GCF_000379465.1 - 37 region(s)

Download region SVG

Location: 1 - 55,801 nt. (total: 55,801 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0100145: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

A37U_RS0100170: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

A37U_RS0100180: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase

A37U_RS0100030: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: deaminase

A37U_RS0100080: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: hydratase

A37U_RS41760: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase synthase

A37U_RS0100005: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS0100015: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A37U_RS0100025: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0100075: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A37U_RS0100085: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.54	PKS	asperlactone	Aspergillus ochraceus
BGC0002191.2	0.54	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.53	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001244.3	0.53	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.50	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.50	PKS	FR901512	fungal sp. No.14919
BGC0001257.3	0.50	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.50	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001284.4	0.63	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.42 out of 24.78

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (11):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.42 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.35 out of 20.97

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.54 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.94 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.99 out of 29.25

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.03 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.54 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.67 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.46 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 55801:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 28579:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0100015: mal

PKS_AT (628..902): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 191.3
inactive: 95.1
Methoxymalonyl-CoA: 66.8
Methylmalonyl-CoA: 61.7
Isobutyryl-CoA: 25.4
Ethylmalonyl-CoA: 22.8
Benzoyl-CoA: 20.1
Propionyl-CoA: 20.0
Acetyl-CoA: 19.5
2-Methylbutyryl-CoA: 10.0
CHC-CoA: 9.9
3-Methylbutyryl-CoA: 6.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0

A37U_RS0100025: X

AMP-binding (14..371): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NRNLHQYGLSMIDACSGAALDSYGSTEMGNVAFA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

A37U_RS0100030: pk

PKS_AT (25..280): pk

ATSignature: (unknown)

No matches above 50%

minowa: Propionyl-CoA

Prediction, score:

Propionyl-CoA: 15.9
CHC-CoA: 15.0
Methylmalonyl-CoA: 14.6
Methoxymalonyl-CoA: 13.7
2-Methylbutyryl-CoA: 6.7
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

A37U_RS0100085: mal

PKS_AT (534..832): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 66.7%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 85.1
Methoxymalonyl-CoA: 59.1
inactive: 53.9
Methylmalonyl-CoA: 35.5
Propionyl-CoA: 30.5
Ethylmalonyl-CoA: 17.9
fatty_acid: 13.1
Acetyl-CoA: 13.0
CHC-CoA: 10.3
Benzoyl-CoA: 10.0
2-Methylbutyryl-CoA: 9.6
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905380.1 - Region 2 - NRPS

Download region SVG

Location: 196,837 - 257,940 nt. (total: 61,104 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0100905: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0100910: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

A37U_RS0100925: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

A37U_RS0100930: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0100935: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0100975: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0100980: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0101070: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: esterase hydrolase

A37U_RS0101010: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

A37U_RS0101060: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

A37U_RS41875: thioesterase

smcogs: SMCOG1004: thioesterase

Lyases: dehydratase

A37U_RS0100920: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

A37U_RS0101075: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase

A37U_RS0100990: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0101030: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0101050: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0101065: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS41865: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A37U_RS48010: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.37 out of 20.47

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.25 out of 18.46

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.57 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.45 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.48 out of 36.53

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 20.47

Confidence: medium

Additional weak hits (6):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.53 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.42 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.44 out of 36.53

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.30 out of 31.73

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.57 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 196836 - 257940:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Cys) + (Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0100990: X

AMP-binding (8..390): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWSSFDLSTFDGYAAFAGEWNLYGPTETNVCTGF
Nearest Stachelhaus code(s):: Pro DLFYLALVCK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

A37U_RS48010: Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (1282..1695): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHTFDASWEQWDVSLGGEYNLYGPTEYTINALG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (82% 8Å match)
Stachelhaus code match:: 70% (weak)

A37U_RS0101030: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (559..948): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TGCSFDLSVQEGYCLLGGDAGLGGATETAIHHTV
Nearest Stachelhaus code(s):: Ser DLYNLGLIHK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

A37U_RS0101050: X

AMP-binding (488..874): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: KAASFIDGSTEEMAVCTGETNSYGCSEVAGDVIA
Nearest Stachelhaus code(s):: bAla IDTLISSGDK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

A37U_RS0101065: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (32..443): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NAALFNYTWPGGAIQIGSAQQVFGMAEGLLNLTR
Nearest Stachelhaus code(s):: Sal PLPAQGVLNK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905380.1 - Region 3 - T1PKS

Download region SVG

Location: 474,250 - 520,441 nt. (total: 46,192 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0102235: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

A37U_RS0102255: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0102270: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acylase carboxylase transferase

A37U_RS0102260: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

A37U_RS0102265: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

A37U_RS42010: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

A37U_RS0102310: putative esterase

smcogs: SMCOG1104: putative esterase

Lyases: dehydratase

A37U_RS0102230: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase

A37U_RS0102305: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.68	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.68	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.67	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001825.4	0.63	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.77 out of 27.04

Confidence: medium

Additional weak hits (5):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.91 out of 26.85

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.25 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 21.55

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 474249 - 520441:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS42010: mmal

PKS_AT (608..901): mmal

ATSignature: Methylmalonyl-CoA, Malonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 62.5%; Malonyl-CoA: 62.5%; Methoxymalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 113.0
Ethylmalonyl-CoA: 96.6
Methoxymalonyl-CoA: 94.4
Malonyl-CoA: 80.3
Propionyl-CoA: 75.5
2-Methylbutyryl-CoA: 75.4
Acetyl-CoA: 59.0
trans-1,2-CPDA: 49.7
fatty_acid: 42.1
Isobutyryl-CoA: 39.5
CHC-CoA: 38.3
inactive: 35.9
3-Methylbutyryl-CoA: 34.8
Benzoyl-CoA: 19.5

A37U_RS0102305: NH2

CAL_domain (56..495): NH2

minowa: NH2

Prediction, score:

NH2: 108.2
Acetyl-CoA: 20.5
fatty_acid: 14.2
AHBA: 7.3
shikimic_acid: 0.0

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
HypR	L-hydroxyproline utilization repressor

NZ_KB905381.1 - Region 1 - RiPP-like

Download region SVG

Location: 11,632 - 21,811 nt. (total: 10,180 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

A37U_RS0106025: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000885.3	0.30	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001866.4	0.29	PKS	viriditoxin	Byssochlamys spectabilis
BGC0000603.5	0.28	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002697.3	0.26	NRPS, PKS	clipibicyclene, azabicyclene B, azabicyclene C, azabicyclene D	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000875.4	0.26	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0002039.3	0.24	other (other)	coformycin, formycin A	Nocardia interforma ATCC 21072
BGC0000914.5	0.24	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001985.4	0.24	other (other)	Pyrazofurin	Streptomyces candidus
BGC0002282.2	0.24	other (other)	formycin A	Streptomyces kaniharaensis
BGC0002478.3	0.24	PKS	rubiginone A2, rubiginone J, rubiginone K, rubiginone L, rubiginone M, rubiginone N, ochromycinone, rubiginone B2	Streptomyces sp. CB02414

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000885.3	0.30	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001866.4	0.29	PKS	viriditoxin	Byssochlamys spectabilis
BGC0000603.5	0.28	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002697.3	0.26	NRPS, PKS	clipibicyclene, azabicyclene B, azabicyclene C, azabicyclene D	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000875.4	0.26	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0002039.3	0.24	other (other)	coformycin, formycin A	Nocardia interforma ATCC 21072
BGC0000914.5	0.24	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0001985.4	0.24	other (other)	Pyrazofurin	Streptomyces candidus
BGC0002282.2	0.24	other (other)	formycin A	Streptomyces kaniharaensis
BGC0002478.3	0.24	PKS	rubiginone A2, rubiginone J, rubiginone K, rubiginone L, rubiginone M, rubiginone N, ochromycinone, rubiginone B2	Streptomyces sp. CB02414

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor

NZ_KB905381.1 - Region 2 - NRP-metallophore,NRPS

Download region SVG

Location: 157,816 - 208,865 nt. (total: 51,050 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A37U_RS0106745: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

A37U_RS0106785: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

A37U_RS0106800: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0106865: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

A37U_RS0106885: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

A37U_RS0106925: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: methyltransferase

A37U_RS0106715: methyltransferase

smcogs: SMCOG1248: methyltransferase

Hydrolases: hydrolase

A37U_RS0106810: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: decarboxylase

A37U_RS48145: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Isomerases: isomerase

A37U_RS0106835: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase

A37U_RS0106805: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS42640: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.87	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000343.5	0.63	NRPS	enterobactin	Pseudomonas sp. J465
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.58	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.58	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.58	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.65	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000343.5	0.65	NRPS	enterobactin	Pseudomonas sp. J465
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000357.5	0.63	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.63	NRPS	epichloenin A	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.10 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.60 out of 29.72

Confidence: medium

Additional weak hits (7):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.86 out of 26.33

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.79 out of 32.74

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.90 out of 33.73

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.32 out of 26.33

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.86 out of 36.53

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.96 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 157815 - 208865:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0106805: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (30..431): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SASLFPLSSPGGAAQVGGAQQVFGMAEGLVNYTS
Nearest Stachelhaus code(s):: diOH-Bz PLPAQGVVNK (94% 8Å match); diOH-Bz or Sal PLPAQGVVNK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

A37U_RS42640: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (447..818): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
MexT	Global virulence regulator
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905381.1 - Region 3 - NRPS-like

Download region SVG

Location: 258,576 - 302,079 nt. (total: 43,504 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0107295: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

A37U_RS0107355: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: aminotransferase

