

15.6%

NC_016047.1and 6 others:

NZ_CP025079.1 Lanthipeptides: BVQ_RS17705_lanthipeptideNZ_CP047644.1 Lanthipeptides: GNE05_RS17275_lanthipeptideNZ_CP099859.1 Lanthipeptides: NIZ95_RS16280_lanthipeptideNZ_CP101621.1 Lanthipeptides: NN913_RS16115_lanthipeptideNZ_KZ848487.1 Lanthipeptides: DSL71_RS15965_lanthipeptideNZ_MUXL01000003.1 Lanthipeptides: B0W20_RS12275_lanthipeptide

Lanthipeptides: GYO_RS39160_lanthipeptide

WRANAVCMGGC

W++ +VC GC

WKSESVCTPGC

15.0%

NZ_RHQE01000015.1:

Lanthipeptides: allorf_086168_086377_lanthipeptide

RANAVCMGGCTCHPVSLAA

RA+ +C G C PVS A

RADRLCRGRCKYVPVSSVA

12.5%

NC_014479.1and 30 others:

NZ_CP021903.1 Lanthipeptides: CD007_RS17065_lanthipeptideNZ_CP023409.1 Lanthipeptides: Bateq7PJ16_RS18530_lanthipeptideNZ_CP026036.1 Lanthipeptides: C2H93_RS15000_lanthipeptideNZ_CP026362.1 Lanthipeptides: BV11031_RS00400_lanthipeptideNZ_CP028218.1 Lanthipeptides: C7M30_RS14555_lanthipeptideNZ_CP033052.1 Lanthipeptides: D9779_RS17315_lanthipeptideNZ_CP035167.1 Lanthipeptides: EQJ08_RS17140_lanthipeptideNZ_CP035226.1 Lanthipeptides: EQW70_RS18175_lanthipeptideNZ_CP045006.1 Lanthipeptides: F9B13_RS03875_lanthipeptideNZ_CP051464.1 Lanthipeptides: HC660_RS17030_lanthipeptideNZ_CP076083.1 Lanthipeptides: KFF76_RS16710_lanthipeptideNZ_CP079759.1 Lanthipeptides: KXZ66_RS17780_lanthipeptideNZ_CP080508.1 Lanthipeptides: K0V03_RS06525_lanthipeptideNZ_CP089148.1 Lanthipeptides: LRO88_RS19055_lanthipeptideNZ_JALAKK010000002.1 Lanthipeptides: MOB09_RS02800_lanthipeptideNZ_JALAKO010000014.1 Lanthipeptides: MOB26_RS08535_lanthipeptideNZ_JALAOG010000003.1 Lanthipeptides: MOC96_RS02500_lanthipeptideNZ_JALAPG010000043.1 Lanthipeptides: MOC70_RS16815_lanthipeptideNZ_JALAQI010000009.1 Lanthipeptides: MOD13_RS06065_lanthipeptideNZ_JALAUA010000003.1 Lanthipeptides: MOD32_RS04985_lanthipeptideNZ_JALAVX010000009.1 Lanthipeptides: MOE40_RS09385_lanthipeptideNZ_JAMYDW010000007.1 Lanthipeptides: NHM07_RS16180_lanthipeptideNZ_JAQOXM010000001.1 Lanthipeptides: PO770_RS03875_lanthipeptideNZ_NJRD01000003.1 Lanthipeptides: CE053_RS07200_lanthipeptideNZ_NJRE01000008.1 Lanthipeptides: CE047_RS18435_lanthipeptideNZ_NXEM01000027.1 Lanthipeptides: CPT06_RS15285_lanthipeptideNZ_SORJ01000001.1 Lanthipeptides: BJ795_RS01490_lanthipeptideNZ_VFNF01000001.1 Lanthipeptides: FB592_RS01525_lanthipeptideNZ_VIOH01000001.1 Lanthipeptides: FLN47_RS03850_lanthipeptideNZ_VLJL01000012.1 Lanthipeptides: L604_RS09425_lanthipeptide

