GCF_000381025.1 - 27 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_KB905813.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	NI-siderophore	1	18,535	High	legonoxamine A/desferrioxamine B/legonoxamine B	other:other
Region 1.2	T2PKS	169,535	242,035	Low	WS 79089B/benaphthamycin/WS 79089D/WS 79089A/WS 79089C	PKS
Region 1.3	T3PKS,RiPP-like	569,454	610,569	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 1.4	T2PKS	875,755	939,081	Low	julichrome Q3-3/julichrome Q3-5	PKS

NZ_KB905814.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	lipolanthine,lanthipeptide-class-iii	61,388	93,709
Region 2.2	linaridin	122,267	142,818
Region 2.3	lassopeptide	267,516	289,018	Medium	ulleungdin	ribosomal:unmodified
Region 2.4	NRPS,T1PKS	455,124	529,144

NZ_KB905815.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 3.1	ectoine	53,961	64,365	High	ectoine	other:ectoine
Region 3.2	terpene-precursor	487,959	509,026

NZ_KB905816.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	T1PKS	89,785	168,918	Low	phoslactomycin B	PKS
Region 4.2	lanthipeptide-class-i	527,115	574,350
Region 4.3	terpene	584,547	611,217	Medium	hopene	terpene

NZ_KB905817.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	T1PKS,transAT-PKS-like,NRPS	207,021	301,164	Low	kirromycin	NRPS:Type I+PKS:Type I

NZ_KB905818.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 6.1	NI-siderophore	44,692	77,255	Low	kinamycin	PKS
Region 6.2	T1PKS	330,686	378,047	Low	actinoallolide A	PKS

NZ_KB905819.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	lanthipeptide-class-i	10,722	35,292	High	planosporicin	ribosomal:RiPP:Lanthipeptide
Region 7.2	azole-containing-RiPP	51,102	83,722
Region 7.3	NRPS	207,993	258,573	Low	TVA-YJ-2	ribosomal:RiPP

NZ_KB905821.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	t3nrps-iterative,PKS-like,T3PKS	95,802	150,458	Low	rubiginone A2/rubiginone J/rubiginone K/rubiginone L/rubiginone M/rubiginone N/ochromycinone/rubiginone B2	PKS
Region 9.2	T1PKS	306,804	349,537	Low	armeniaspirol A/armeniaspirol B/armeniaspirol C	PKS

NZ_KB905822.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	NRP-metallophore,NRPS	223,882	266,554	Medium	coelibactin	NRPS:Type I

NZ_KB905823.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	T1PKS,NRPS	101,016	173,007	Low	microtermolide A	NRPS:Type I+PKS

NZ_KB905828.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	T2PKS	1	56,627	High	resistomycin/resistoflavine	PKS:Type II

NZ_KB905830.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 18.1	RRE-containing	62,565	72,882	Low	bottromycin A2	ribosomal:RiPP:Bottromycin

NZ_KB905831.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 19.1	NRP-metallophore,NRPS	1	47,640	Medium	bacillibactin	NRPS:Type I

NZ_KB905836.1 (Streptomyces sulphureus DSM 40104)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	RiPP-like,bottromycin	1	9,160	High	bottromycin D	ribosomal:RiPP:Bottromycin

No secondary metabolite regions were found in these records:: NZ_KB905820.1 (Streptomyces sulphureus DSM 40104); NZ_KB905824.1 (Streptomyces sulphureus DSM 40104); NZ_KB905825.1 (Streptomyces sulphureus DSM 40104); NZ_KB905826.1 (Streptomyces sulphureus DSM 40104); NZ_KB905827.1 (Streptomyces sulphureus DSM 40104); NZ_KB905829.1 (Streptomyces sulphureus DSM 40104); NZ_KB905832.1 (Streptomyces sulphureus DSM 40104); NZ_KB905833.1 (Streptomyces sulphureus DSM 40104); NZ_KB905834.1 (Streptomyces sulphureus DSM 40104); NZ_KB905835.1 (Streptomyces sulphureus DSM 40104); NZ_KB905837.1 (Streptomyces sulphureus DSM 40104); NZ_KB905838.1 (Streptomyces sulphureus DSM 40104)

Compact view

NZ_KB905813.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 1 - 18,535 nt. (total: 18,535 nt) Show pHMM detection rules used

Region on contig edge.

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

F603_RS0100030: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Lyases: decarboxylase

F603_RS0100035: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.79	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.72	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.64	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.64	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002620.2	0.57	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002464.3	0.57	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0001531.5	0.54	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002690.2	0.51	other (other)	FW0622	Verrucosispora sp. FIM060022

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.3	0.79	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002305.2	0.72	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0001572.3	0.67	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000940.5	0.64	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.64	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0002620.2	0.57	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002464.3	0.57	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0001531.5	0.54	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0002690.2	0.51	other (other)	FW0622	Verrucosispora sp. FIM060022

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.73 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

Additional weak hits (5):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.85 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.56 out of 36.53

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.38 out of 25.88

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905813.1 - Region 2 - T2PKS

Download region GenBank file

Download region SVG

Location: 169,535 - 242,035 nt. (total: 72,501 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

F603_RS0100790: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

F603_RS0100825: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

F603_RS0100835: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS0100895: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

F603_RS0100920: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS0100930: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

F603_RS0100955: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

F603_RS0100960: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

F603_RS0101010: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS0101025: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: methyltransferase

F603_RS0100910: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: deacetylase

F603_RS0100750: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Lyases: cyclase hydratase

F603_RS0100855: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

F603_RS0100870: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

F603_RS0101035: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Isomerases: mutase

F603_RS0100975: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase

F603_RS0100810: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

F603_RS0100880: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F603_RS0100885: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.64	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.63	PKS	spore pigment	Streptomyces collinus
BGC0001723.5	0.61	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000271.5	0.58	PKS	spore pigment	Streptomyces avermitilis
BGC0000204.5	0.58	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001197.5	0.58	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000235.5	0.57	PKS	kiamycin	Streptomyces sp. W007
BGC0001366.5	0.56	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.64	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000272.3	0.63	PKS	spore pigment	Streptomyces collinus
BGC0001723.5	0.61	PKS	oviedomycin	Streptomyces antibioticus
BGC0000234.5	0.59	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000271.5	0.58	PKS	spore pigment	Streptomyces avermitilis
BGC0000204.5	0.58	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0001197.5	0.58	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001513.3	0.57	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000235.5	0.57	PKS	kiamycin	Streptomyces sp. W007
BGC0001366.5	0.56	PKS	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 24.07 out of 30.11

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (17):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.03 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.80 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.54 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.39 out of 36.54

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.37 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.61 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.37 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.68 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.10 out of 30.11

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.62 out of 20.01

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.76 out of 36.54

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.16 out of 36.53

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 169534 to 242035
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

F603_RS0100835: KR (Score: 179.6; E-value: 2.1e-55)
F603_RS0100855: CYC C4-C21/C2-C23|C2-C19 (Score: 134.9; E-value: 2.2e-42)
F603_RS0100865: ACP (Score: 34.5; E-value: 3.6e-11)
F603_RS0100870: CYC C9-C14 (Score: 241.3; E-value: 7.4e-75)
F603_RS0100875: CYC C5-C18 (Score: 190.6; E-value: 2.1e-59)
F603_RS0100880: KS (Score: 708.5; E-value: 5.8e-216)
F603_RS0100885: CLF (Score: 463.3; E-value: 1.5e-141)
F603_RS0100910: MET (Score: 221.3; E-value: 4.2e-68)
F603_RS0100920: KR (Score: 169.0; E-value: 3.6e-52)
F603_RS0100955: KR (Score: 62.8; E-value: 9.2e-20)
F603_RS0101010: KR (Score: 133.0; E-value: 3.4e-41)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905813.1 - Region 3 - RiPP-like,T3PKS

Download region GenBank file

Download region SVG

Location: 569,454 - 610,569 nt. (total: 41,116 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

F603_RS0102595: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS0102680: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

F603_RS0102690: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acetyltransferase kinase methyltransferase

F603_RS0102645: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

F603_RS0102675: Methylation

MITE: MITE0000155Methylation (identity: 64.10%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