A37U_RS0107215: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase synthase

A37U_RS0107265: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0107350: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.58	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0002496.3	0.45	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000925.5	0.45	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0001873.3	0.44	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001895.4	0.44	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000340.5	0.44	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0001850.4	0.43	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001964.2	0.43	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001909.3	0.43	PKS	strobilurin A	Strobilurus tenacellus
BGC0001215.5	0.43	NRPS	conglobatin	Streptomyces conglobatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.58	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0002496.3	0.45	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000925.5	0.45	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0001873.3	0.44	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0001895.4	0.44	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000340.5	0.44	NRPS	echoside A, echoside B, echoside C, echoside D, echoside E	Streptomyces sp. LZ35
BGC0001850.4	0.43	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001
BGC0001964.2	0.43	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001909.3	0.43	PKS	strobilurin A	Strobilurus tenacellus
BGC0001215.5	0.43	NRPS	conglobatin	Streptomyces conglobatus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.48 out of 36.53

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.54 out of 20.01

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

Additional weak hits (7):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.07 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.07 out of 30.97

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.76 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.80 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.69 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.95 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.61 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 258575 - 302079:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0107265: X

AMP-binding (85..512): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YGEMHMFGRVTSFAFSDPAL--------TAMVGS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
ArgR	Regulator of arginine biosynthesis genes
CatR	H2O2-responsive repressor
DmdR1	Iron(II)-dependent repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905381.1 - Region 4 - aminopolycarboxylic-acid

Download region SVG

Location: 901,442 - 910,873 nt. (total: 9,432 nt) Show pHMM detection rules used

Region on contig edge.

aminopolycarboxylic-acid: (AesA and AesB and AesC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0110260: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: deaminase

A37U_RS0110280: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: decarboxylase

A37U_RS0110275: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

A37U_RS0110270: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.64	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.60	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.48	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000943.5	0.37	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000188.5	0.32	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000889.5	0.32	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001071.4	0.31	NRPS, PKS	nosperin	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001592.5	0.30	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000989.3	0.29	NRPS, PKS	epothilone	Sorangium cellulosum So0157-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001587.5	0.64	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.60	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.48	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0000943.5	0.37	other (other)	staphyloferrin B	Staphylococcus aureus subsp. aureus NCTC 8325
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0000188.5	0.32	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000889.5	0.32	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0001071.4	0.31	NRPS, PKS	nosperin	Nostoc sp. 'Peltigera membranacea cyanobiont'
BGC0001592.5	0.30	other (other)	ferroverdin, bagremycin	Streptomyces lunaelactis
BGC0000989.3	0.29	NRPS, PKS	epothilone	Sorangium cellulosum So0157-2

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.47 out of 36.53

Confidence: medium

Additional weak hits (4):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.88 out of 21.84

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.81 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.25 out of 36.53

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor

NZ_KB905382.1 - Region 1 - NRPS,arylpolyene

Download region SVG

Location: 77,223 - 145,611 nt. (total: 68,389 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0110815: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS43120: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: kinase

A37U_RS0110750: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

A37U_RS43115: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: deaminase hydrolase

A37U_RS0110775: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

A37U_RS0110850: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: dehydratase

A37U_RS0110905: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

A37U_RS0110800: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0110805: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A37U_RS0110835: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS0110840: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS0110860: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS0110900: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS43125: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.84	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.82	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.81	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.78	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.77	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.77	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.73	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.71	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001825.4	0.74	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000426.5	0.71	NRPS	sevadicin	Paenibacillus larvae
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.96 out of 29.72

Confidence: medium

Additional weak hits (9):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.71 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.67 out of 30.22

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.54 out of 20.01

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.35 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.19 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.82 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.31 out of 32.74

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 77222 - 145611:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ala - D-Ser) + (D-X - Val - X - Asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 77222 - 140691:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ala - D-Ser) + (D-X - Val - X - Asp)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 104486 - 145611:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ala - D-Ser) + (D-X - Val - X - Asp)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0110800: Ala - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (463..865): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFEGSAVLAGEANIYGPTEATVYAAA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1895..2293): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFICSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

A37U_RS0110805: X - Val - X - Asp

Search NORINE for peptide: strict or relaxed

AMP-binding (453..853): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDMSTCECLLWSGGDGDGYGPAEATAFVCR
Nearest Stachelhaus code(s):: Cyc-D-Gly DAYLWGGVFK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1940..2329): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDRSFDASTYEAWLWSGGDGDGYGPTETTTFATR
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2987..3391): X

nrpys: Dpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HAKAFDISIWQCEVMVTGEVNAYGPTECSDDVTH
Nearest Stachelhaus code(s):: Dpr DIWEMTADDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4043..4416): Asp

nrpys: Asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: asp,asn (Asp, Asn)
Single AA prediction:: asp (Asp)

Stachelhaus prediction details:

Stachelhaus sequence:: YFATFDLSVTATKALLGGELNTYGPTEATVNVTQ
Nearest Stachelhaus code(s):: Asp DLTKLGVVNK (82% 8Å match); Asn DLTKLGDVNK (62% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905385.1 - Region 1 - terpene

Download region SVG

Location: 52,662 - 78,876 nt. (total: 26,215 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer

A37U_RS0113055: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0113090: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

A37U_RS0113135: flavodoxin

smcogs: SMCOG1134: flavodoxin

Ligases: synthetase

A37U_RS0113085: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.60	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000664.5	0.47	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.47	terpene	isorenieratene	Streptomyces argillaceus
BGC0000643.3	0.46	terpene	carotenoid	Brevundimonas vesicularis
BGC0000644.3	0.46	terpene	carotenoid	Dietzia sp. CQ4
BGC0000634.3	0.46	terpene	carotenoid	Brevundimonas sp. SD212

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.60	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000648.3	0.51	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000664.5	0.47	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.47	terpene	isorenieratene	Streptomyces argillaceus
BGC0000643.3	0.46	terpene	carotenoid	Brevundimonas vesicularis
BGC0000644.3	0.46	terpene	carotenoid	Dietzia sp. CQ4
BGC0000634.3	0.46	terpene	carotenoid	Brevundimonas sp. SD212

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

A37U_RS0113080: T2TS

Domain 1 (3 - 641): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

A37U_RS0113085: PT_FPPS_like

Domain 1 (50 - 332): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

A37U_RS0113095: PT_phytoene_like

Domain 1 (3 - 281): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

A37U_RS43460: PT_phytoene_like

Domain 1 (12 - 270): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.99 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description

NZ_KB905386.1 - Region 1 - lanthipeptide-class-i

Download region SVG

Location: 1 - 20,884 nt. (total: 20,884 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

A37U_RS43555: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

A37U_RS43560: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.54	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.51	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.50	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.49	ribosomal	planosporicin	Planomonospora alba
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.43	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.54	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000542.3	0.51	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.50	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000544.4	0.49	ribosomal	planosporicin	Planomonospora alba
BGC0002316.2	0.47	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.43	ribosomal	entianin	Bacillus subtilis subsp. spizizenii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for A37U_RS43555

A37U_RS51480

Leader:

MQNTLATRNRDEHDMFDLELKVVPADVQQAEASNADPS

Core:

FSSCPECSNPSWKCTPPFRR

Core with dehydrations:

FDhaDhaCysPECysDhaNPDhaWKCysDhbPPFRR

antiSMASH-DB 4.0 matches for A37U_RS51480

100.0%

NZ_KB905386.1:

Lanthipeptides: A37U_RS51480_lanthipeptide

1

FSSCPECSNPSWKCTPPFRR

20

FSSCPECSNPSWKCTPPFRR

1

FSSCPECSNPSWKCTPPFRR

20

26.7%

NZ_FNIE01000012.1:

Lanthipeptides: allorf_236282_236434_lanthipeptide

10

PSWKC-TPPFRR

20

P W+C TPPF R

5

PKWRCATPPFTR

16

23.3%

NZ_CP046956.1:

Lanthipeptides: allorf_0712042_0712206_lanthipeptide

1

FSSCPECSNPSWKCTPPFR

19

FSSC CS S + PP R

20

FSSC--CSRWSLRILPPLR

36

with 1 more sequence matches

22.5%

NZ_FQZK01000006.1and 1 other:

NZ_FQZK01000006.1 Lanthipeptides: BUE45_RS13115_lanthipeptide

Lanthipeptides: BUE45_RS13115_lanthipeptide

2

SSCPEC------SNPSWKCT

15

S CP C NP W CT

12

SLCPSCLASWAIGNPGWACT

31

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.74 out of 20.47

Confidence: medium

Additional weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.26 out of 30.22

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.38 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.46 out of 28.14

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.04 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.36 out of 28.19

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

A37U_RS51480 - Class I

Cleavage pHMM score: 3.10

RODEO score: 16

Monoisotopic mass: 2238.0 Da

Molecular weight: 2239.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2257.6 Da N = 1; 2275.6 Da N = 2

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 152 - 243; Score: 62.4

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905387.1 - Region 1 - T1PKS,T2PKS,benzoxazole

Download region SVG

Location: 1 - 72,955 nt. (total: 72,955 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)
benzoxazole: (ksIII and AMP-binding and PP-binding and Amidohydro_1)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

A37U_RS0114155: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0114180: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

A37U_RS0114185: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0114195: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

A37U_RS0114220: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0114335: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

A37U_RS0114365: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acylase aminotransferase glycosyltransferase methyltransferase

A37U_RS0114095: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

A37U_RS0114115: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

A37U_RS0114135: methyltransferase

smcogs: SMCOG1248: methyltransferase

A37U_RS0114160: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

A37U_RS0114190: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

A37U_RS43705: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: cyclase dehydratase

A37U_RS0114125: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

A37U_RS0114210: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

A37U_RS0114215: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Isomerases: racemase