Lanthipeptides: BSUW23_RS16845_lanthipeptide

WRANAVCMGGC

W++ ++C GC

WKSESLCTPGC

12.5%

NZ_AUAQ01000012.1:

Lanthipeptides: G393_RS16160_lanthipeptide

WRANAVCMGGC

W++ ++C GC

WKSKSLCTPGC

12.2%

NZ_JACHJQ010000008.1:

Lanthipeptides: allorf_200802_200999_lanthipeptide

GCTCHPVSL

G CHPV L

GSACHPVDL

MIBiG 4.0 matches for allorf_016175_016288

30.0%

BGC0001155.5 (AGY49587.1):

Thiopeptide: GE2270

NAVCMGGCTCHP

N VC C+C P

NCVCGFCCSCSP

8.8%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

AVCMGGC

++C GC

SLCTPGC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 27.95 out of 32.74

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (5):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.79 out of 20.01

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.90 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.79 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.18 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.00 out of 24.78

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

G370_RS0114170 - Class II

Cleavage pHMM score: -4.40

RODEO score: 0

Monoisotopic mass: 1749.8 Da

Molecular weight: 1751.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1769.0 Da N = 1

allorf_016175_016288 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 2009.9 Da

Molecular weight: 2011.4 Da

Number of bridges: 2

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
FuR variant 2	Ferric Uptake Regulator

NZ_KB907503.1 - Region 1 - arylpolyene

Download region GenBank file

Download region SVG

Location: 256,008 - 299,610 nt. (total: 43,603 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase reductase

G370_RS0117125: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

G370_RS0117140: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

G370_RS0117195: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase halogenase

G370_RS0117215: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

G370_RS0117270: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: hydrolase

G370_RS0117145: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

G370_RS0117190: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G370_RS0117205: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

G370_RS0117245: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

G370_RS0117250: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0000836.5	0.64	other (other)	APE Ec	Escherichia coli CFT073
BGC0002008.3	0.62	other (other)	aryl polyenes	Xenorhabdus doucetiae
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001723.5	0.49	PKS	oviedomycin	Streptomyces antibioticus
BGC0000837.4	0.49	other (other)	APE Vf	Aliivibrio fischeri ES114
BGC0002000.4	0.48	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002510.2	0.48	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001197.5	0.48	PKS	frankiamicin	Frankia sp. EAN1pec

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.75	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0002608.2	0.75	NRPS, PKS	ochratoxin A	Aspergillus steynii
BGC0000836.5	0.64	other (other)	APE Ec	Escherichia coli CFT073
BGC0002008.3	0.62	other (other)	aryl polyenes	Xenorhabdus doucetiae
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001723.5	0.49	PKS	oviedomycin	Streptomyces antibioticus
BGC0000837.4	0.49	other (other)	APE Vf	Aliivibrio fischeri ES114
BGC0002000.4	0.48	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002510.2	0.48	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0001197.5	0.48	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

Additional weak hits (8):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.18 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.50 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.07 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.01 out of 26.06

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.35 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.21 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.57 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

G370_RS0117250: X

AMP-binding (51..302): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: THQ-----LFRWVAFSSGGTEVYGSSETGGIAWR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB907506.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 12,794 nt. (total: 12,794 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

G370_RS0119575: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000640.3	0.32	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000630.3	0.31	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0002219.2	0.31	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000641.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000638.3	0.29	terpene	carotenoid	Pantoea ananatis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.47	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.44	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000640.3	0.32	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000630.3	0.31	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0002219.2	0.31	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0000641.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000638.3	0.29	terpene	carotenoid	Pantoea ananatis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

G370_RS0119575: PT_FPPS_like

Domain 1 (32 - 292): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial

Reactions:: IPP, DMAPP → FPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.72 out of 26.06

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.56 out of 29.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.00 out of 30.98

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description