F603_RS0102685: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

F603_RS0102715: methyltransferase

smcogs: SMCOG1089: methyltransferase

F603_RS0102770: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

Hydrolases: hydrolase

F603_RS0102635: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthase

F603_RS0102565: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

F603_RS0102660: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

F603_RS0102670: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.46	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002584.2	0.29	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0001294.5	0.24	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000582.4	0.21	ribosomal	cypemycin	Streptomyces sp. OH-4156
BGC0001513.3	0.21	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0001831.3	0.21	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001647.3	0.21	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0000632.5	0.20	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0000821.5	0.19	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0001985.4	0.19	other (other)	Pyrazofurin	Streptomyces candidus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.76	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.54	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001077.4	0.50	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002362.3	0.46	PKS	loseolamycin A1, loseolamycin A2	Micromonospora endolithica
BGC0002584.2	0.45	ribosomal	azolemycin B, azolemycin A, azolemycin D, azolemycin C	Streptomyces sp. FXJ1.264
BGC0000131.5	0.45	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0002381.3	0.45	PKS, other (other)	tambjamine BE-18591	Streptomyces albus subsp. albus
BGC0000272.3	0.44	PKS	spore pigment	Streptomyces collinus
BGC0000231.5	0.44	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000706.3	0.44	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.39 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (11):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.98 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.44 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.89 out of 25.88

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.07 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.15 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.03 out of 24.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.89 out of 25.88

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.95 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905813.1 - Region 4 - T2PKS

Download region GenBank file

Download region SVG

Location: 875,755 - 939,081 nt. (total: 63,327 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

F603_RS0104070: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

F603_RS0104165: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS0104195: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F603_RS0104265: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS0104275: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

F603_RS0104310: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

F603_RS0104280: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase dehydratase

F603_RS0104025: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

F603_RS0104160: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

F603_RS36360: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

Ligases: synthase

F603_RS0104175: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F603_RS0104180: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.82	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.74	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.70	PKS	oviedomycin	Streptomyces antibioticus
BGC0002000.4	0.67	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002514.3	0.61	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0001904.2	0.59	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria
BGC0002012.4	0.59	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0000253.4	0.58	PKS	oviedomycin	Streptomyces antibioticus
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0002712.2	0.58	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.82	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.74	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.70	PKS	oviedomycin	Streptomyces antibioticus
BGC0002000.4	0.67	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002514.3	0.61	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0001904.2	0.59	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria
BGC0002012.4	0.59	PKS	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0000253.4	0.58	PKS	oviedomycin	Streptomyces antibioticus
BGC0000275.4	0.58	PKS	tetracenomycin C	Streptomyces glaucescens
BGC0002712.2	0.58	PKS	WS-5995 D, WS-5995 B, WS-5995 C, SEK 43	Streptomyces yanglinensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.31 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.17 out of 24.78

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

Additional weak hits (21):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.61 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.57 out of 30.11

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.07 out of 30.11

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.74 out of 23.43

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.18 out of 25.75

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.45 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.18 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.16 out of 36.54

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.71 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.76 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.48 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.15 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.16 out of 29.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.66 out of 25.75

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.92 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.35 out of 30.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.35 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 875754 to 939081
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 667.6; E-value: 1.2e-203)
Product class(es):: angucycline
Product molecular weight(s):: acetyl-CoA_8: 337 Da
acetyl-CoA_9: 379 Da

F603_RS0104160: CYC C7-C12 (Score: 445.9; E-value: 1.4e-136)
F603_RS0104165: KR C9 (Score: 467.7; E-value: 2.2e-143)
F603_RS0104170: ACP (Score: 112.3; E-value: 1.9e-35)
F603_RS0104175: CLF 8|9 (Score: 667.6; E-value: 1.2e-203)
F603_RS0104180: KS (Score: 765.6; E-value: 2.8e-233)
F603_RS0104265: KR (Score: 200.0; E-value: 1.3e-61)
F603_RS0104310: KR (Score: 177.3; E-value: 1.1e-54)
F603_RS36360: CYC C4-C17/C2-C19 (Score: 149.0; E-value: 3.2e-46)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905814.1 - Region 1 - lanthipeptide-class-iii,lipolanthine

Download region GenBank file

Download region SVG

Location: 61,388 - 93,709 nt. (total: 32,322 nt) Show pHMM detection rules used

lipolanthine: (micKC and Flavoprotein)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F603_RS0104615: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase

F603_RS0104560: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: hydrolase

F603_RS0104565: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000519.4	0.43	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000551.5	0.41	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.39	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.38	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.3	0.37	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002111.3	0.34	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000546.3	0.31	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0000527.5	0.30	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000519.4	0.54	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000551.5	0.53	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000501.3	0.52	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.5	0.52	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.51	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.3	0.50	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0002111.3	0.48	ribosomal	andalusicin A, andalusicin B	Bacillus thuringiensis serovar andalousiensis NRRL B-23139
BGC0000546.3	0.46	ribosomal	SAL-2242	Streptomyces albidoflavus
BGC0001787.3	0.45	ribosomal	suicin 3908	Streptococcus suis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for F603_RS31580

F603_RS34610

Leader:

MTDFILDLQGMSSEDVE

Core:

VGEQLASSYTTVLCGHSWTSITC

Core with dehydrations:

VGEQLADhaDhaYDhbDhbVLCysGHDhaWDhbDhaIDhbCys

antiSMASH-DB 4.0 matches for F603_RS34610

100.0%

NZ_KB905814.1:

Lanthipeptides: F603_RS34610_lanthipeptide

1

VGEQLASSYTTVLCGHSWTSITC

23

VGEQLASSYTTVLCGHSWTSITC

1

VGEQLASSYTTVLCGHSWTSITC

23

47.8%

NZ_CP019724.1:

Lanthipeptides: allorf_2155301_2155474_lanthipeptide

3

EQLASSYTTVLCGHSWTSITC

23

+ LASS+T+V C SW S +C

3

DVLASSWTSVCCKCSWVSTSC

23

47.8%

NZ_LZRD01000005.1and 1 other:

NZ_LZRD01000005.1 Lanthipeptides: allorf_317314_317487_lanthipeptide

Lanthipeptides: allorf_317314_317487_lanthipeptide

3

EQLASSYTTVLCGHSWTSITC

23

+ LASS+T+V C SW S +C

3

DVLASSWTSVCCKCSWISTSC

23

with 5 more sequence matches

36.0%

NZ_CP034350.1:

Lanthipeptides: D1J60_RS32970_lanthipeptide

1

VGEQLASSYTTVLCGHSWTSIT

22

+G S + +LCG S SIT

1

LGGGGGSRASLLLCGDSSLSIT

22

34.8%

NZ_RBWU01000007.1:

Lanthipeptides: BZB76_RS30440_lanthipeptide

11

TVLCGHSWTSIT

22

+VLCGHS S T

3

SVLCGHSSNSQT

14

33.3%

NZ_BMVE01000003.1and 12 others:

NZ_BMVL01000005.1 Lanthipeptides: IE257_RS16230_lanthipeptideNZ_CP011664.1 Lanthipeptides: M444_RS30240_lanthipeptideNZ_CP020039.1 Lanthipeptides: B4U39_RS34445_lanthipeptideNZ_CP020555.1 Lanthipeptides: B6R96_RS03515_lanthipeptideNZ_CP029189.1 Lanthipeptides: DEJ51_RS31910_lanthipeptideNZ_CP033581.1 Lanthipeptides: EES41_RS31595_lanthipeptideNZ_CP115936.1 Lanthipeptides: PET44_RS28650_lanthipeptideNZ_JAFLQY010000003.1 Lanthipeptides: J0X20_RS29030_lanthipeptideNZ_LIVP01000027.1 Lanthipeptides: AMK15_RS28680_lanthipeptideNZ_LWLD01000038.1 Lanthipeptides: A6A28_RS28600_lanthipeptideNZ_ML123038.1 Lanthipeptides: EES37_RS30340_lanthipeptideNZ_NNBM01000002.1 Lanthipeptides: CG724_RS07855_lanthipeptide

Lanthipeptides: IE248_RS10435_lanthipeptide

6

ASSYTTVLCGHSWTSIT

22

S + +LCG S SIT

5

GSRASLLLCGDSSLSIT

21

23.1%

NZ_KB467824.1:

Lanthipeptides: allorf_1564502_1564696_lanthipeptide

1

VGEQLASSYTTVLCGHSWTSITC

23

G Q S++ V CG T+I C

1

AGGQAQVSHSWVACGQCPTNIPC

23

19.4%

NZ_CP076356.1:

Lanthipeptides: allorf_0465169_0465315_lanthipeptide

1

VGEQLASSYTTVLC

14

VGE+LA ++ LC

3

VGEKLAFKRSSELC

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

Additional weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.09 out of 30.98

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

F603_RS34610 - Class III

Cleavage pHMM score: 3.00

RODEO score: 0

Monoisotopic mass: 2252.1 Da

Molecular weight: 2253.5 Da

Number of bridges: 1

Additional modifications: AviCys

Alternative weights: (assuming N unmodified Ser/Thr residues); 2271.6 Da N = 1; 2289.6 Da N = 2; 2307.6 Da N = 3; 2325.6 Da N = 4; 2343.6 Da N = 5; 2361.7 Da N = 6

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905814.1 - Region 2 - linaridin

Download region GenBank file

Download region SVG

Location: 122,267 - 142,818 nt. (total: 20,552 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F603_RS0104835: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

F603_RS0104850: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: methyltransferase

F603_RS0104860: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: dehalogenase hydrolase

F603_RS0104855: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

F603_RS0104870: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000495.5	0.44	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000503.5	0.42	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001374.5	0.42	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000817.4	0.42	other (other)	methylarcyriarubin	uncultured bacterium
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000874.5	0.38	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000706.3	0.38	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001336.5	0.38	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001277.4	0.38	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000495.5	0.44	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0000503.5	0.42	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001374.5	0.42	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000817.4	0.42	other (other)	methylarcyriarubin	uncultured bacterium
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001483.4	0.40	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000874.5	0.38	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0000706.3	0.38	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001336.5	0.38	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001277.4	0.38	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.72 out of 27.04

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.19 out of 23.79

Confidence: medium

Additional weak hits (3):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.54 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.41 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 24.17 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
IolR	Regulator of the inositol catabolism

NZ_KB905814.1 - Region 3 - lassopeptide

Download region GenBank file

Download region SVG

Location: 267,516 - 289,018 nt. (total: 21,503 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.74	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.70	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.69	ribosomal	anantin C	Streptomyces olindensis
BGC0001645.3	0.65	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001307.3	0.64	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001539.4	0.64	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001493.5	0.63	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001551.4	0.60	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0002318.2	0.60	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001889.2	0.60	ribosomal	fusilassin	Thermobifida fusca YX

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002053.3	0.74	ribosomal	ulleungdin	Streptomyces sp.
BGC0002074.2	0.70	ribosomal	huascopeptin	Streptomyces huasconensis
BGC0001507.3	0.69	ribosomal	anantin C	Streptomyces olindensis
BGC0001645.3	0.65	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001307.3	0.64	ribosomal	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001539.4	0.64	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001493.5	0.63	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001551.4	0.60	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0002318.2	0.60	ribosomal	canucin A, canucin B	Streptomyces canus
BGC0001889.2	0.60	ribosomal	fusilassin	Thermobifida fusca YX

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.57 out of 20.97

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.38 out of 29.72

Confidence: medium

Additional weak hits (8):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.44 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.41 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.08 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 19 - 93; Score: 81.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
NtrC	Nitrogen regulatory protein C

NZ_KB905814.1 - Region 4 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 455,124 - 529,144 nt. (total: 74,021 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

F603_RS0106470: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

F603_RS31685: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acyltransferase glycosyltransferase methyltransferase

F603_RS0106260: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

F603_RS0106340: methyltransferase

smcogs: SMCOG1089: methyltransferase

F603_RS0106345: methyltransferase

smcogs: SMCOG1248: methyltransferase

F603_RS0106375: methyltransferase

smcogs: SMCOG1089: methyltransferase

F603_RS0106430: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

Hydrolases: dehalogenase esterase hydrolase

F603_RS0106270: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

F603_RS0106305: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

F603_RS0106365: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

F603_RS0106405: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

F603_RS0106485: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

F603_RS0106335: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F603_RS0106400: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F603_RS0106410: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS0106415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS0106450: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F603_RS0106475: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F603_RS31675: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS33370: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F603_RS33375: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.84	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.79	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.77	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.76	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.75	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.74	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.71	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002164.2	0.70	NRPS	peramine	Epichloe festucae
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.68 out of 19.52

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 26.47 out of 30.22

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.17 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.19 out of 19.26

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.72 out of 27.18

Confidence: medium

Additional weak hits (28):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.31 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.28 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.69 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.71 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.12 out of 27.78

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.42 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.02 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.97 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.44 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.98 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.10 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.62 out of 25.88

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.33 out of 39.62

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.99 out of 35.63

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.37 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.09 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.35 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.82 out of 36.53

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.19 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.44 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.97 out of 24.78

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.06 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.83 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.23 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 455123 - 529144:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-mal) + (Orn) + (mal) + (Cys - Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

F603_RS33370: X - fatty_acid

AMP-binding (474..808): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SWLTLAASVHAWLLLTDGGHWLWALPEAGGFTAA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

CAL_domain (1038..1455): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 23.8
NH2: 22.4
Acetyl-CoA: 9.9
shikimic_acid: 0.0
AHBA: 0.0

F603_RS33375: mal

PKS_AT (544..822): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.4
Methoxymalonyl-CoA: 52.7
inactive: 46.5
Methylmalonyl-CoA: 40.3
Propionyl-CoA: 29.5
Ethylmalonyl-CoA: 19.4
2-Methylbutyryl-CoA: 11.8
fatty_acid: 7.6
Isobutyryl-CoA: 6.7
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

F603_RS31675: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (511..907): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISVNELYIWCGGEYHGYGPAEATIGVSC
Nearest Stachelhaus code(s):: Orn DINYWGGIGK (94% 8Å match); Fo-OH-Orn DINYWGGIGK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

F603_RS0106400: mal

PKS_AT (535..816): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 140.2
Methoxymalonyl-CoA: 63.7
inactive: 63.4
Methylmalonyl-CoA: 41.5
Propionyl-CoA: 33.9
fatty_acid: 21.4
Ethylmalonyl-CoA: 17.9
2-Methylbutyryl-CoA: 17.4
Isobutyryl-CoA: 15.8
CHC-CoA: 15.8
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

F603_RS0106410: Cys - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (191..592): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSLWDGMGILGGDVGLGGNTEASILSCT
Nearest Stachelhaus code(s):: Leu DLLHLGLILK (35% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1254..1650): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: AETTHDMSVFDGNSFLGGDVSVGGPTETTLWNIW
Nearest Stachelhaus code(s):: Cys DMFNFGVLWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

F603_RS0106415: Ala

Search NORINE for peptide: strict or relaxed

AMP-binding (14..403): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: FWVSFDLSVFEGNTNLAGEHNLYGPSEDTTYSTW
Nearest Stachelhaus code(s):: Ala DLFNNALTYK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
ClgR	Caseinolytic protease gene regulator
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905815.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 53,961 - 64,365 nt. (total: 10,405 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F603_RS0108360: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase

F603_RS0108345: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.86	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002052.3	0.86	other (ectoine)	ectoine	Streptomyces sp.
BGC0000853.3	0.85	other (other)	ectoine	Streptomyces anulatus
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.57 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.30 out of 31.73

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.25 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_KB905815.1 - Region 2 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 487,959 - 509,026 nt. (total: 21,068 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: peptidase

F603_RS0110225: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Ligases: synthetase

F603_RS0110255: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002436.2	0.42	other (other)	coformycin	Streptomyces citricolor
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000502.5	0.39	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001075.5	0.36	PKS, terpene	aurachin RE	Rhodococcus erythropolis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002436.2	0.42	other (other)	coformycin	Streptomyces citricolor
BGC0000513.3	0.41	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000502.5	0.39	ribosomal	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001075.5	0.36	PKS, terpene	aurachin RE	Rhodococcus erythropolis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

F603_RS0110255: PT_FPPS_like

Domain 1 (64 - 353): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.56 out of 20.97

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.39 out of 25.31

Confidence: medium

Additional weak hits (8):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.63 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.66 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.83 out of 26.12

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.78 out of 21.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A

NZ_KB905816.1 - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 89,785 - 168,918 nt. (total: 79,134 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

F603_RS0112400: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

F603_RS0112495: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS0112500: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS0112515: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F603_RS0112535: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