A37U_RS0114295: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase synthase

A37U_RS0114205: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0114225: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A37U_RS0114230: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS0114245: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

A37U_RS0114250: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	1.09	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001273.3	0.91	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.88	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000218.5	0.88	PKS	doxorubicin	Streptomyces peucetius
BGC0001160.5	0.87	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000217.5	0.87	PKS	daunorubicin	Streptomyces sp.
BGC0001164.3	0.86	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.82	PKS	ACT-Toxin II	Alternaria alternata
BGC0002276.2	0.82	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000234.5	0.81	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.69	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000218.5	0.63	PKS	doxorubicin	Streptomyces peucetius
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000217.5	0.62	PKS	daunorubicin	Streptomyces sp.
BGC0002276.2	0.62	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0000234.5	0.61	PKS	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.95 out of 20.97

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (10):

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.55 out of 28.19

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.54 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.07 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.39 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.49 out of 20.97

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.24 out of 32.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 72955:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0114205: X

AMP-binding (24..416): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NQVL--YHLMHSYSLSGGSLQGYGLAEAAPLTHS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

A37U_RS43705: mal

PKS_AT (6..285): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 60.2
Methylmalonyl-CoA: 34.9
Propionyl-CoA: 30.0
Methoxymalonyl-CoA: 28.3
fatty_acid: 18.4
inactive: 16.0
CHC-CoA: 10.2
2-Methylbutyryl-CoA: 8.9
Ethylmalonyl-CoA: 7.5
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

A37U_RS0114250: mal - mmal

PKS_AT (526..813): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 62.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 159.3
Methoxymalonyl-CoA: 74.1
Methylmalonyl-CoA: 60.1
Propionyl-CoA: 57.7
inactive: 57.4
Ethylmalonyl-CoA: 42.0
fatty_acid: 31.7
Acetyl-CoA: 28.5
Isobutyryl-CoA: 27.1
2-Methylbutyryl-CoA: 24.7
CHC-CoA: 17.2
Benzoyl-CoA: 13.5
trans-1,2-CPDA: 9.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (1497..1791): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 190.9
Ethylmalonyl-CoA: 182.4
Methoxymalonyl-CoA: 162.7
2-Methylbutyryl-CoA: 131.4
trans-1,2-CPDA: 124.4
Propionyl-CoA: 122.0
Malonyl-CoA: 92.5
CHC-CoA: 89.9
Isobutyryl-CoA: 66.7
Benzoyl-CoA: 54.1
Acetyl-CoA: 53.4
inactive: 40.6
fatty_acid: 28.6
3-Methylbutyryl-CoA: 25.4

Type II PKS gene cluster prediction details

Cluster section:: 0 to 72340
Starter unit(s):: 2-methylbutyryl-CoA (Score: 733.0; E-value: 1.12e-159)
malonamyl-CoA (Score: 387.0; E-value: 1.17e-131)
propionyl-CoA (Score: 125.7; E-value: 4.32e-32)
acetyl-CoA (Score: 5.7; E-value: 2.8)
isobutyryl-CoA (Score: 5.7; E-value: 2.8)
butyryl-CoA (Score: 5.7; E-value: 2.8)
Malonyl elongations:: 8|9 (Score: 626.1; E-value: 4.9e-191)
Product class(es):: anthracycline
aureolic acid
tetracycline
Product molecular weight(s):: 2-methylbutyryl-CoA_8: 606 Da
2-methylbutyryl-CoA_9: 648 Da
acetyl-CoA_8: 564 Da
acetyl-CoA_9: 606 Da
butyryl-CoA_8: 592 Da
butyryl-CoA_9: 634 Da
isobutyryl-CoA_8: 592 Da
isobutyryl-CoA_9: 634 Da
malonamyl-CoA_8: 607 Da
malonamyl-CoA_9: 649 Da
propionyl-CoA_8: 578 Da
propionyl-CoA_9: 620 Da

A37U_RS0114095: MET C10 (Score: 446.3; E-value: 1.3e-136)
A37U_RS0114100: CYC C1-C18|C2-C19 (Score: 186.6; E-value: 4.3e-58)
A37U_RS0114135: MET (Score: 20.4; E-value: 5.4e-07)
A37U_RS0114155: KR (Score: 183.5; E-value: 1.3e-56)
A37U_RS0114160: GT (Score: 374.2; E-value: 2.3e-114)
A37U_RS0114175: CYC C5-C14/C3-C16 (Score: 408.0; E-value: 3.5e-125)
A37U_RS0114180: OXY (Score: 195.7; E-value: 3.4e-60)
A37U_RS0114185: KR (Score: 138.7; E-value: 6.5e-43)
A37U_RS0114190: MET C2O|C2N (Score: 406.0; E-value: 2.8e-124)
A37U_RS0114195: OXY (Score: 386.0; E-value: 6.3e-118)
A37U_RS0114205: LIG (Score: 491.1; E-value: 6.9e-150); LIG ELQ83297.1_Oxytetracycline_malonamyl-CoA (Score: 387.0; E-value: 1.17e-131)
A37U_RS0114210: CYC C7-C12 (Score: 137.4; E-value: 1.1e-42)
A37U_RS0114215: CYC C7-C12 (Score: 370.4; E-value: 1.3e-113)
A37U_RS0114220: KR C9 (Score: 428.5; E-value: 2e-131)
A37U_RS0114225: CLF 8|9 (Score: 626.1; E-value: 4.9e-191)
A37U_RS0114230: KS (Score: 732.0; E-value: 4.3e-223)
A37U_RS0114235: ACP (Score: 87.1; E-value: 1.4e-27)
A37U_RS0114245: KSIII (Score: 450.1; E-value: 1.1e-137); KSIII ADB23398.1_TLN-05220/TLN-05223_2-methylbutyryl-CoA (Score: 442.0; E-value: 1.12e-159)
A37U_RS0114250: AT (Score: 183.6; E-value: 1.1e-56); KR (Score: 36.8; E-value: 7.5e-12); AT ABC00730.1_Cosmomycin_propionyl-CoA (Score: 120.0; E-value: 4.32e-32); AT AAG30190.1_R1128_acetyl-CoA/propionyl-CoA/isobutyryl-CoA/butyryl-CoA (Score: 22.7; E-value: 2.8)
A37U_RS43705: AT (Score: 402.2; E-value: 4.1e-123); AT ADB23379.1_TLN-05220/TLN-05223_2-methylbutyryl-CoA (Score: 291.0; E-value: 7.69e-97)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
NtrC	Nitrogen regulatory protein C

NZ_KB905387.1 - Region 2 - T1PKS

Download region SVG

Location: 74,619 - 120,248 nt. (total: 45,630 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0114460: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

A37U_RS43765: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase glycosyltransferase

A37U_RS0114390: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

A37U_RS0114415: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

A37U_RS0114475: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

A37U_RS0114480: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase

A37U_RS0114420: thioesterase

smcogs: SMCOG1004: thioesterase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001258.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.04 out of 18.57

Confidence: medium

Additional weak hits (10):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.36 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.44 out of 21.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.54 out of 36.54

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.34 out of 32.93

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.53 out of 35.63

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.25 out of 35.63

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.80 out of 23.43

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 74618 - 120248:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (ccmal - Me-ccmal) + (ccemal)
Non-colinear ordering:: A37U_RS0114480 + A37U_RS0114475 + A37U_RS0114470

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0114470: emal

PKS_AT (566..863): emal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 87.5%; Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 83.3%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 197.0
Methylmalonyl-CoA: 188.4
Methoxymalonyl-CoA: 163.5
2-Methylbutyryl-CoA: 121.5
trans-1,2-CPDA: 120.4
CHC-CoA: 106.2
Isobutyryl-CoA: 101.5
Malonyl-CoA: 90.4
Propionyl-CoA: 82.6
Benzoyl-CoA: 75.1
Acetyl-CoA: 68.0
3-Methylbutyryl-CoA: 34.8
fatty_acid: 31.7
inactive: 13.3

A37U_RS0114475: mal - mmal

PKS_AT (563..854): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 209.1
inactive: 103.8
Methoxymalonyl-CoA: 78.1
Methylmalonyl-CoA: 63.8
Propionyl-CoA: 48.0
Isobutyryl-CoA: 45.3
Acetyl-CoA: 33.0
Ethylmalonyl-CoA: 27.1
fatty_acid: 24.3
2-Methylbutyryl-CoA: 20.3
Benzoyl-CoA: 20.1
CHC-CoA: 16.2
3-Methylbutyryl-CoA: 12.8
trans-1,2-CPDA: 10.4

PKS_AT (2296..2590): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 180.6
Ethylmalonyl-CoA: 176.1
Methoxymalonyl-CoA: 143.6
2-Methylbutyryl-CoA: 120.4
trans-1,2-CPDA: 100.2
Propionyl-CoA: 95.5
CHC-CoA: 90.1
Malonyl-CoA: 81.9
Benzoyl-CoA: 50.1
Isobutyryl-CoA: 45.5
Acetyl-CoA: 38.9
fatty_acid: 16.1
inactive: 12.2
3-Methylbutyryl-CoA: 8.6

A37U_RS0114480: mal

PKS_AT (563..843): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.3
inactive: 114.6
Methoxymalonyl-CoA: 51.7
Methylmalonyl-CoA: 46.0
Isobutyryl-CoA: 29.9
Propionyl-CoA: 28.6
Acetyl-CoA: 22.1
Benzoyl-CoA: 19.3
Ethylmalonyl-CoA: 17.7
CHC-CoA: 15.5
2-Methylbutyryl-CoA: 15.3
fatty_acid: 5.7
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
ToxT	Regulator of MSHA biosynthesis