F603_RS32010: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acylase

F603_RS0112480: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

F603_RS0112485: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

F603_RS0112525: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

F603_RS0112465: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

F603_RS0112415: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS0112475: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F603_RS0112490: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F603_RS0112545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.64	PKS	oronofacic acid	Pseudomonas syringae
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (14):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.05 out of 27.55

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.58 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.00 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 18.77 out of 33.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.83 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.07 out of 32.74

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.40 out of 24.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.37 out of 30.98

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 32.93

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.03 out of 25.88

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.92 out of 23.43

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.58 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.30 out of 33.14

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.46 out of 27.18

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 89784 - 168918:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (pk - ccmal) + (ccmal - pk) + (ohmal) + (Me-redmal) + (ohemal) + (ohmal)
Non-colinear ordering:: F603_RS0112475 + F603_RS0112480 + F603_RS0112485 + F603_RS0112495 + F603_RS0112500 + F603_RS0112490

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

F603_RS0112415: X

AMP-binding (12..391): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SALLHGLILG-GFGVSGSAVERYGMTETLMNTSV
Nearest Stachelhaus code(s):: nohBza GLGLVGAIIK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

F603_RS0112475: pk - mal

PKS_AT (231..525): pk

ATSignature: CHC-CoA

Top 3 matches:: CHC-CoA: 95.8%; Ethylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 66.7%

minowa: CHC-CoA

Prediction, score:

CHC-CoA: 198.0
Ethylmalonyl-CoA: 156.2
Methylmalonyl-CoA: 154.1
Methoxymalonyl-CoA: 128.9
2-Methylbutyryl-CoA: 113.4
trans-1,2-CPDA: 105.4
Propionyl-CoA: 99.5
Malonyl-CoA: 78.6
Isobutyryl-CoA: 63.9
Benzoyl-CoA: 60.2
Acetyl-CoA: 28.2
fatty_acid: 26.7
3-Methylbutyryl-CoA: 14.2
inactive: 11.4

PKS_AT (1197..1461): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 121.3
Methoxymalonyl-CoA: 65.7
inactive: 50.6
Methylmalonyl-CoA: 35.2
Isobutyryl-CoA: 22.1
Acetyl-CoA: 21.3
Propionyl-CoA: 19.1
Ethylmalonyl-CoA: 15.5
trans-1,2-CPDA: 11.3
CHC-CoA: 8.8
fatty_acid: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

F603_RS0112480: mal - pk

PKS_AT (555..823): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 119.7
Methoxymalonyl-CoA: 70.0
inactive: 53.7
Methylmalonyl-CoA: 39.2
Acetyl-CoA: 25.2
Ethylmalonyl-CoA: 21.8
Propionyl-CoA: 18.9
Isobutyryl-CoA: 16.6
trans-1,2-CPDA: 13.6
CHC-CoA: 11.1
fatty_acid: 0.0
Benzoyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (2250..2541): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 213.8
Methylmalonyl-CoA: 207.7
Methoxymalonyl-CoA: 171.5
2-Methylbutyryl-CoA: 130.3
Malonyl-CoA: 119.6
trans-1,2-CPDA: 117.1
Propionyl-CoA: 111.7
CHC-CoA: 105.2
Isobutyryl-CoA: 80.3
Benzoyl-CoA: 72.7
Acetyl-CoA: 61.7
fatty_acid: 40.8
inactive: 38.3
3-Methylbutyryl-CoA: 21.6

F603_RS0112485: mal

PKS_AT (571..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 178.6
inactive: 79.8
Methoxymalonyl-CoA: 75.7
Methylmalonyl-CoA: 57.4
Propionyl-CoA: 27.7
Acetyl-CoA: 22.8
CHC-CoA: 21.3
Benzoyl-CoA: 18.1
fatty_acid: 18.0
2-Methylbutyryl-CoA: 17.8
Isobutyryl-CoA: 16.9
Ethylmalonyl-CoA: 12.9
trans-1,2-CPDA: 10.7
3-Methylbutyryl-CoA: 0.0

F603_RS0112490: mal

PKS_AT (558..831): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Methylbutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.3
inactive: 100.2
Methoxymalonyl-CoA: 73.8
Methylmalonyl-CoA: 60.5
Propionyl-CoA: 41.6
Isobutyryl-CoA: 38.9
Acetyl-CoA: 35.5
Ethylmalonyl-CoA: 32.2
2-Methylbutyryl-CoA: 32.0
CHC-CoA: 31.0
Benzoyl-CoA: 25.6
trans-1,2-CPDA: 21.9
fatty_acid: 18.3
3-Methylbutyryl-CoA: 7.5

F603_RS0112495: mmal

PKS_AT (573..872): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 201.4
Ethylmalonyl-CoA: 184.9
Methoxymalonyl-CoA: 161.8
2-Methylbutyryl-CoA: 139.9
Malonyl-CoA: 110.3
Propionyl-CoA: 107.2
CHC-CoA: 99.2
trans-1,2-CPDA: 97.8
Isobutyryl-CoA: 81.0
Benzoyl-CoA: 79.4
Acetyl-CoA: 78.3
fatty_acid: 43.9
3-Methylbutyryl-CoA: 39.9
inactive: 36.3

F603_RS0112500: emal

PKS_AT (574..873): emal

ATSignature: Ethylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%; Methylmalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 183.0
Methylmalonyl-CoA: 180.1
Methoxymalonyl-CoA: 150.3
2-Methylbutyryl-CoA: 113.9
Malonyl-CoA: 97.5
CHC-CoA: 97.4
trans-1,2-CPDA: 95.6
Propionyl-CoA: 93.7
Isobutyryl-CoA: 76.0
Benzoyl-CoA: 63.5
Acetyl-CoA: 61.0
fatty_acid: 36.5
inactive: 22.6
3-Methylbutyryl-CoA: 19.4

F603_RS0112545: X

AMP-binding (457..886): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AMESHTGFLYGLQAVATGACGAFGTTETCLAALS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_KB905816.1 - Region 2 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 527,115 - 574,350 nt. (total: 47,236 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

F603_RS0114390: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

F603_RS0114410: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Lyases: cyclase dehydratase

F603_RS0114340: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

F603_RS0114345: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

F603_RS0114450: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002707.2	0.23	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002535.2	0.20	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001226.4	0.18	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.17	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002514.3	0.17	PKS	julichrome Q6.6	Streptomyces sampsonii
BGC0001300.5	0.16	PKS	anthracimycin	Streptomyces sp. CNH365
BGC0001579.4	0.16	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0002220.2	0.16	terpene	Ent-kauren-16alpha-ol	Punctularia strigosozonata HHB-11173 SS5
BGC0000221.5	0.15	PKS	erdacin	uncultured soil bacterium V167
BGC0001965.4	0.15	other (other)	nybomycin	Streptomyces albus subsp. chlorinus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001226.4	0.49	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0000563.4	0.48	ribosomal	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0002635.2	0.48	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001727.3	0.48	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0001579.4	0.47	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000540.5	0.46	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000503.5	0.45	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0001229.4	0.45	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001660.3	0.45	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000605.5	0.45	ribosomal	GE37468	Streptomyces sp. ATCC 55365

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (8):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.24 out of 31.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.00 out of 26.85

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.84 out of 29.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.27 out of 20.01

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.76 out of 18.57

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.55 out of 26.12

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.88 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 247; Score: 59.8

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_KB905816.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 584,547 - 611,217 nt. (total: 26,671 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F603_RS0114650: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

Transferases: aminotransferase transferase

F603_RS0114580: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

F603_RS0114655: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Ligases: synthetase

F603_RS0114600: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: transport

F603_RS0114625: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.65	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.58	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.50	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.65	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.58	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000664.5	0.50	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

F603_RS0114595: T2TS

Domain 1 (51 - 686): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

F603_RS0114600: PT_FPPS_like

Domain 1 (61 - 354): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

F603_RS0114610: PT_phytoene_like

Domain 1 (17 - 300): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

F603_RS0114615: PT_phytoene_like

Domain 1 (11 - 279): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

Additional weak hits (5):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.65 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.31 out of 24.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.37 out of 30.98

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.33 out of 29.25

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein

NZ_KB905817.1 - Region 1 - NRPS,T1PKS,transAT-PKS-like

Download region GenBank file

Download region SVG

Location: 207,021 - 301,164 nt. (total: 94,144 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
transAT-PKS-like: cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS) and not PKS_AT)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