NZ_KB905388.1 - Region 1 - T1PKS

Download region SVG

Location: 86,561 - 116,568 nt. (total: 30,008 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

A37U_RS0115055: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Ligases: ligase synthase

A37U_RS0115060: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

A37U_RS0115065: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

A37U_RS0114980: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.66	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.66	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (7):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.88 out of 27.55

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.90 out of 36.54

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.93 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 86560 - 116568:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0115060: pk

PKS_AT (617..910): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; Methylmalonyl-CoA: 66.7%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 107.5
Methoxymalonyl-CoA: 95.5
Ethylmalonyl-CoA: 86.4
Propionyl-CoA: 74.0
Malonyl-CoA: 73.6
Acetyl-CoA: 59.9
trans-1,2-CPDA: 58.6
CHC-CoA: 56.4
2-Methylbutyryl-CoA: 54.4
Isobutyryl-CoA: 41.5
fatty_acid: 34.6
3-Methylbutyryl-CoA: 25.5
Benzoyl-CoA: 18.0
inactive: 13.8

A37U_RS0115065: Acetyl-CoA

CAL_domain (46..488): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 35.0
AHBA: 22.1
NH2: 21.1
fatty_acid: 18.1
shikimic_acid: 9.7

TFBS definitions

Regulator	Description

NZ_KB905389.1 - Region 1 - NRPS-like

Download region SVG

Location: 86,689 - 115,048 nt. (total: 28,360 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

A37U_RS0115490: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

A37U_RS0115495: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0115515: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

A37U_RS0115520: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0115525: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Ligases: ligase

A37U_RS0115530: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0115545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.47	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002474.2	0.46	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002405.2	0.45	saccharide	mid-chain acyl sugars	Solanum lycopersicum
BGC0000231.5	0.45	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000783.3	0.43	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002212.3	0.43	PKS	Orsellinic acid	Moniliophthora roreri MCA 2997

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.47	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002474.2	0.46	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0000866.5	0.46	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0002405.2	0.45	saccharide	mid-chain acyl sugars	Solanum lycopersicum
BGC0000231.5	0.45	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000783.3	0.43	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000234.5	0.43	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0002212.3	0.43	PKS	Orsellinic acid	Moniliophthora roreri MCA 2997

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (1):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 86688 - 115048:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0115530: X

AMP-binding (11..413): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MITAHAAGVLCPFLWYGAAAQLFGQSEAPMMIST
Nearest Stachelhaus code(s):: Val DALFVGLVAK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

A37U_RS0115545: X

AMP-binding (83..513): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LRSRHVVGRAAGDF--GGDL-------GGRYVSA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905390.1 - Region 1 - terpene

Download region SVG

Location: 80,027 - 101,538 nt. (total: 21,512 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

A37U_RS0116130: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

A37U_RS0116160: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: sulfotransferase

A37U_RS0116165: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Hydrolases: hydrolase

A37U_RS0116115: isochorismatase

smcogs: SMCOG1027: isochorismatase

A37U_RS0116180: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

A37U_RS43995: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Ligases: synthetase

A37U_RS43985: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: permease

A37U_RS0116100: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001336.5	0.44	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000285.5	0.43	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002631.2	0.54	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000844.5	0.50	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001224.5	0.47	other (other)	reductasporine	uncultured bacterium
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0002103.2	0.45	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001336.5	0.44	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0000285.5	0.43	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0001485.4	0.43	other (other)	chuangxinmycin	Actinoplanes tsinanensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene			C20	C6-C11 + C10-C15	PP

Genes with terpene domains:

A37U_RS43980: T2TS

Domain 1 (2 - 495): Type 2 terpene synthase

Subtype: Diterpene synthase

Reactions:: GGPP → diterpene_C6-C11/C10-C15_PP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.31 out of 36.54

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.97 out of 32.93

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_KB905392.1 - Region 1 - nucleoside

Download region SVG

Location: 307,735 - 328,700 nt. (total: 20,966 nt) Show pHMM detection rules used

nucleoside: (LipM or LipV or LipU or TunD or pur6 or pur10 or nikJ or nikO or truD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0118395: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: back translocase

A37U_RS0118345: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Lyases: hydratase

A37U_RS0118370: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Translocases: permease

A37U_RS0118400: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000706.3	0.43	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001576.3	0.39	ribosomal	divamide A	Prochloron didemni
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002285.2	0.38	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000875.4	0.37	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0002284.3	0.35	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001076.5	0.35	other (nucleoside)	liposidomycin B, liposidomycin A, liposidomycin C, liposidomycin Z, liposidomycin H, liposidomycin G, liposidomycin L, liposidomycin M, liposidomycin K, liposidomycin N	Streptomyces sp. SN-1061M

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000706.3	0.43	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000551.5	0.42	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0001576.3	0.39	ribosomal	divamide A	Prochloron didemni
BGC0002698.2	0.39	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002285.2	0.38	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000875.4	0.37	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0002284.3	0.35	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001076.5	0.35	other (nucleoside)	liposidomycin B, liposidomycin A, liposidomycin C, liposidomycin Z, liposidomycin H, liposidomycin G, liposidomycin L, liposidomycin M, liposidomycin K, liposidomycin N	Streptomyces sp. SN-1061M

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 23.89 out of 30.11

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (5):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.07 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.81 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.04 out of 30.11

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905395.1 - Region 1 - lanthipeptide-class-i

Download region SVG

Location: 3,362 - 28,669 nt. (total: 25,308 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

A37U_RS0121900: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

A37U_RS0121905: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.49	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.47	ribosomal	planosporicin	Planomonospora alba
BGC0000540.5	0.44	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000560.5	0.43	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.40	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.49	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000544.4	0.47	ribosomal	planosporicin	Planomonospora alba
BGC0000540.5	0.44	ribosomal	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.43	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000560.5	0.43	ribosomal	subtilomycin	Bacillus subtilis
BGC0000506.4	0.42	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000559.4	0.40	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (14):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.90 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.56 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.61 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.41 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.80 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.98 out of 27.04

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.16 out of 32.74

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.58 out of 27.55

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.03 out of 26.85

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.48 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.25 out of 24.78

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 255; Score: 61.3

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905398.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 41,409 nt. (total: 41,409 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

A37U_RS0123125: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

A37U_RS0123135: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

A37U_RS44815: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: acylase

A37U_RS0123060: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase peptidase

A37U_RS0123070: thioesterase

smcogs: SMCOG1004: thioesterase

A37U_RS0123155: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

Lyases: hydratase

A37U_RS44810: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002175.3	0.64	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002175.3	0.64	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (9):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.45 out of 18.57

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.82 out of 30.25

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.75 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 25.75

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.28 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.53 out of 36.53

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.59 out of 36.54

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.13 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 41409:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal - Me-ohmal - Me-ohmal) + (ohmal)
Non-colinear ordering:: A37U_RS0123060 + A37U_RS53025

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS53025: mal - mal

PKS_AT (556..843): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 166.8
inactive: 77.1
Methoxymalonyl-CoA: 59.1
Methylmalonyl-CoA: 54.1
fatty_acid: 29.8
Isobutyryl-CoA: 28.3
Propionyl-CoA: 27.0
Acetyl-CoA: 26.8
Benzoyl-CoA: 24.7
Ethylmalonyl-CoA: 24.3
trans-1,2-CPDA: 13.3
CHC-CoA: 10.0
2-Methylbutyryl-CoA: 8.9
3-Methylbutyryl-CoA: 0.0

PKS_AT (2046..2334): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 158.3
inactive: 86.2
Methoxymalonyl-CoA: 72.4
Methylmalonyl-CoA: 60.1
Ethylmalonyl-CoA: 30.4
Isobutyryl-CoA: 28.6
Propionyl-CoA: 27.4
Acetyl-CoA: 23.7
fatty_acid: 22.7
trans-1,2-CPDA: 22.4
Benzoyl-CoA: 15.0
CHC-CoA: 12.1
2-Methylbutyryl-CoA: 8.9
3-Methylbutyryl-CoA: 0.0

A37U_RS0123060: mmal - mmal - mmal

PKS_AT (571..861): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Malonyl-CoA: 75.0%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 175.6
Ethylmalonyl-CoA: 147.9
Methoxymalonyl-CoA: 140.6
2-Methylbutyryl-CoA: 116.3
trans-1,2-CPDA: 98.0
CHC-CoA: 95.6
Malonyl-CoA: 91.5
Propionyl-CoA: 88.7
Isobutyryl-CoA: 56.1
3-Methylbutyryl-CoA: 43.3
Benzoyl-CoA: 42.1
inactive: 33.6
Acetyl-CoA: 33.2
fatty_acid: 23.1

PKS_AT (2095..2394): mmal

ATSignature: Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 177.5
Ethylmalonyl-CoA: 169.8
Methoxymalonyl-CoA: 149.6
2-Methylbutyryl-CoA: 124.2
trans-1,2-CPDA: 106.0
Propionyl-CoA: 91.4
CHC-CoA: 83.1
Malonyl-CoA: 75.8
Isobutyryl-CoA: 52.0
Benzoyl-CoA: 46.3
Acetyl-CoA: 38.4
3-Methylbutyryl-CoA: 30.6
inactive: 24.8
fatty_acid: 14.1

PKS_AT (3632..3922): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 178.5
Ethylmalonyl-CoA: 147.5
Methoxymalonyl-CoA: 143.8
2-Methylbutyryl-CoA: 127.9
CHC-CoA: 104.6
Malonyl-CoA: 98.7
Propionyl-CoA: 94.3
trans-1,2-CPDA: 90.6
Isobutyryl-CoA: 58.6
Benzoyl-CoA: 56.1
inactive: 44.5
3-Methylbutyryl-CoA: 40.9
Acetyl-CoA: 35.6
fatty_acid: 14.8

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905399.1 - Region 1 - RiPP-like

Download region SVG

Location: 9,299 - 20,105 nt. (total: 10,807 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

A37U_RS48485: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000045.3	0.24	PKS	dehydrocurvularin	Aspergillus terreus
BGC0001882.3	0.22	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0002104.3	0.21	NRPS, PKS	eurocidin D, eurocidin E	Streptomyces eurocidicus ATCC 27428
BGC0001021.5	0.21	NRPS, PKS	mycobactin	Mycobacterium tuberculosis H37Rv
BGC0000274.5	0.21	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0001540.5	0.19	other (other)	CC-1065	Streptomyces zelensis
BGC0001533.5	0.19	PKS	borrelidin	Streptomyces rochei
BGC0000065.5	0.19	PKS	rustmicin	Streptomyces galbus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000045.3	0.24	PKS	dehydrocurvularin	Aspergillus terreus
BGC0001882.3	0.22	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0002104.3	0.21	NRPS, PKS	eurocidin D, eurocidin E	Streptomyces eurocidicus ATCC 27428
BGC0001021.5	0.21	NRPS, PKS	mycobactin	Mycobacterium tuberculosis H37Rv
BGC0000274.5	0.21	PKS	tetarimycin A, tetarimycin B	uncultured bacterium
BGC0001540.5	0.19	other (other)	CC-1065	Streptomyces zelensis
BGC0001533.5	0.19	PKS	borrelidin	Streptomyces rochei
BGC0000065.5	0.19	PKS	rustmicin	Streptomyces galbus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (1):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.81 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KB905401.1 - Region 1 - redox-cofactor

Download region SVG

Location: 15,696 - 38,450 nt. (total: 22,755 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0124040: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0124100: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0124130: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Lyases: dehydratase

A37U_RS0124030: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: synthase

A37U_RS0124055: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001534.3	0.65	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001535.3	0.63	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000706.3	0.49	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001633.3	0.45	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002147.2	0.45	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0001628.4	0.42	NRPS	JBIR-78, JBIR-95	Kibdelosporangium sp. AK-AA56
BGC0001567.4	0.41	NRPS	cysteoamide	Streptomyces lincolnensis
BGC0000111.5	0.41	PKS	neocarzilin A, neocarzilin B	Streptomyces carzinostaticus
BGC0001850.4	0.41	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001534.3	0.65	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0001535.3	0.63	other (other)	branched-chain fatty acids	Streptomyces filamentosus
BGC0002276.2	0.52	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000706.3	0.49	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001633.3	0.45	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002147.2	0.45	NRPS	bohemamine A, bohemamine B, bohemamine C	Streptomyces sp. CB02009
BGC0001628.4	0.42	NRPS	JBIR-78, JBIR-95	Kibdelosporangium sp. AK-AA56
BGC0001567.4	0.41	NRPS	cysteoamide	Streptomyces lincolnensis
BGC0000111.5	0.41	PKS	neocarzilin A, neocarzilin B	Streptomyces carzinostaticus
BGC0001850.4	0.41	other (shikimate-derived)	diazaquinomycin A, diazaquinomycin E, diazaquinomycin F, diazaquinomycin G	Streptomyces sp. F001

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (2):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.37 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.76 out of 27.04

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Mycofactocin_RRE; Location: 10 - 90; Score: 92.8

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_KB905403.1 - Region 1 - T1PKS,hglE-KS

Download region SVG

Location: 255,502 - 306,296 nt. (total: 50,795 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
hglE-KS: (hglE or hglD)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase methyltransferase

A37U_RS0126020: methyltransferase

smcogs: SMCOG1089: methyltransferase

A37U_RS0126025: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Hydrolases: hydrolase

A37U_RS0125990: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

A37U_RS0126030: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

A37U_RS0126105: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Isomerases: racemase

A37U_RS0125980: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

A37U_RS0126060: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase

A37U_RS0126045: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS45320: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.58	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.58	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.57	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.51	PKS	FR901512	fungal sp. No.14919
BGC0002648.2	0.44	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.44	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0001268.4	0.44	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.62	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.62	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.62	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002192.3	0.59	PKS	FR901512	fungal sp. No.14919
BGC0002648.2	0.55	PKS	eicosapentaenoic acid	Shewanella sp. N2AIL
BGC0000861.5	0.55	other (other)	eicosapentaenoic acid	Shewanella sp. BR-2
BGC0001268.4	0.55	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.96 out of 23.79

Confidence: medium

Additional weak hits (13):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.71 out of 32.74

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.28 out of 31.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.96 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.21 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.83 out of 32.74

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.80 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.77 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.91 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.82 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.78 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.91 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 255501 - 306296:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mxmal) + (mal)
Non-colinear ordering:: A37U_RS45320 + A37U_RS0126035 + A37U_RS0126045

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 255501 - 299632:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mxmal) + (mal)
Non-colinear ordering:: A37U_RS45320 + A37U_RS0126035 + A37U_RS0126045

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 259639 - 306296:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mxmal) + (mal)
Non-colinear ordering:: A37U_RS45320 + A37U_RS0126035 + A37U_RS0126045

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS45320: mxmal

PKS_AT (604..816): mxmal

ATSignature: (unknown)

No matches above 50%

minowa: Methoxymalonyl-CoA

Prediction, score:

Methoxymalonyl-CoA: 13.5
Methylmalonyl-CoA: 5.3
Malonyl-CoA: 2.1
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

A37U_RS0126045: mal

PKS_AT (1172..1464): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 58.3%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 64.9
Methylmalonyl-CoA: 36.1
Methoxymalonyl-CoA: 35.9
Ethylmalonyl-CoA: 31.0
trans-1,2-CPDA: 21.3
Propionyl-CoA: 19.6
inactive: 18.6
2-Methylbutyryl-CoA: 12.2
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism

NZ_KB905407.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 45,232 nt. (total: 45,232 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0128640: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0128650: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Hydrolases: esterase phosphatase

A37U_RS0128630: thioesterase

smcogs: SMCOG1004: thioesterase

A37U_RS0128635: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: synthase

A37U_RS0128655: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS0128660: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS0128665: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS45775: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

Similar subclusters

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 45232:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal - redmal) + (redmal - ccmal) + (ohmal)
Non-colinear ordering:: A37U_RS45775 + A37U_RS0128665 + A37U_RS0128660

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0128655: mal

PKS_AT (533..831): mal

ATSignature: Malonyl-CoA, inactive

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 70.8%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 81.9
inactive: 48.5
Methoxymalonyl-CoA: 45.0
Methylmalonyl-CoA: 27.3
Propionyl-CoA: 18.4
Ethylmalonyl-CoA: 16.0
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

A37U_RS0128660: mal

PKS_AT (563..836): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 213.1
inactive: 103.8
Methoxymalonyl-CoA: 72.4
Methylmalonyl-CoA: 59.1
Propionyl-CoA: 29.6
Isobutyryl-CoA: 22.4
Ethylmalonyl-CoA: 21.6
Acetyl-CoA: 20.3
Benzoyl-CoA: 17.6
2-Methylbutyryl-CoA: 13.8
CHC-CoA: 13.6
trans-1,2-CPDA: 11.9
fatty_acid: 9.3
3-Methylbutyryl-CoA: 5.1

A37U_RS0128665: mal - mal

PKS_AT (558..850): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 62.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 176.3
inactive: 89.2
Methoxymalonyl-CoA: 61.9
Methylmalonyl-CoA: 49.0
Isobutyryl-CoA: 33.6
Ethylmalonyl-CoA: 26.1
fatty_acid: 25.2
Propionyl-CoA: 23.8
Benzoyl-CoA: 20.5
Acetyl-CoA: 14.6
CHC-CoA: 9.9
trans-1,2-CPDA: 9.4
2-Methylbutyryl-CoA: 6.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (2586..2855): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.1
inactive: 85.4
Methylmalonyl-CoA: 55.9
Methoxymalonyl-CoA: 53.2
Isobutyryl-CoA: 31.6
Benzoyl-CoA: 23.2
Propionyl-CoA: 20.8
Ethylmalonyl-CoA: 14.0
Acetyl-CoA: 13.6
fatty_acid: 11.6
CHC-CoA: 10.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

A37U_RS45775: mal - mal

PKS_AT (0..250): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 70.8%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 160.7
inactive: 96.8
Methylmalonyl-CoA: 60.8
Methoxymalonyl-CoA: 59.1
Isobutyryl-CoA: 36.1
Ethylmalonyl-CoA: 35.6
Benzoyl-CoA: 31.7
Propionyl-CoA: 24.3
trans-1,2-CPDA: 23.6
Acetyl-CoA: 23.1
2-Methylbutyryl-CoA: 16.8
CHC-CoA: 16.0
fatty_acid: 14.7
3-Methylbutyryl-CoA: 0.0

PKS_AT (1626..1905): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 214.4
inactive: 108.2
Methoxymalonyl-CoA: 55.2
Methylmalonyl-CoA: 51.4
Propionyl-CoA: 25.6
Acetyl-CoA: 22.2
Isobutyryl-CoA: 21.5
Benzoyl-CoA: 19.7
CHC-CoA: 14.8
fatty_acid: 12.2
Ethylmalonyl-CoA: 10.9
trans-1,2-CPDA: 9.5
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

NZ_KB905409.1 - Region 1 - NRPS-like,T1PKS

Download region SVG

Location: 1 - 38,352 nt. (total: 38,352 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0128965: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0128975: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: acylase