F603_RS0116340: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F603_RS0116350: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

F603_RS0116365: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F603_RS0116415: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase glycosyltransferase methyltransferase transferase

F603_RS0116330: methyltransferase

smcogs: SMCOG1089: methyltransferase

F603_RS0116335: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

F603_RS0116380: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

F603_RS0116385: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

F603_RS0116435: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: amidase back translocase esterase

F603_RS0116375: amidase

smcogs: SMCOG1105: amidase

F603_RS0116445: thioesterase

smcogs: SMCOG1004: thioesterase

F603_RS0116460: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

F603_RS0116465: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Lyases: dehydratase

F603_RS0116355: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

F603_RS0116390: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

F603_RS0116400: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F603_RS0116405: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F603_RS0116410: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F603_RS0116420: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

F603_RS0116425: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F603_RS0116430: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.77	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.77	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000041.3	0.67	PKS	oronofacic acid	Pseudomonas syringae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.58	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.58	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.58	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000357.5	0.58	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002276.2	0.64	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001268.4	0.63	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002164.2	0.63	NRPS	peramine	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (3):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.78 out of 39.62

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.65 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 207020 - 301164:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (Me-ohmal - ohmal - mal) + (Gly - ccmal) + (Me-ccmal - mal - ohmal - ohmal - ccmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 214903 - 301164:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal - ccmal) + (Me-ohmal - ohmal - mal) + (Gly - ccmal) + (Me-ccmal - mal - ohmal - ohmal - ccmal) + (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

F603_RS0116335: pk - mal

PKS_AT (7..297): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 32.4
Malonyl-CoA: 26.7
Methylmalonyl-CoA: 21.6
Isobutyryl-CoA: 17.0
Propionyl-CoA: 13.1
inactive: 11.9
fatty_acid: 8.9
trans-1,2-CPDA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

PKS_AT (339..618): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 121.2
inactive: 35.9
Methoxymalonyl-CoA: 35.8
Methylmalonyl-CoA: 33.3
Propionyl-CoA: 31.8
2-Methylbutyryl-CoA: 16.7
fatty_acid: 9.9
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

F603_RS0116420: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (529..923): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIAGLELQALCGGEWNMYGPTETTIWSSV
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_KB905818.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 44,692 - 77,255 nt. (total: 32,564 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

F603_RS0117535: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Isomerases: mutase

F603_RS0117540: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000941.3	0.51	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0002305.2	0.49	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002633.2	0.47	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0000941.3	0.51	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0002305.2	0.49	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0002633.2	0.47	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002683.2	0.47	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.91 out of 19.26

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.29 out of 23.79

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.01 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.44 out of 27.18

Confidence: medium

Additional weak hits (9):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.34 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.15 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.51 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.32 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.46 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes
RpoN	Regulator of nitrogen assimilation and virulence

NZ_KB905818.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 330,686 - 378,047 nt. (total: 47,362 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

F603_RS0118720: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

F603_RS0118745: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

F603_RS0118770: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

F603_RS32380: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: kinase

F603_RS32375: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: hydrolase

F603_RS0118750: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

F603_RS0118740: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

F603_RS0118680: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.72	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.72	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.61 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.61 out of 21.55

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.23 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.98 out of 25.88

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.11 out of 30.22

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.49 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.04 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 330685 - 378047:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

F603_RS0118740: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (26..432): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: VNALFTCAHPGGALQVGGAQQVYGMSEGLLSFTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVLCK (71% 8Å match); Sal PLPAQGVLNK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

F603_RS0118745: pk

PKS_AT (536..832): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 66.7%; Methoxymalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 109.1
Methoxymalonyl-CoA: 97.7
Malonyl-CoA: 90.8
Ethylmalonyl-CoA: 69.3
2-Methylbutyryl-CoA: 64.0
Isobutyryl-CoA: 58.0
Propionyl-CoA: 53.1
trans-1,2-CPDA: 45.9
fatty_acid: 33.9
Acetyl-CoA: 26.3
CHC-CoA: 23.1
inactive: 17.0
Benzoyl-CoA: 15.7
3-Methylbutyryl-CoA: 3.5

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
OsdR	Development and stress management regulator

NZ_KB905819.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 10,722 - 35,292 nt. (total: 24,571 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

F603_RS0119400: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

F603_RS0119405: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Ligases: ligase

F603_RS0119370: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000544.4	0.79	ribosomal	planosporicin	Planomonospora alba
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.70	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002274.2	0.56	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0001579.4	0.53	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.52	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000542.3	0.52	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.51	ribosomal	paenicidin A	Paenibacillus polymyxa

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000544.4	0.79	ribosomal	planosporicin	Planomonospora alba
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.70	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0002274.2	0.56	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001289.5	0.55	ribosomal	penisin	Paenibacillus ehimensis
BGC0001579.4	0.53	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0001660.3	0.52	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000542.3	0.52	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.51	ribosomal	paenicidin A	Paenibacillus polymyxa

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for F603_RS0119405

F603_RS34750

Leader:

MGINSPADVRNDEGLLDLDLEIGVEKSVAGPA

Core:

VTSISYCTPGCTSEGGGSGCSHCC

Core with dehydrations:

VDhbDhaIDhaYCysDhbPGCysDhbDhaEGGGDhaGCysDhaHCysCys

antiSMASH-DB 4.0 matches for F603_RS34750

100.0%

NZ_KB905819.1:

Lanthipeptides: F603_RS34750_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

VTSISYCTPGCTSEGGGSGCSHCC

1

VTSISYCTPGCTSEGGGSGCSHCC

24

95.8%

NZ_CP007699.2:

Lanthipeptides: T261_RS08380_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

VTSISYCTPGCTS+GGGSGCSHCC

1

VTSISYCTPGCTSDGGGSGCSHCC

24

95.8%

NZ_CP048882.1and 1 other:

NZ_CP048882.1 Lanthipeptides: G4Z16_RS06545_lanthipeptide

Lanthipeptides: G4Z16_RS06545_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

+TSISYCTPGCTSEGGGSGCSHCC

1

ITSISYCTPGCTSEGGGSGCSHCC

24

with 103 more sequence matches

Only the first 10 are displayed here.

95.8%

NZ_JAMTCQ010000009.1:

Lanthipeptides: LY41_RS11610_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

VTS+SYCTPGCTSEGGGSGCSHCC

1

VTSVSYCTPGCTSEGGGSGCSHCC

24

91.7%

NZ_FMHI01000015.1and 1 other:

NZ_LIXJ01000007.1 Lanthipeptides: AMK22_RS13160_lanthipeptide

Lanthipeptides: H180DRAFT_RS21560_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

+TS+SYCTPGCTSEGGGSGCSHCC

1

ITSVSYCTPGCTSEGGGSGCSHCC

24

91.7%

NZ_JADDUE010000020.1:

Lanthipeptides: INP57_RS28495_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

VTS+SYCTPGCTSEGGGS CSHCC

1

VTSVSYCTPGCTSEGGGSNCSHCC

24

87.5%

NZ_JAMHJQ010000009.1and 2 others:

NZ_KN039946.1 Lanthipeptides: FM21_RS35825_lanthipeptideNZ_LIPF01000002.1 Lanthipeptides: AMK11_RS10850_lanthipeptide

Lanthipeptides: M1203_RS22635_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

+TS+S+CTPGCTSEGGGSGCSHCC

1

ITSVSWCTPGCTSEGGGSGCSHCC

24

87.5%

NZ_LIVZ01000011.1:

Lanthipeptides: AMK31_RS29125_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

+TS+SYCTPGCTS+GGGSGCSHCC

1

ITSVSYCTPGCTSDGGGSGCSHCC

24

83.3%

NZ_JACHEM010000003.1:

Lanthipeptides: HNQ79_RS07795_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

+TS+S+CTPGCTS+GGGSGCSHCC

1

ITSVSWCTPGCTSDGGGSGCSHCC

24

79.2%

NZ_AXWW01000016.1and 1 other:

NZ_JAMTCO010000009.1 Lanthipeptides: LV75_RS20160_lanthipeptide

Lanthipeptides: H504_RS39505_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

+TSIS CTPGCTS GGGS CS CC

1

ITSISLCTPGCTSAGGGSNCSFCC

24

79.2%

NZ_FMZZ01000002.1:

Lanthipeptides: BLS56_RS30480_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