A37U_RS52025: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: phosphatase

A37U_RS0128960: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Ligases: ligase synthase

A37U_RS45840: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS53155: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001135.5	0.55	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.54	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.62	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.10 out of 36.54

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.56 out of 31.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.47 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 0 - 38352:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Me-mal - redmal) + (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 0 - 36396:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Me-mal - redmal) + (Me-redmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS45840: X

AMP-binding (423..814): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWSVFDVAGNSLFLVVIGEVNCYGPTEITVVMTA
Nearest Stachelhaus code(s):: Pro DVQFVAHVVK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

A37U_RS53155: mmal - mal

PKS_AT (533..824): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 176.5
Ethylmalonyl-CoA: 149.6
Methoxymalonyl-CoA: 149.1
2-Methylbutyryl-CoA: 137.4
CHC-CoA: 104.3
Propionyl-CoA: 101.6
Malonyl-CoA: 101.4
trans-1,2-CPDA: 88.8
Isobutyryl-CoA: 58.7
Benzoyl-CoA: 50.9
inactive: 39.9
3-Methylbutyryl-CoA: 37.7
Acetyl-CoA: 37.1
fatty_acid: 24.8

PKS_AT (1514..1790): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.6
inactive: 73.3
Methoxymalonyl-CoA: 62.9
Methylmalonyl-CoA: 55.6
Isobutyryl-CoA: 30.7
Propionyl-CoA: 29.2
Acetyl-CoA: 23.8
fatty_acid: 23.3
Ethylmalonyl-CoA: 20.1
Benzoyl-CoA: 17.0
trans-1,2-CPDA: 16.6
2-Methylbutyryl-CoA: 16.2
CHC-CoA: 16.0
3-Methylbutyryl-CoA: 0.0

A37U_RS52025: mmal

PKS_AT (1225..1524): mmal

ATSignature: Methoxymalonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Methoxymalonyl-CoA: 83.3%; Methylmalonyl-CoA: 83.3%; Ethylmalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 178.1
Ethylmalonyl-CoA: 170.9
Methoxymalonyl-CoA: 151.4
2-Methylbutyryl-CoA: 109.4
trans-1,2-CPDA: 107.0
Propionyl-CoA: 94.3
Malonyl-CoA: 88.6
Isobutyryl-CoA: 71.8
CHC-CoA: 65.2
Benzoyl-CoA: 58.8
Acetyl-CoA: 50.1
inactive: 48.5
3-Methylbutyryl-CoA: 33.4
fatty_acid: 12.0

TFBS definitions

Regulator	Description

NZ_KB905411.1 - Region 1 - RiPP-like

Download region SVG

Location: 23,601 - 34,416 nt. (total: 10,816 nt) Show pHMM detection rules used

Region on contig edge.

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

No matches found.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

Additional weak hits (4):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.03 out of 26.85

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.06 out of 29.51

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NZ_KB905413.1 - Region 1 - betalactone

Download region SVG

Location: 7,875 - 30,431 nt. (total: 22,557 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

A37U_RS0129685: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

A37U_RS0129695: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Ligases: ligase synthase

A37U_RS0129700: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0129705: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001809.3	0.43	other (other)	trans-aconitic acid	Bacillus thuringiensis serovar chinensis CT-43
BGC0000927.3	0.42	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0000252.5	0.40	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0000843.5	0.39	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001806.4	0.39	NRPS	tolaasin A	Pseudomonas tolaasii
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae
BGC0001959.4	0.36	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0002036.4	0.36	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0002152.2	0.36	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001302.5	0.36	other (other)	lomofungin	Streptomyces lomondensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001809.3	0.43	other (other)	trans-aconitic acid	Bacillus thuringiensis serovar chinensis CT-43
BGC0000927.3	0.42	other (flavin)	roseoflavin	Streptomyces davaonensis JCM 4913
BGC0000252.5	0.40	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0000843.5	0.39	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate	Streptomyces clavuligerus ATCC 27064
BGC0001806.4	0.39	NRPS	tolaasin A	Pseudomonas tolaasii
BGC0000929.3	0.38	other (other)	xanthothricin	Burkholderia glumae
BGC0001959.4	0.36	other (other)	taylorflavin A, taylorflavin B	Streptomyces hiroshimensis
BGC0002036.4	0.36	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0002152.2	0.36	other (other)	toxoflavin	Pseudomonas protegens Pf-5
BGC0001302.5	0.36	other (other)	lomofungin	Streptomyces lomondensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.95 out of 29.72

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.35 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.95 out of 28.19

Confidence: medium

Additional weak hits (5):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.78 out of 27.04

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.07 out of 32.74

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.84 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.01 out of 32.93

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.58 out of 27.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
MexT	Global virulence regulator
NtrC	Nitrogen regulatory protein C
ZuR variant 1	Zinc-responsive repressor

NZ_KB905414.1 - Region 1 - NRPS

Download region SVG

Location: 253,567 - 303,712 nt. (total: 50,146 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0131070: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0131075: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0131080: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

A37U_RS0131085: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

A37U_RS0131095: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

A37U_RS0131215: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Hydrolases: amidase esterase

A37U_RS0131055: amidase

smcogs: SMCOG1105: amidase

A37U_RS0131170: putative esterase

smcogs: SMCOG1104: putative esterase

Lyases: dehydratase hydratase

A37U_RS0131065: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A37U_RS0131090: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A37U_RS46260: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase

A37U_RS0131100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0131175: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS46265: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: permease

A37U_RS0131040: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.73	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.59 out of 23.05

Confidence: medium

Additional weak hits (15):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.78 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.44 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.86 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.11 out of 26.85

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.58 out of 28.14

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.25 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.47 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.31 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.28 out of 26.33

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.70 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.88 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.35 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.39 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 253566 - 303712:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Lys - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0131100: X

AMP-binding (44..455): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AGLVHTGFAFGLFGVIAGACPAWGLTECSIMSSA
Nearest Stachelhaus code(s):: S-bohPhe or dhPhe DGWFLAAVMK (32% 8Å match); Ph-Ser or Phe DAFTVAAIWK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

A37U_RS46265: X - Lys - X

Search NORINE for peptide: strict or relaxed

AMP-binding (459..855): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHQAFDA-YWDLGTFIGGEVNLYGPTETCVDAVT
Nearest Stachelhaus code(s):: Arg DPWGFGLVDK (56% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1511..1898): Lys

nrpys: Lys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LNHSFDAAWDPWETAVGGEVNMYGPTETCVDAVF
Nearest Stachelhaus code(s):: Lys DADDAGTVDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2546..2943): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LQHAFDASWDPWEVTVGGEQNYYGPTETCVNAMA
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (74% 8Å match); OH-Orn DAQEGGLVDK (71% 8Å match); Lys DADDAGTVDK (62% 8Å match)
Stachelhaus code match:: 60% (weak)

A37U_RS0131175: X

AMP-binding (14..415): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: WHVLHTNALNAQYLALAPAVDGFGATETNMVIGA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905417.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 24,628 nt. (total: 24,628 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0132345: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

A37U_RS0132335: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

A37U_RS0132340: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.66	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000041.3	0.69	PKS	oronofacic acid	Pseudomonas syringae
BGC0000067.5	0.66	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 24628:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ccmal) + (ohmal) + (redmal - ccmal)
Non-colinear ordering:: A37U_RS0132335 + A37U_RS0132340 + A37U_RS0132345

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0132335: mal

PKS_AT (1353..1612): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 171.4
inactive: 90.6
Methylmalonyl-CoA: 62.9
Methoxymalonyl-CoA: 55.8
Ethylmalonyl-CoA: 34.2
Benzoyl-CoA: 33.3
Isobutyryl-CoA: 30.1
Propionyl-CoA: 24.9
trans-1,2-CPDA: 22.6
Acetyl-CoA: 19.7
fatty_acid: 18.1
CHC-CoA: 16.5
2-Methylbutyryl-CoA: 15.7
3-Methylbutyryl-CoA: 0.0

A37U_RS0132340: mal

PKS_AT (557..822): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; inactive: 66.7%; Propionyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.3
inactive: 77.4
Methoxymalonyl-CoA: 70.5
Methylmalonyl-CoA: 59.2
Propionyl-CoA: 45.3
Isobutyryl-CoA: 37.2
Acetyl-CoA: 36.8
Benzoyl-CoA: 36.3
Ethylmalonyl-CoA: 32.8
fatty_acid: 32.0
CHC-CoA: 22.7
trans-1,2-CPDA: 22.2
2-Methylbutyryl-CoA: 20.8
3-Methylbutyryl-CoA: 10.2

A37U_RS0132345: mal - mal

PKS_AT (560..844): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 75.0%; Propionyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 205.5
inactive: 98.8
Methoxymalonyl-CoA: 59.5
Methylmalonyl-CoA: 50.0
Propionyl-CoA: 29.6
Ethylmalonyl-CoA: 25.8
Isobutyryl-CoA: 22.7
Acetyl-CoA: 16.4
fatty_acid: 14.4
Benzoyl-CoA: 14.1
CHC-CoA: 10.1
2-Methylbutyryl-CoA: 7.4
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2524..2799): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 70.8%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 184.9
inactive: 93.9
Methylmalonyl-CoA: 63.2
Methoxymalonyl-CoA: 59.3
Isobutyryl-CoA: 36.5
Ethylmalonyl-CoA: 34.8
trans-1,2-CPDA: 28.7
Benzoyl-CoA: 28.1
Propionyl-CoA: 21.9
Acetyl-CoA: 19.4
CHC-CoA: 13.3
2-Methylbutyryl-CoA: 10.1
fatty_acid: 9.1
3-Methylbutyryl-CoA: 0.0