VTS+S CTPGCTS GGGS CS CC

1

VTSVSLCTPGCTSPGGGSNCSFCC

24

79.2%

NZ_KI866523.1:

Lanthipeptides: MPTA5024_RS39835_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

VTS S CTPGCTS GGGS CS CC

1

VTSWSLCTPGCTSPGGGSNCSFCC

24

75.0%

NZ_AP023356.1:

Lanthipeptides: Aiant_RS23765_lanthipeptide

1

VTSISYCTPGCTSEGGGSGCSHCC

24

+TS+S CTPGCTS GGGS CS CC

1

ITSVSLCTPGCTSAGGGSQCSFCC

24

MIBiG 4.0 matches for F603_RS34750

35.3%

BGC0000535.4 (ADJ56352.1):

Lanthipeptide: nisin A

1

VTSISYCTPGCTSEGGGSGCS

21

+TSIS CTPGC + G GC+

1

ITSISLCTPGCKT-GALMGCN

20

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.23 out of 27.18

Confidence: medium

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.56 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.76 out of 29.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.41 out of 35.63

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.31 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.34 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.45 out of 30.98

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

F603_RS34750 - Class I

Cleavage pHMM score: 9.60

RODEO score: 27

Monoisotopic mass: 2150.8 Da

Molecular weight: 2152.4 Da

Number of bridges: 5

Alternative weights: (assuming N unmodified Ser/Thr residues); 2170.4 Da N = 1; 2188.4 Da N = 2; 2206.4 Da N = 3

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 174 - 264; Score: 50.9

TFBS definitions

Regulator	Description
NrdR	Represses ribonucleotide reductase encoding genes
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905819.1 - Region 2 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 51,102 - 83,722 nt. (total: 32,621 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

F603_RS0119590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.54	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000662.5	0.52	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001146.5	0.50	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001592.5	0.50	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0002826.2	0.50	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000606.5	0.50	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0000889.5	0.50	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0002311.3	0.49	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001295.5	0.49	other (other)	cremeomycin	Streptomyces cremeus
BGC0001145.5	0.48	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.54	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000662.5	0.52	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001146.5	0.50	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001592.5	0.50	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0002826.2	0.50	other (other)	closoxazole A, closoxazole B	Clostridium cavendishii DSM 21758
BGC0000606.5	0.50	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0000889.5	0.50	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0002311.3	0.49	ribosomal	cutimycin	Cutibacterium acnes KPA171202
BGC0001295.5	0.49	other (other)	cremeomycin	Streptomyces cremeus
BGC0001145.5	0.48	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.40 out of 20.97

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

Additional weak hits (8):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.50 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.42 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 20.25 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.33 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.36 out of 29.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.12 out of 29.65

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 0 - 82; Score: 37.6

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A

Core peptide predictions

No core peptides found.

NZ_KB905819.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 207,993 - 258,573 nt. (total: 50,581 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase synthase

F603_RS0120215: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

F603_RS0120230: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

F603_RS0120295: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: synthase

F603_RS0120230: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Ligases: ligase synthase

F603_RS0120285: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

F603_RS0120315: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

Additional weak hits (21):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.45 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.60 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.36 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.56 out of 28.14

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.76 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.21 out of 23.43

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.71 out of 26.85

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.17 out of 20.97

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.24 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.50 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.58 out of 33.14

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.33 out of 23.43

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.01 out of 36.54

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.80 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 207992 - 258573:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Orn - Orn - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

F603_RS0120315: Orn - Orn - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (473..950): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDAAWDPWETALGGEYNFYGPTEATVDAVT
Nearest Stachelhaus code(s):: Lys DADDAGTVDK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1613..2015): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDASWDPWETALGGEWNLYGPTEATVDSTA
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (74% 8Å match); Lys DADDAGTVDK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2674..3075): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDASWDPWETALGGEWNLYGPTEATVDTLC
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (71% 8Å match); Lys DADDAGTVDK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_KB905821.1 - Region 1 - PKS-like,T3PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 95,802 - 150,458 nt. (total: 54,657 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
PKS-like: (t2pks2 or ksIII)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

F603_RS0123020: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

F603_RS0123060: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS35605: monooxygenase FAD-binding

smcogs: SMCOG1246: monooxygenase FAD-binding

Transferases: glycosyltransferase halogenase methyltransferase

F603_RS0123035: halogenase

smcogs: SMCOG1119: halogenase

F603_RS0123130: methyltransferase

smcogs: SMCOG1089: methyltransferase

F603_RS32655: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

F603_RS0123030: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

F603_RS0123135: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: decarboxylase dehydratase

F603_RS0123090: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

F603_RS0123105: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

F603_RS0123045: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F603_RS0123075: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

F603_RS0123085: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS0123100: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

F603_RS32635: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.61	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000286.3	0.59	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000218.5	0.57	PKS	doxorubicin	Streptomyces peucetius
BGC0002547.2	0.57	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces youssoufiensis
BGC0000217.5	0.55	PKS	daunorubicin	Streptomyces sp.
BGC0000192.3	0.52	PKS	aclacinomycin	Streptomyces galilaeus
BGC0001197.5	0.52	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002510.2	0.52	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000191.5	0.51	PKS	aclacinomycin	Streptomyces galilaeus
BGC0001596.3	0.50	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.5	0.53	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000286.3	0.52	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0002547.2	0.51	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces youssoufiensis
BGC0000218.5	0.51	PKS	doxorubicin	Streptomyces peucetius
BGC0000909.3	0.51	other (other)	melanin	Streptomyces avermitilis
BGC0000217.5	0.50	PKS	daunorubicin	Streptomyces sp.
BGC0002510.2	0.49	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0000192.3	0.49	PKS	aclacinomycin	Streptomyces galilaeus
BGC0000191.5	0.49	PKS	aclacinomycin	Streptomyces galilaeus
BGC0001197.5	0.49	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.00 out of 20.47

Confidence: strong

Additional weak hits (13):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.71 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.69 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.50 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.65 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.16 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.80 out of 27.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.13 out of 39.62

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.03 out of 29.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.17 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.24 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

F603_RS0123085: X

AMP-binding (11..405): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGLYQLAGTNTGAQLMYGLTECKRATIM
Nearest Stachelhaus code(s):: Asp DYYPTTMRAK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905821.1 - Region 2 - T1PKS

Download region GenBank file

Download region SVG

Location: 306,804 - 349,537 nt. (total: 42,734 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

F603_RS0124095: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

F603_RS0124120: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

F603_RS32740: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

F603_RS32750: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acylase halogenase

F603_RS0124055: flavin-dependent pyrrole halogenase

halogenases: flavin-dependent pyrrole halogenase
smcogs: SMCOG1119: halogenase

F603_RS0124060: ambiguous flavin-dependent halogenase

halogenases: ambiguous flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

F603_RS0124080: flavin-dependent pyrrole halogenase

halogenases: flavin-dependent pyrrole halogenase
smcogs: SMCOG1119: halogenase

F603_RS32760: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Ligases: ligase synthase

F603_RS0124100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS0124115: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

F603_RS32755: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.76	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000131.5	0.61	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002341.2	0.76	other (other)	3,5-dibromo-p-anisic acid	Planctomycetales bacterium 10988
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000131.5	0.61	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001244.3	0.60	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (10):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.29 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.17 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.98 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.63 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.01 out of 20.97

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.81 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.04 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.72 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.62 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 306803 - 349537:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (mal - Me-ohmal)
Non-colinear ordering:: F603_RS32755 + F603_RS32760

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

F603_RS32755: mal

PKS_AT (572..867): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 167.8
inactive: 100.2
Methoxymalonyl-CoA: 77.5
Methylmalonyl-CoA: 69.8
Ethylmalonyl-CoA: 67.2
Propionyl-CoA: 44.7
2-Methylbutyryl-CoA: 39.6
trans-1,2-CPDA: 39.1
CHC-CoA: 38.1
Isobutyryl-CoA: 32.1
Acetyl-CoA: 28.1
fatty_acid: 20.5
Benzoyl-CoA: 15.7
3-Methylbutyryl-CoA: 7.3