NZ_KB905421.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 18,927 nt. (total: 18,927 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0132690: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

A37U_RS0132685: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000143.5	0.67	PKS	salinomycin	Streptomyces albus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0000067.5	0.62	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000143.5	0.67	PKS	salinomycin	Streptomyces albus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0000067.5	0.62	PKS	geldanamycin	Streptomyces hygroscopicus subsp. duamyceticus
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002175.3	0.60	PKS	YWA1	Aspergillus oryzae RIB40
BGC0002154.2	0.60	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 18927:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (Me-ohmal - Me-ohmal)
Non-colinear ordering:: A37U_RS0132685 + A37U_RS0132690

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0132685: mal

PKS_AT (1200..1488): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 70.8%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 166.0
inactive: 87.7
Methoxymalonyl-CoA: 70.3
Methylmalonyl-CoA: 59.9
Isobutyryl-CoA: 38.2
fatty_acid: 32.7
Ethylmalonyl-CoA: 30.3
Propionyl-CoA: 24.6
Benzoyl-CoA: 21.8
Acetyl-CoA: 19.1
trans-1,2-CPDA: 13.3
CHC-CoA: 7.1
2-Methylbutyryl-CoA: 6.9
3-Methylbutyryl-CoA: 0.0

A37U_RS0132690: mmal - mmal - mal

PKS_AT (563..852): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Methoxymalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 188.0
Ethylmalonyl-CoA: 158.9
Methoxymalonyl-CoA: 154.3
2-Methylbutyryl-CoA: 139.5
Malonyl-CoA: 101.5
trans-1,2-CPDA: 100.3
Propionyl-CoA: 99.5
CHC-CoA: 98.3
Isobutyryl-CoA: 59.7
Benzoyl-CoA: 54.3
3-Methylbutyryl-CoA: 44.5
Acetyl-CoA: 41.1
inactive: 36.4
fatty_acid: 21.0

PKS_AT (2067..2357): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 83.3%; Methoxymalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 171.4
Methoxymalonyl-CoA: 149.3
Ethylmalonyl-CoA: 144.0
2-Methylbutyryl-CoA: 118.7
CHC-CoA: 91.8
Propionyl-CoA: 91.7
trans-1,2-CPDA: 90.2
Malonyl-CoA: 85.6
Isobutyryl-CoA: 49.3
Benzoyl-CoA: 39.6
3-Methylbutyryl-CoA: 35.5
Acetyl-CoA: 33.2
inactive: 31.0
fatty_acid: 16.8

PKS_AT (3590..3878): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 158.3
inactive: 86.2
Methoxymalonyl-CoA: 72.4
Methylmalonyl-CoA: 60.1
Ethylmalonyl-CoA: 30.4
Isobutyryl-CoA: 28.6
Propionyl-CoA: 27.4
Acetyl-CoA: 23.7
fatty_acid: 22.7
trans-1,2-CPDA: 22.4
Benzoyl-CoA: 15.0
CHC-CoA: 12.1
2-Methylbutyryl-CoA: 8.9
3-Methylbutyryl-CoA: 0.0

NZ_KB905425.1 - Region 1 - T1PKS

Download region SVG

Location: 426,650 - 453,413 nt. (total: 26,764 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0135315: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS53245: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase kinase

A37U_RS0135370: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

A37U_RS46905: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Lyases: hydratase

A37U_RS0135360: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: ligase synthase

A37U_RS0135320: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A37U_RS0135375: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000867.3	0.48	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002749.2	0.46	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0002404.2	0.45	other (other)	falcarindiol	Solanum lycopersicum
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000043.5	0.42	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.42	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0001987.2	0.42	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000867.3	0.48	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002749.2	0.46	NRPS, PKS	aspcandine	Aspergillus candidus
BGC0002404.2	0.45	other (other)	falcarindiol	Solanum lycopersicum
BGC0000888.5	0.45	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.43	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000043.5	0.42	PKS	curacin A	Moorea producens 19L
BGC0000122.5	0.42	PKS	phenylnannolone A, phenylnannolone B, phenylnannolone C	Nannocystis pusilla
BGC0001987.2	0.42	PKS	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.23 out of 27.78

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.50 out of 24.78

Confidence: medium

Additional weak hits (9):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.05 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.56 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.83 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.99 out of 32.93

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.05 out of 24.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.30 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.36 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.65 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

A37U_RS0135370: pk

PKS_AT (52..247): pk

ATSignature: (unknown)

No matches above 50%

minowa: CHC-CoA

Prediction, score:

CHC-CoA: 9.4
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

A37U_RS0135375: X

AMP-binding (5..365): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FNMLHQYGISMIDACSGAALDSYGSTENLAFATL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905433.1 - Region 1 - lanthipeptide-class-i

Download region SVG

Location: 1 - 9,184 nt. (total: 9,184 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS47060: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase dehydratase

A37U_RS0135860: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

A37U_RS47065: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.50	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000541.5	0.49	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.48	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000544.4	0.48	ribosomal	planosporicin	Planomonospora alba
BGC0000515.4	0.44	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000560.5	0.43	ribosomal	subtilomycin	Bacillus subtilis
BGC0000507.5	0.42	ribosomal	epicidin	Staphylococcus epidermidis
BGC0001727.3	0.41	ribosomal	paenilan	Paenibacillus polymyxa E681

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.76	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.50	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.50	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000541.5	0.49	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.48	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000544.4	0.48	ribosomal	planosporicin	Planomonospora alba
BGC0000515.4	0.44	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000560.5	0.43	ribosomal	subtilomycin	Bacillus subtilis
BGC0000507.5	0.42	ribosomal	epicidin	Staphylococcus epidermidis
BGC0001727.3	0.41	ribosomal	paenilan	Paenibacillus polymyxa E681

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (3):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.07 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.50 out of 30.98

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 142 - 235; Score: 50.5

TFBS definitions

Regulator	Description

NZ_KB905436.1 - Region 1 - aminopolycarboxylic-acid,betalactone,lanthipeptide-class-i

Download region SVG

Location: 108,869 - 161,740 nt. (total: 52,872 nt) Show pHMM detection rules used

aminopolycarboxylic-acid: (AesA and AesB and AesC)
betalactone: (HMGL-like and AMP-binding)
lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0136585: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: aminotransferase

A37U_RS0136530: aminotransferase

smcogs: SMCOG1019: aminotransferase

A37U_RS0136590: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: deaminase

A37U_RS0136550: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

Lyases: cyclase decarboxylase dehydratase hydratase

A37U_RS0136520: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A37U_RS0136545: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

A37U_RS0136635: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A37U_RS0136640: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

A37U_RS0136645: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A37U_RS0136710: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

A37U_RS0136755: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

A37U_RS47190: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Ligases: ligase synthase

A37U_RS0136540: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A37U_RS0136630: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

A37U_RS0136650: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.45	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001587.5	0.31	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001727.3	0.26	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000506.4	0.25	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0000515.4	0.25	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000559.4	0.25	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0002568.2	0.24	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0000846.5	0.23	other (other)	tabtoxin	Pseudomonas syringae
BGC0000511.5	0.23	ribosomal	ericin S	Bacillus subtilis
BGC0001289.5	0.21	ribosomal	penisin	Paenibacillus ehimensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001587.5	0.66	other (other)	ethylenediaminesuccinic acid hydroxyarginine (EDHA)	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0002568.2	0.63	other (other)	Ethylenediaminesuccinic acid hydroxyarginine	Streptomyces scabiei 87.22
BGC0002567.2	0.57	other (other)	EDHA	Streptomyces sp. MA5143a
BGC0001289.5	0.54	ribosomal	penisin	Paenibacillus ehimensis
BGC0000541.5	0.53	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.53	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001160.5	0.52	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002316.2	0.50	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000852.5	0.48	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for A37U_RS0136710

A37U_RS52320

Leader:

MTAALETPSAPRLDTELDHFDLDARIVLNPDELRPV

Core:

NLSTDTHLTQCTSCPTIC

Core with dehydrations:

NLDhaDhbDDhbHLDhbQCysDhbDhaCysPDhbICys

antiSMASH-DB 4.0 matches for A37U_RS52320

100.0%

NZ_KB905436.1:

Lanthipeptides: A37U_RS52320_lanthipeptide

1

NLSTDTHLTQCTSCPTIC

18

NLSTDTHLTQCTSCPTIC

1

NLSTDTHLTQCTSCPTIC

18

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (6):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.60 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.81 out of 29.65

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.55 out of 27.04

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.32 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.77 out of 28.19

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

A37U_RS52320 - Class I

Cleavage pHMM score: -1.80

RODEO score: 18

Monoisotopic mass: 1810.8 Da

Molecular weight: 1812.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 1830.0 Da N = 1; 1848.1 Da N = 2; 1866.1 Da N = 3; 1884.1 Da N = 4

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 155 - 247; Score: 58.7

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NZ_KB905447.1 - Region 1 - NRPS

Download region SVG

Location: 6,386 - 74,594 nt. (total: 68,209 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

A37U_RS0137760: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

A37U_RS0137875: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

A37U_RS0137910: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: deacetylase dehalogenase esterase

A37U_RS0137745: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

A37U_RS0137790: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

A37U_RS0137845: thioesterase

smcogs: SMCOG1004: thioesterase

A37U_RS0137865: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: hydratase

A37U_RS0137885: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Isomerases: mutase

A37U_RS0137765: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase

A37U_RS0137835: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

A37U_RS47455: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS47460: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.73	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001133.4	0.73	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002071.2	0.73	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (8):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.38 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.39 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.21 out of 21.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.36 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.51 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.07 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.83 out of 29.65