F603_RS32760: mal - mmal

PKS_AT (539..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; Methylmalonyl-CoA: 70.8%; Propionyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 114.9
Methylmalonyl-CoA: 106.9
Methoxymalonyl-CoA: 95.7
Isobutyryl-CoA: 69.8
Ethylmalonyl-CoA: 65.9
inactive: 52.3
Propionyl-CoA: 41.4
CHC-CoA: 38.5
fatty_acid: 37.2
Acetyl-CoA: 37.1
2-Methylbutyryl-CoA: 27.5
Benzoyl-CoA: 25.5
3-Methylbutyryl-CoA: 24.3
trans-1,2-CPDA: 21.6

PKS_AT (1555..1846): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 66.7%; Malonyl-CoA: 62.5%; Ethylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 135.7
Ethylmalonyl-CoA: 127.8
Methoxymalonyl-CoA: 117.4
Propionyl-CoA: 98.0
2-Methylbutyryl-CoA: 90.5
Malonyl-CoA: 79.5
CHC-CoA: 74.1
trans-1,2-CPDA: 73.0
Isobutyryl-CoA: 62.9
Acetyl-CoA: 57.5
Benzoyl-CoA: 53.9
fatty_acid: 45.5
inactive: 30.3
3-Methylbutyryl-CoA: 22.9

F603_RS0124100: Pro

Search NORINE for peptide: strict or relaxed

AMP-binding (9..405): Pro

nrpys: Pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAAFDLSVLDVYSLFAGELNLYGPTETNVCTAY
Nearest Stachelhaus code(s):: Pro DLLYLALVCK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description

NZ_KB905822.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 223,882 - 266,554 nt. (total: 42,673 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase

F603_RS0125385: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

F603_RS0125415: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

F603_RS0125445: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Hydrolases: esterase hydrolase

F603_RS0125365: isochorismatase

smcogs: SMCOG1027: isochorismatase

F603_RS0125410: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

F603_RS0125420: thioesterase

smcogs: SMCOG1004: thioesterase

Isomerases: isomerase

F603_RS32925: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

F603_RS0125450: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS0125460: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS32915: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.60	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.60	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.59	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.58	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 25.13 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.95 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.93 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.95 out of 28.19

Confidence: medium

Additional weak hits (21):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.22 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.35 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.48 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 21.55 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.04 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.16 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.42 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.52 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.60 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.03 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.40 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.18 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.01 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.39 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.50 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.78 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.38 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.86 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.00 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 223881 - 266554:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

F603_RS32915: Ser - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (563..941): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDLSFDLSVFDANCLLGGDVALGGTTETAIHSTV
Nearest Stachelhaus code(s):: Ser DLFNLGLIHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1581..1977): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDVSFDLSVYDGNSLVSGDVALGGATEAAIWSNA
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

F603_RS0125450: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (543..939): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVFDGDSLLSGDVSLGGATEAAIWSIH
Nearest Stachelhaus code(s):: Cys DLFNLSLIWK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

F603_RS0125460: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (32..435): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFPLACPGGALQVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVVNK (91% 8Å match); diOH-Bz or Sal PLPAQGVVNK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_KB905823.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 101,016 - 173,007 nt. (total: 71,992 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: electron transfer

F603_RS0126020: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: acylase carboxylase methyltransferase transferase

F603_RS0126080: methyltransferase

smcogs: SMCOG1089: methyltransferase

F603_RS0126090: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

F603_RS0126110: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

F603_RS32945: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: back translocase esterase hydrolase peptidase

F603_RS0126030: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

F603_RS0126045: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

F603_RS0126140: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

F603_RS32950: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

F603_RS0126060: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F603_RS0126065: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F603_RS0126070: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F603_RS0126100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS0126105: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS32940: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.89	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.88	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.87	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000342.4	0.75	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.70	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.67	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000342.4	0.70	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001641.4	0.68	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.67	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.58 out of 23.79

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.52 out of 23.79

Confidence: medium

Additional weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.37 out of 26.85

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.62 out of 26.12

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.37 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.88 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 101015 - 173007:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk) + (pk) + (Me-redmal) + (Me-ccmal) + (D-mal) + (NMe-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 101015 - 167798:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk) + (pk) + (Me-redmal) + (Me-ccmal) + (D-mal) + (NMe-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 127811 - 173007:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk) + (Me-redmal) + (Me-ccmal) + (D-mal) + (NMe-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

F603_RS32940: pk

PKS_AT (562..858): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 75.0%; Propionyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 129.0
Ethylmalonyl-CoA: 107.7
Malonyl-CoA: 97.9
Methoxymalonyl-CoA: 96.9
2-Methylbutyryl-CoA: 83.4
Propionyl-CoA: 73.9
trans-1,2-CPDA: 61.7
Isobutyryl-CoA: 50.8
CHC-CoA: 42.7
Acetyl-CoA: 42.7
inactive: 42.4
Benzoyl-CoA: 37.7
fatty_acid: 25.6
3-Methylbutyryl-CoA: 24.8

F603_RS0126060: pk

PKS_AT (557..849): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 70.8%; Methoxymalonyl-CoA: 66.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 118.1
Methoxymalonyl-CoA: 92.0
Ethylmalonyl-CoA: 86.2
Malonyl-CoA: 82.6
Isobutyryl-CoA: 64.1
2-Methylbutyryl-CoA: 62.5
trans-1,2-CPDA: 57.9
Propionyl-CoA: 53.3
Acetyl-CoA: 47.0
fatty_acid: 41.3
CHC-CoA: 40.4
Benzoyl-CoA: 37.8
3-Methylbutyryl-CoA: 32.4
inactive: 31.6

F603_RS0126065: mmal

PKS_AT (571..858): mmal

ATSignature: Methoxymalonyl-CoA, Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 62.5%; Malonyl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 125.5
Methoxymalonyl-CoA: 112.7
Ethylmalonyl-CoA: 92.9
Malonyl-CoA: 79.0
Isobutyryl-CoA: 74.7
trans-1,2-CPDA: 69.4
2-Methylbutyryl-CoA: 69.2
Propionyl-CoA: 63.0
Acetyl-CoA: 60.3
fatty_acid: 56.9
CHC-CoA: 38.4
Benzoyl-CoA: 36.8
inactive: 36.3
3-Methylbutyryl-CoA: 19.7

F603_RS0126070: mmal

PKS_AT (574..871): mmal

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 121.5
Ethylmalonyl-CoA: 106.1
Methoxymalonyl-CoA: 93.2
Malonyl-CoA: 85.5
Propionyl-CoA: 83.7
trans-1,2-CPDA: 79.6
2-Methylbutyryl-CoA: 62.5
Isobutyryl-CoA: 54.7
fatty_acid: 45.5
Acetyl-CoA: 31.2
CHC-CoA: 24.0
Benzoyl-CoA: 23.0
3-Methylbutyryl-CoA: 19.8
inactive: 17.0

F603_RS32945: mal

PKS_AT (553..835): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 138.0
inactive: 72.3
Methoxymalonyl-CoA: 69.9
Methylmalonyl-CoA: 61.4
Isobutyryl-CoA: 40.6
Propionyl-CoA: 38.0
Ethylmalonyl-CoA: 31.5
trans-1,2-CPDA: 17.6
Benzoyl-CoA: 16.7
fatty_acid: 16.0
CHC-CoA: 14.0
2-Methylbutyryl-CoA: 10.1
Acetyl-CoA: 2.4
3-Methylbutyryl-CoA: 1.9

F603_RS0126080: X

AMP-binding (468..858): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TVRASYLYLFSTVLVVTGELSLYGSAETAGAAVL
Nearest Stachelhaus code(s):: D-Ala DLFTVCLIAK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

F603_RS0126100: Acetyl-CoA

CAL_domain (46..496): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 48.6
fatty_acid: 28.8
NH2: 8.8
AHBA: 3.3
shikimic_acid: 0.0

F603_RS0126105: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (21..408): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LACHFDFSVWEGSQVLGGEYNMYGITEITVHATV
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_KB905828.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 1 - 56,627 nt. (total: 56,627 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

F603_RS0129160: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

F603_RS0129250: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

F603_RS33185: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acetyltransferase acylase methyltransferase

F603_RS0129085: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

F603_RS0129130: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

F603_RS0129135: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

F603_RS0129245: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: cyclase

F603_RS0129105: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

F603_RS0129120: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

F603_RS0129125: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

F603_RS0129240: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000264.5	0.76	PKS	resistomycin, resistoflavine	Streptomyces resistomycificus
BGC0000231.5	0.62	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002274.2	0.59	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.55	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000866.5	0.55	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000264.5	0.76	PKS	resistomycin, resistoflavine	Streptomyces resistomycificus
BGC0000231.5	0.62	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001257.3	0.60	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.59	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002274.2	0.59	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001513.3	0.55	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000866.5	0.55	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 25.31