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.24 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 6385 - 74594:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ala - Thr - Ser - D-Ser) + (Ala - Gly - D-Phe) + (Ile)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS47455: Ala - Thr - Ser - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (458..843): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFDICAALAGEANIYGPTEACVYATA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (85% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1488..1887): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LACHFDFSVWEGSQIFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWSIGMVHK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2539..2931): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3588..3980): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFFCSGEFNLYGPTEAAVDVTW
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

A37U_RS47460: Ala - Gly - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (444..826): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LWATFDVSVFDVCAALAGEANIYGPTEACVYASA
Nearest Stachelhaus code(s):: Ala DVFSVAIVYK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1475..1850): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDISVLEGQALVGGETNLYGPTETTIWSTM
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2471..2856): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LVQAFDAMFWEATLVVAGELNGYGPTETTVAVSV
Nearest Stachelhaus code(s):: Phe DAWTFAGVAK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

A37U_RS0137835: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (440..816): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHIAFDASVLELFLLLGGELNVYGPTETTVFSLT
Nearest Stachelhaus code(s):: Ile DALFMGVVFK (50% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB905447.1 - Region 2 - lanthipeptide-class-v

Download region SVG

Location: 169,168 - 211,062 nt. (total: 41,895 nt) Show pHMM detection rules used

lanthipeptide-class-v: (APH and HopA1)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase peptidase

A37U_RS0138485: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

A37U_RS0138550: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: cyclase

A37U_RS47515: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: synthase

A37U_RS0138515: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

A37U_RS0138520: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Translocases: permease

A37U_RS0138375: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000016.4	0.43	other (other)	amphotericin B	Streptomyces nodosus
BGC0002130.3	0.42	ribosomal	cacaoidin	Streptomyces cacaoi CA-170360
BGC0001387.5	0.41	other (other)	nucleocidin	Streptomyces calvus
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000204.5	0.39	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002064.2	0.38	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0000821.5	0.37	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0000877.5	0.36	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0000197.5	0.36	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000896.5	0.36	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000016.4	0.43	other (other)	amphotericin B	Streptomyces nodosus
BGC0002130.3	0.42	ribosomal	cacaoidin	Streptomyces cacaoi CA-170360
BGC0001387.5	0.41	other (other)	nucleocidin	Streptomyces calvus
BGC0001294.5	0.40	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0000204.5	0.39	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002064.2	0.38	ribosomal	felipeptin A2, felipeptin A1	Amycolatopsis sp. YIM 10
BGC0000821.5	0.37	other (other)	rebeccamycin	Lechevalieria aerocolonigenes
BGC0000877.5	0.36	other (other)	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0000197.5	0.36	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0000896.5	0.36	other (other)	cycloserine	Streptomyces lavendulae subsp. lavendulae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (9):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.29 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.62 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.91 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.55 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.51 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.70 out of 28.19

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.69 out of 27.04

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.49 out of 32.93

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

No core peptides found.

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production

NZ_KB905458.1 - Region 1 - ectoine

Download region SVG

Location: 93,734 - 104,126 nt. (total: 10,393 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

A37U_RS0139625: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

A37U_RS0139640: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000857.3	0.68	other (other)	ectoine	Methylophaga alcalica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000854.3	0.65	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.81	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.81	other (ectoine)	ectoine	Streptomyces sp.
BGC0000859.3	0.72	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000857.3	0.68	other (other)	ectoine	Methylophaga alcalica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000854.3	0.65	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.55 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.29 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.49 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KB905458.1 - Region 2 - PKS-like

Download region SVG

Location: 171,318 - 212,370 nt. (total: 41,053 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase decarboxylase

A37U_RS0140085: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

A37U_RS47705: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

A37U_RS47715: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

Ligases: synthase

A37U_RS0140075: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

A37U_RS0140120: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000883.5	0.52	other (other)	arginomycin	Streptomyces arginensis
BGC0001778.5	0.43	other (other)	showdomycin	Streptomyces showdoensis
BGC0001314.3	0.39	terpene	tirucalla	Arabidopsis thaliana
BGC0001387.5	0.36	other (other)	nucleocidin	Streptomyces calvus
BGC0000914.5	0.36	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0000847.4	0.36	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0000197.5	0.35	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0002370.2	0.35	NRPS	zelkovamycin B, zelkovamycin C, zelkovamycin D, zelkovamycin E	Actinomadura graeca
BGC0002443.3	0.35	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0002499.2	0.35	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000883.5	0.52	other (other)	arginomycin	Streptomyces arginensis
BGC0001778.5	0.43	other (other)	showdomycin	Streptomyces showdoensis
BGC0001314.3	0.39	terpene	tirucalla	Arabidopsis thaliana
BGC0001387.5	0.36	other (other)	nucleocidin	Streptomyces calvus
BGC0000914.5	0.36	other (other)	methylenomycin A	Streptomyces coelicolor A3(2)
BGC0000847.4	0.36	other (non-nrp beta-lactam)	thienamycin	Streptomyces cattleya
BGC0000197.5	0.35	PKS, saccharide	aranciamycin	Streptomyces echinatus
BGC0002370.2	0.35	NRPS	zelkovamycin B, zelkovamycin C, zelkovamycin D, zelkovamycin E	Actinomadura graeca
BGC0002443.3	0.35	PKS	mycemycin C, mycemycin A, mycemycin B	Streptomyces olivaceus
BGC0002499.2	0.35	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.69 out of 36.53

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.86 out of 18.57

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.49 out of 28.19

Confidence: medium

Additional weak hits (13):

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.17 out of 27.04

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.02 out of 39.62

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.47 out of 27.78

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.45 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.72 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.39 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.79 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.66 out of 29.65

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.90 out of 18.57

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.83 out of 26.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.86 out of 26.85

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_KB905458.1 - Region 3 - lanthipeptide-class-i

Download region SVG

Location: 258,550 - 276,736 nt. (total: 18,187 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase dehydratase

A37U_RS0140460: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

A37U_RS0140465: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.45	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000544.4	0.40	ribosomal	planosporicin	Planomonospora alba
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001727.3	0.39	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000529.5	0.38	ribosomal	microbisporicin A2	Microbispora corallina

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0001289.5	0.45	ribosomal	penisin	Paenibacillus ehimensis
BGC0002635.2	0.44	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000544.4	0.40	ribosomal	planosporicin	Planomonospora alba
BGC0000514.5	0.40	ribosomal	gallidermin	Staphylococcus gallinarum
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001727.3	0.39	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000529.5	0.38	ribosomal	microbisporicin A2	Microbispora corallina

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.41 out of 27.55

Confidence: medium

Additional weak hits (9):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.13 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.94 out of 36.54

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.09 out of 20.01

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.58 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.51 out of 27.55

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.63 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.54 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.49 out of 28.19

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 158 - 240; Score: 56.6

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes

NZ_KB905465.1 - Region 1 - NAPAA,NRP-metallophore,NRPS,betalactone

Download region SVG

Location: 54,839 - 135,077 nt. (total: 80,239 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)
betalactone: (HMGL-like and AMP-binding)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

A37U_RS0140895: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

A37U_RS0140945: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

A37U_RS0141000: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

A37U_RS0141025: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

A37U_RS0141050: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: PPTase acyltransferase carboxylase formyltransferase methyltransferase

A37U_RS0140930: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

A37U_RS0140960: methyltransferase

smcogs: SMCOG1248: methyltransferase

A37U_RS0141020: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

A37U_RS0141030: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

A37U_RS47825: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

A37U_RS47865: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Isomerases: mutase

A37U_RS0140830: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

A37U_RS0141070: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase

A37U_RS0140905: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0140940: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

A37U_RS0141100: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	1.39	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	1.28	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	1.14	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002174.2	0.95	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001050.5	0.91	NRPS, PKS	thalassospiramide A	Tistrella bauzanensis
BGC0002071.2	0.85	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0000342.4	0.83	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.82	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.81	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.78	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.77	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.71	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.70	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (17):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.82 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.77 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.61 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.12 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.90 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.42 out of 29.38

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.35 out of 39.62

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 20.69 out of 36.54

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.97 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.19 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.41 out of 36.53

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.97 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.46 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.19 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 54838 - 135077:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X - Ser - NMe-X - X - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 54838 - 93528:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 77951 - 135077:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Ser - NMe-X - X - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

A37U_RS0140905: X

AMP-binding (43..416): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

A37U_RS0140940: X

AMP-binding (13..418): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HSGMHVGGSSYIFLGYGASIHVYGMTEMGGVVTS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

A37U_RS0141020: X - Ser - X - X - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (157..559): X

nrpys: Fo-OH-Orn, Ac-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDVAFWDLILLAGTEFNAYGPTEATVNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWILGATNK (97% 8Å match); Ac-OH-Orn DVWALGAVNK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1225..1598): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFFCSGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHFSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2251..2658): X

nrpys: Fo-OH-Orn, Ac-OH-Orn

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTQAFDVAFWDLILLAGTEFNAYGPTEATVNSTL
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWILGATNK (97% 8Å match); Ac-OH-Orn DVWALGAVNK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3679..4066): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RALSFIDGSTEGTVVTSGEVNLYGCSELAGDSLG
Nearest Stachelhaus code(s):: me-bAla LDTTVSLGDK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4706..5093): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDASWQPWELGIGGEYNLYGPTEATVDALV
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

A37U_RS0141100: X

AMP-binding (65..503): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AWSVYIV----AFTFLAGEIDHWWQTETGWAIAA
Nearest Stachelhaus code(s):: pPro DVQFSAHGAK (32% 8Å match)
Stachelhaus code match:: 60% (weak)