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.67 out of 23.79

Confidence: medium

Additional weak hits (14):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.22 out of 36.54

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.10 out of 26.12

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 20.37 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.75 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.61 out of 32.74

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.28 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.00 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.16 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.19 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.05 out of 20.97

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.59 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.59 out of 35.63

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

TFBS Finder

NRPS/PKS substrate predictions

F603_RS0129085: mal

PKS_AT (99..388): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 51.1
Methoxymalonyl-CoA: 37.6
inactive: 30.6
Methylmalonyl-CoA: 29.6
Isobutyryl-CoA: 13.3
Ethylmalonyl-CoA: 12.7
2-Methylbutyryl-CoA: 11.5
fatty_acid: 11.4
CHC-CoA: 11.0
Propionyl-CoA: 10.6
3-Methylbutyryl-CoA: 10.5
Benzoyl-CoA: 9.8
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0

F603_RS0129240: X

AMP-binding (56..508): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TATAFDRGAR-I--ICGGSYEGYGLTETTAAATA
Nearest Stachelhaus code(s):: nDodec DVLFIGGVAK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 0 to 56627
Starter unit(s):: 2-methylbutyryl-CoA (Score: 116.0; E-value: 2.78e-31)

F603_RS0129085: AT (Score: 155.5; E-value: 4e-48); AT ADB23379.1_TLN-05220/TLN-05223_2-methylbutyryl-CoA (Score: 116.0; E-value: 2.78e-31)
F603_RS0129090: CYC C5-C14/C3-C16 (Score: 319.5; E-value: 3.8e-98)
F603_RS0129105: CYC C9-C14 (Score: 127.5; E-value: 7.7e-40)
F603_RS0129110: ACP (Score: 34.1; E-value: 4.8e-11)
F603_RS0129120: CLF (Score: 431.0; E-value: 9.8e-132)
F603_RS0129125: KS (Score: 514.9; E-value: 3.3e-157)
F603_RS0129130: MET (Score: 144.6; E-value: 8.8e-45)
F603_RS0129135: MET (Score: 172.4; E-value: 3.3e-53)
F603_RS0129250: KR (Score: 131.4; E-value: 1.1e-40)
F603_RS33185: OXY (Score: 126.3; E-value: 3.8e-39)

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism

NZ_KB905830.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 62,565 - 72,882 nt. (total: 10,318 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F603_RS0130255: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: Methylation

F603_RS34500: Methylation

MITE: MITE0000049Methylation (identity: 66.30%)

Hydrolases: Hydrolysis hydrolase

F603_RS0130260: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

F603_RS0130265: Hydrolysis

MITE: MITE0000048Hydrolysis (identity: 69.20%)

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000470.6	0.46	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000468.5	0.42	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.42	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000469.6	0.39	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000507.5	0.36	ribosomal	epicidin	Staphylococcus epidermidis
BGC0000217.5	0.35	PKS	daunorubicin	Streptomyces sp.
BGC0002181.3	0.35	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0002716.2	0.35	NRPS	gamexpeptide A, gamexpeptide B, gamexpeptide E, luminmide B, luminmide D, luminmide E, luminmide F, luminmide G	Photorhabdus laumondii subsp. laumondii
BGC0001882.3	0.35	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000631.5	0.34	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000470.6	0.46	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000468.5	0.42	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.42	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000469.6	0.39	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0000507.5	0.36	ribosomal	epicidin	Staphylococcus epidermidis
BGC0000217.5	0.35	PKS	daunorubicin	Streptomyces sp.
BGC0002181.3	0.35	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0002716.2	0.35	NRPS	gamexpeptide A, gamexpeptide B, gamexpeptide E, luminmide B, luminmide D, luminmide E, luminmide F, luminmide G	Photorhabdus laumondii subsp. laumondii
BGC0001882.3	0.35	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000631.5	0.34	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Bottromycin_Methyltransferase_RRE; Location: 0 - 57; Score: 93.5

TFBS definitions

Regulator	Description

NZ_KB905831.1 - Region 1 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 1 - 47,640 nt. (total: 47,640 nt) Show pHMM detection rules used

Region on contig edge.

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

F603_RS0130295: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

F603_RS0130335: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

F603_RS0130365: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: glycosyltransferase kinase transferase

F603_RS0130310: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

F603_RS0130325: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

F603_RS0130420: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

F603_RS0130455: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

F603_RS0130465: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: esterase hydrolase phosphatase

F603_RS0130350: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

F603_RS0130380: isochorismatase

smcogs: SMCOG1027: isochorismatase

F603_RS0130450: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Isomerases: isomerase mutase racemase

F603_RS0130315: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

F603_RS0130370: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

F603_RS0130405: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

F603_RS0130375: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

F603_RS0130390: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.87	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001185.5	0.77	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.68	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000401.5	0.67	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001185.5	0.71	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.67	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000401.5	0.67	NRPS	paenibactin	Paenibacillus elgii B69
BGC0000706.3	0.66	saccharide	kanamycin	Streptomyces kanamyceticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.96 out of 29.65

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

Additional weak hits (6):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 19.15 out of 28.14

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.29 out of 33.73

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.94 out of 20.01

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 19.26

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 47640:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

F603_RS0130375: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (45..453): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SGSLFPMSSPGGGMLVGGAMQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

F603_RS0130390: X

AMP-binding (474..873): X

nrpys: Ala, Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVTH
Nearest Stachelhaus code(s):: Ala or Ser DVWHFSLVDK (100% 8Å match); Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
LexA variant 1	Repressor of DNA damage response

NZ_KB905836.1 - Region 1 - RiPP-like,bottromycin

Download region GenBank file

Download region SVG

Location: 1 - 9,160 nt. (total: 9,160 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))
bottromycin: botH

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: Cyclization oxygenase

F603_RS0131235: Cyclization

MITE: MITE0000053Cyclization (identity: 77.50%)

F603_RS0131255: Decarboxylation, Oxidation

MITE: MITE0000044Decarboxylation, Oxidation (identity: 74.00%)
smcogs: SMCOG1007: cytochrome P450

Transferases: Methylation

F603_RS0131240: Methylation

MITE: MITE0000046Methylation (identity: 78.00%)

F603_RS0131260: Methylation

MITE: MITE0000047Methylation (identity: 70.90%)

F603_RS34890: Methylation

MITE: MITE0000049Methylation (identity: 68.40%)

Hydrolases: Hydrolysis dehalogenase

F603_RS0131250: Hydrolysis

MITE: MITE0000050Hydrolysis (identity: 66.10%)

F603_RS33305: Epimerization

MITE: MITE0000051Epimerization (identity: 68.20%)
smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: oxygenase

F603_RS0131255: Decarboxylation, Oxidation

MITE: MITE0000044Decarboxylation, Oxidation (identity: 74.00%)
smcogs: SMCOG1007: cytochrome P450

Isomerases: dehalogenase

F603_RS33305: Epimerization

MITE: MITE0000051Epimerization (identity: 68.20%)
smcogs: SMCOG1262: haloalkane dehalogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000470.6	1.38	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.93	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001157.6	0.93	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.92	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001201.3	0.38	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.36	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000844.5	0.29	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000598.5	0.27	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0002120.3	0.26	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000902.4	0.25	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000470.6	0.88	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000469.6	0.76	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0001157.6	0.76	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.5	0.76	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001201.3	0.51	terpene	eremophilene	Sorangium cellulosum So ce56
BGC0001310.5	0.49	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0000844.5	0.45	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000598.5	0.42	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0002120.3	0.41	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0000902.4	0.41	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.33 out of 23.79

Confidence: medium

RREFinder

TFBS Finder

RRE predictions

: RRE type: Bottromycin_Methyltransferase_RRE; Location: 0 - 57; Score: 93.8; RRE type: Bottromycin_Methyltransferase_RRE; Location: 531 - 609; Score: 112.9
: RRE type: Bottromycin_Methyltransferase_RRE; Location: 0 - 57; Score: 93.8; RRE type: Bottromycin_Methyltransferase_RRE; Location: 531 - 609; Score: 112.9

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism