GCF_000373305.1 - 40 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_KB890915.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RRE-containing	503,651	523,944
Region 1.2	RRE-containing	526,373	547,095

NZ_KB890916.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 2.1	linaridin,T1PKS	12,630	115,576	High	bafilomycin B1	PKS:Type I
Region 2.2	t3nrps-iterative,NRPS,T1PKS,RiPP-like	154,653	220,941	High	10-epi-HSAF/10-epi-3-deOH-HSAF/10-epi-maltophilin/10-epi-xanthobaccin C/10-epi-hydroxymaltophilin/10-epi-FI-2	other:other+PKS
Region 2.3	NRPS,T2PKS,PKS-like,other,oligosaccharide	247,571	376,500	Medium	cinerubin B	PKS:Type II
Region 2.4	NRPS,RiPP-like	396,659	460,688	High	valinomycin/montanastatin	saccharide:hybrid/tailoring+NRPS:Type I
Region 2.5	melanin,terpene-precursor	461,400	490,163	High	melanin	other:other
Region 2.6	T3PKS,NRPS	504,763	607,731	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 2.7	terpene	704,174	732,592	High	isorenieratene	terpene
Region 2.8	NRPS,T1PKS,azole-containing-RiPP	741,755	788,939	Low	lactazole	ribosomal:RiPP:Thiopeptide

NZ_KB890918.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 4.1	ectoine	125,998	136,396	High	ectoine	other:other

NZ_KB890919.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 5.1	NI-siderophore	100,062	132,797	Low	kinamycin	PKS

NZ_KB890921.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 7.1	NRPS-like	117,554	161,537	High	minimycin/indigoidine	NRPS:Type I+saccharide

NZ_KB890923.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 9.1	NI-siderophore	48,997	78,775	High	desferrioxamin B	other:other
Region 9.2	lanthipeptide-class-iii,lanthipeptide-class-ii	125,889	157,431

NZ_KB890924.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 10.1	T2PKS	1	41,473	Low	prejadomycin/rabelomycin/gaudimycin C/gaudimycin D/UWM6/gaudimycin A	PKS:Type II+saccharide:hybrid/tailoring
Region 10.2	lassopeptide	98,537	121,333	High	keywimysin	ribosomal:RiPP

NZ_KB890925.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 11.1	terpene-precursor	1	12,761
Region 11.2	lanthipeptide-class-iii	136,325	150,395	High	AmfS	ribosomal:RiPP:Lanthipeptide

NZ_KB890926.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 12.1	lanthipeptide-class-i,NRPS	50,598	124,830

NZ_KB890927.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 13.1	ectoine,butyrolactone	263,723	279,107	Low	showdomycin	other:other
Region 13.2	betalactone	386,410	414,177

NZ_KB890930.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 16.1	terpene	67,631	88,725	Low	steffimycin D	PKS:Type II+saccharide:hybrid/tailoring

NZ_KB890938.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 24.1	lanthipeptide-class-i	93,139	118,407

NZ_KB890945.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 31.1	arylpolyene,NRPS-like	1	31,545
Region 31.2	butyrolactone	41,350	52,219	Low	coelimycin P1	PKS:Type I
Region 31.3	terpene	80,372	102,585	High	geosmin	terpene:Sesquiterpene
Region 31.4	transAT-PKS,PKS-like,T1PKS,NRPS,NRP-metallophore,terpene	105,329	241,057	High	griseobactin	NRPS:Type I
Region 31.5	NRP-metallophore,NRPS,terpene	242,054	310,912	High	coelichelin	NRPS:Type I
Region 31.6	NRPS,T1PKS	349,709	400,453	Low	Bisenarsan	PKS:Type I
Region 31.7	T3PKS	406,986	448,119

NZ_KB890946.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 32.1	NRPS,NRPS-like	111,646	158,647
Region 32.2	RiPP-like	286,179	297,669	Low	14-hydroxyisochainin	PKS:Modular type I
Region 32.3	lanthipeptide-class-i	350,511	375,954
Region 32.4	NRPS,hydrogen-cyanide	417,435	461,319

NZ_KB890947.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 33.1	terpene	280,610	307,183	Medium	hopene	terpene
Region 33.2	thioamide-NRP	334,857	366,432	Low	cadaside A/cadaside B	NRPS:Type I

NZ_KB890948.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 34.1	terpene	199,867	220,844

NZ_KB890950.1 (Streptomyces sp. CcalMP-8W)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 36.1	t3nrps-iterative,RRE-containing,azole-containing-RiPP,ectoine	105,228	173,964
Region 36.2	thioamide-NRP,PKS-like,t3nrps-iterative,T1PKS	215,760	282,726	Low	enteromycin	PKS+NRPS:Type I

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	RRE-containing	503,651	523,944
Region 1.2	RRE-containing	526,373	547,095
Region 2.1	linaridin,T1PKS	12,630	115,576	High	bafilomycin B1	PKS:Type I
Region 2.2	t3nrps-iterative,NRPS,T1PKS,RiPP-like	154,653	220,941	High	10-epi-HSAF/10-epi-3-deOH-HSAF/10-epi-maltophilin/10-epi-xanthobaccin C/10-epi-hydroxymaltophilin/10-epi-FI-2	other:other+PKS
Region 2.3	NRPS,T2PKS,PKS-like,other,oligosaccharide	247,571	376,500	Medium	cinerubin B	PKS:Type II
Region 2.4	NRPS,RiPP-like	396,659	460,688	High	valinomycin/montanastatin	saccharide:hybrid/tailoring+NRPS:Type I
Region 2.5	melanin,terpene-precursor	461,400	490,163	High	melanin	other:other
Region 2.6	T3PKS,NRPS	504,763	607,731	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 2.7	terpene	704,174	732,592	High	isorenieratene	terpene
Region 2.8	NRPS,T1PKS,azole-containing-RiPP	741,755	788,939	Low	lactazole	ribosomal:RiPP:Thiopeptide
Region 4.1	ectoine	125,998	136,396	High	ectoine	other:other
Region 5.1	NI-siderophore	100,062	132,797	Low	kinamycin	PKS
Region 7.1	NRPS-like	117,554	161,537	High	minimycin/indigoidine	NRPS:Type I+saccharide
Region 9.1	NI-siderophore	48,997	78,775	High	desferrioxamin B	other:other
Region 9.2	lanthipeptide-class-iii,lanthipeptide-class-ii	125,889	157,431
Region 10.1	T2PKS	1	41,473	Low	prejadomycin/rabelomycin/gaudimycin C/gaudimycin D/UWM6/gaudimycin A	PKS:Type II+saccharide:hybrid/tailoring
Region 10.2	lassopeptide	98,537	121,333	High	keywimysin	ribosomal:RiPP
Region 11.1	terpene-precursor	1	12,761
Region 11.2	lanthipeptide-class-iii	136,325	150,395	High	AmfS	ribosomal:RiPP:Lanthipeptide
Region 12.1	lanthipeptide-class-i,NRPS	50,598	124,830
Region 13.1	ectoine,butyrolactone	263,723	279,107	Low	showdomycin	other:other
Region 13.2	betalactone	386,410	414,177
Region 16.1	terpene	67,631	88,725	Low	steffimycin D	PKS:Type II+saccharide:hybrid/tailoring
Region 24.1	lanthipeptide-class-i	93,139	118,407
Region 31.1	arylpolyene,NRPS-like	1	31,545
Region 31.2	butyrolactone	41,350	52,219	Low	coelimycin P1	PKS:Type I
Region 31.3	terpene	80,372	102,585	High	geosmin	terpene:Sesquiterpene
Region 31.4	transAT-PKS,PKS-like,T1PKS,NRPS,NRP-metallophore,terpene	105,329	241,057	High	griseobactin	NRPS:Type I
Region 31.5	NRP-metallophore,NRPS,terpene	242,054	310,912	High	coelichelin	NRPS:Type I
Region 31.6	NRPS,T1PKS	349,709	400,453	Low	Bisenarsan	PKS:Type I
Region 31.7	T3PKS	406,986	448,119
Region 32.1	NRPS,NRPS-like	111,646	158,647
Region 32.2	RiPP-like	286,179	297,669	Low	14-hydroxyisochainin	PKS:Modular type I
Region 32.3	lanthipeptide-class-i	350,511	375,954
Region 32.4	NRPS,hydrogen-cyanide	417,435	461,319
Region 33.1	terpene	280,610	307,183	Medium	hopene	terpene
Region 33.2	thioamide-NRP	334,857	366,432	Low	cadaside A/cadaside B	NRPS:Type I
Region 34.1	terpene	199,867	220,844
Region 36.1	t3nrps-iterative,RRE-containing,azole-containing-RiPP,ectoine	105,228	173,964
Region 36.2	thioamide-NRP,PKS-like,t3nrps-iterative,T1PKS	215,760	282,726	Low	enteromycin	PKS+NRPS:Type I

No secondary metabolite regions were found in these records:: NZ_KB890917.1 (Streptomyces sp. CcalMP-8W); NZ_KB890920.1 (Streptomyces sp. CcalMP-8W); NZ_KB890922.1 (Streptomyces sp. CcalMP-8W); NZ_KB890928.1 (Streptomyces sp. CcalMP-8W); NZ_KB890929.1 (Streptomyces sp. CcalMP-8W); NZ_KB890931.1 (Streptomyces sp. CcalMP-8W); NZ_KB890932.1 (Streptomyces sp. CcalMP-8W); NZ_KB890933.1 (Streptomyces sp. CcalMP-8W); NZ_KB890934.1 (Streptomyces sp. CcalMP-8W); NZ_KB890935.1 (Streptomyces sp. CcalMP-8W); NZ_KB890936.1 (Streptomyces sp. CcalMP-8W); NZ_KB890937.1 (Streptomyces sp. CcalMP-8W); NZ_KB890939.1 (Streptomyces sp. CcalMP-8W); NZ_KB890940.1 (Streptomyces sp. CcalMP-8W); NZ_KB890941.1 (Streptomyces sp. CcalMP-8W); NZ_KB890942.1 (Streptomyces sp. CcalMP-8W); NZ_KB890943.1 (Streptomyces sp. CcalMP-8W); NZ_KB890944.1 (Streptomyces sp. CcalMP-8W); NZ_KB890949.1 (Streptomyces sp. CcalMP-8W)

Compact view

NZ_KB890915.1 - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 503,651 - 523,944 nt. (total: 20,294 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase transferase

B053_RS0102200: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

B053_RS0102255: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase

B053_RS0102195: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.56	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.56	NRPS	epichloenin A	Epichloe festucae
BGC0001261.3	0.56	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000595.3	0.50	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000903.3	0.49	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000597.4	0.45	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000933.3	0.45	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0001137.5	0.45	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001166.5	0.56	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.56	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.56	NRPS	epichloenin A	Epichloe festucae
BGC0001261.3	0.56	NRPS	AM-toxin	Alternaria alternata
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000595.3	0.50	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000903.3	0.49	other (other)	fluorometabolite	Streptomyces cattleya
BGC0000597.4	0.45	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000933.3	0.45	other (other)	xiamenmycin A	Streptomyces xiamenensis
BGC0001137.5	0.45	other (other)	marinacarboline A, marinacarboline B, marinacarboline C, marinacarboline D	Marinactinospora thermotolerans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.02 out of 28.19

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.87 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.76 out of 27.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.85 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.66 out of 26.85

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.44 out of 24.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.09 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.08 out of 28.19

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: PqqD_RRE; Location: 11 - 93; Score: 34.1; RRE type: Stand_Alone_Lasso_RRE; Location: 38 - 94; Score: 31.4

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_KB890915.1 - Region 2 - RRE-containing

Download region GenBank file

Download region SVG

Location: 526,373 - 547,095 nt. (total: 20,723 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0102275: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.49	ribosomal	microcin C7	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001863.4	0.39	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000517.4	0.37	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0002382.3	0.37	ribosomal	grimoviridin	Grimontia marina
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000571.3	0.37	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0000557.5	0.37	ribosomal	streptococcin A-FF22	Streptococcus pyogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000585.5	0.49	ribosomal	microcin C7	Escherichia coli
BGC0002306.2	0.43	ribosomal	freyrasin	Paenibacillus polymyxa ATCC 842
BGC0000504.5	0.40	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001639.3	0.40	ribosomal	klebsidin	Klebsiella pneumoniae
BGC0001863.4	0.39	ribosomal, terpene	bacillicn CER074	Bacillus mycoides
BGC0000517.4	0.37	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0002382.3	0.37	ribosomal	grimoviridin	Grimontia marina
BGC0000885.3	0.37	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0000571.3	0.37	ribosomal	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0000557.5	0.37	ribosomal	streptococcin A-FF22	Streptococcus pyogenes

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.63 out of 28.19

Confidence: medium

Additional weak hits (9):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.54 out of 31.73

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.70 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.24 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.08 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.43 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.23 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.72 out of 26.85

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 23.72 out of 30.12

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Pantocin_Microcin_RRE; Location: 1 - 88; Score: 53.5

TFBS definitions

Regulator	Description
ZuR variant 1	Zinc-responsive repressor

NZ_KB890916.1 - Region 1 - T1PKS,linaridin

Download region GenBank file

Download region SVG

Location: 12,630 - 115,576 nt. (total: 102,947 nt) Show pHMM detection rules used

linaridin: (cypemycin or cypI)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0103820: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

B053_RS0103830: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acylase methyltransferase

B053_RS0103755: methyltransferase

smcogs: SMCOG1248: methyltransferase

B053_RS0103795: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B053_RS0103860: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase phosphatase

B053_RS0103835: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

B053_RS0103850: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

B053_RS01000000133440: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B053_RS0103780: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0103785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0103790: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

B053_RS0103800: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B053_RS0103805: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B053_RS0103815: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000028.5	0.79	PKS	bafilomycin B1	Streptomyces lohii
BGC0002193.2	0.54	other (other)	phenguignardic acid	Aspergillus terreus NIH2624
BGC0001160.5	0.51	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001641.4	0.51	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001164.3	0.51	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0000357.5	0.48	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.48	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.48	NRPS	epichloenin A	Epichloe festucae
BGC0001273.3	0.42	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.41	PKS	(-)-Mellein	Parastagonospora nodorum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000028.5	0.90	PKS	bafilomycin B1	Streptomyces lohii
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001348.5	0.71	PKS	JBIR-100	Streptomyces varsoviensis
BGC0000041.3	0.68	PKS	oronofacic acid	Pseudomonas syringae
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.81 out of 23.79

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.08 out of 25.31

Confidence: medium

Additional weak hits (11):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.17 out of 27.04

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.43 out of 36.54

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.52 out of 24.78

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.25 out of 36.54

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.11 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.73 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 32.93

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 14.85 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 12629 - 115576:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ohmal - ohmal - Me-mal) + (Me-ohmal - ohemal - ccmal) + (pk - Me-redmal) + (pk - Me-ccmal) + (Me-ccmal)
Non-colinear ordering:: B053_RS0103795 + B053_RS0103800 + B053_RS0103805 + B053_RS01000000133440 + B053_RS0103815

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 15407 - 115576:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-mal - Me-ohmal - ohmal - Me-mal) + (Me-ohmal - ohemal - ccmal) + (pk - Me-redmal) + (pk - Me-ccmal) + (Me-ccmal)
Non-colinear ordering:: B053_RS0103795 + B053_RS0103800 + B053_RS0103805 + B053_RS01000000133440 + B053_RS0103815

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0103780: X

AMP-binding (10..416): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NTTLHTFGICGTMGFSGGALEGYGLTETSPVVAY
Nearest Stachelhaus code(s):: nLev GFCMYGGCSK (74% 8Å match)
Stachelhaus code match:: 60% (weak)

B053_RS0103785: X

AMP-binding (15..418): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -ARLHSSGATADLLTYVGSIQVYATSEAGFVSML
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

B053_RS0103795: mmal - mmal - mal - mmal

PKS_AT (99..398): mmal

ATSignature: Isobutyryl-CoA

Top 3 matches:: Isobutyryl-CoA: 79.2%; Methoxymalonyl-CoA: 70.8%; Methylmalonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 162.6
Ethylmalonyl-CoA: 159.2
2-Methylbutyryl-CoA: 152.6
Methoxymalonyl-CoA: 134.5
Propionyl-CoA: 131.4
CHC-CoA: 98.8
Isobutyryl-CoA: 88.1
Malonyl-CoA: 87.4
trans-1,2-CPDA: 83.7
Benzoyl-CoA: 52.2
3-Methylbutyryl-CoA: 31.3
Acetyl-CoA: 28.6
inactive: 22.5
fatty_acid: 17.7

PKS_AT (1117..1411): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.2
Ethylmalonyl-CoA: 199.8
Methoxymalonyl-CoA: 171.8
2-Methylbutyryl-CoA: 153.8
trans-1,2-CPDA: 136.0
Propionyl-CoA: 117.9
CHC-CoA: 101.1
Malonyl-CoA: 92.6
Benzoyl-CoA: 87.1
Isobutyryl-CoA: 84.1
Acetyl-CoA: 51.1
fatty_acid: 43.8
3-Methylbutyryl-CoA: 34.7
inactive: 27.1

PKS_AT (2778..3092): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 231.1
inactive: 116.5
Methoxymalonyl-CoA: 72.2
Methylmalonyl-CoA: 58.7
Propionyl-CoA: 44.4
Isobutyryl-CoA: 32.7
Ethylmalonyl-CoA: 20.4
Acetyl-CoA: 19.0
2-Methylbutyryl-CoA: 16.0
Benzoyl-CoA: 15.8
CHC-CoA: 12.2
fatty_acid: 9.2
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (4453..4749): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Malonyl-CoA: 87.5%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 196.2
Ethylmalonyl-CoA: 192.2
Methoxymalonyl-CoA: 161.4
2-Methylbutyryl-CoA: 130.8
trans-1,2-CPDA: 118.9
Propionyl-CoA: 104.5
CHC-CoA: 97.2
Isobutyryl-CoA: 78.1
Malonyl-CoA: 77.7
Benzoyl-CoA: 70.8
Acetyl-CoA: 43.6
3-Methylbutyryl-CoA: 35.4
fatty_acid: 29.6
inactive: 27.0

B053_RS0103800: mmal - emal - mal

PKS_AT (578..878): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 218.9
Ethylmalonyl-CoA: 213.0
Methoxymalonyl-CoA: 176.5
2-Methylbutyryl-CoA: 165.0
trans-1,2-CPDA: 129.9
Propionyl-CoA: 116.7
CHC-CoA: 102.6
Malonyl-CoA: 97.9
Benzoyl-CoA: 79.1
Isobutyryl-CoA: 78.2
Acetyl-CoA: 60.5
3-Methylbutyryl-CoA: 42.0
fatty_acid: 39.4
inactive: 32.7

PKS_AT (2156..2454): emal

ATSignature: Ethylmalonyl-CoA, Methylmalonyl-CoA, Methoxymalonyl-CoA

Top 3 matches:: Ethylmalonyl-CoA: 95.8%; Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 95.8%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 218.6
Methylmalonyl-CoA: 204.9
Methoxymalonyl-CoA: 185.5
trans-1,2-CPDA: 139.6
2-Methylbutyryl-CoA: 137.0
Malonyl-CoA: 100.3
Propionyl-CoA: 97.4
CHC-CoA: 94.1
Isobutyryl-CoA: 65.6
Benzoyl-CoA: 64.0
Acetyl-CoA: 35.8
3-Methylbutyryl-CoA: 28.8
inactive: 27.1
fatty_acid: 25.6

PKS_AT (3841..4136): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Methylbutyryl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.6
inactive: 103.0
Methoxymalonyl-CoA: 64.2
Methylmalonyl-CoA: 60.6
Propionyl-CoA: 41.1
Ethylmalonyl-CoA: 36.7
Acetyl-CoA: 24.7
Isobutyryl-CoA: 24.3
CHC-CoA: 22.4
2-Methylbutyryl-CoA: 19.9
Benzoyl-CoA: 13.8
fatty_acid: 10.8
trans-1,2-CPDA: 10.6
3-Methylbutyryl-CoA: 0.0

B053_RS0103805: pk - mmal

PKS_AT (612..910): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 232.4
Methylmalonyl-CoA: 228.7
Methoxymalonyl-CoA: 193.5
2-Methylbutyryl-CoA: 181.4
trans-1,2-CPDA: 154.0
Propionyl-CoA: 125.3
Malonyl-CoA: 122.5
CHC-CoA: 122.5
Benzoyl-CoA: 80.2
Isobutyryl-CoA: 75.4
Acetyl-CoA: 42.9
3-Methylbutyryl-CoA: 42.2
fatty_acid: 37.6
inactive: 33.7

PKS_AT (2394..2688): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 212.9
Ethylmalonyl-CoA: 206.2
Methoxymalonyl-CoA: 174.4
2-Methylbutyryl-CoA: 156.6
trans-1,2-CPDA: 126.0
Propionyl-CoA: 119.7
CHC-CoA: 103.6
Malonyl-CoA: 97.3
Isobutyryl-CoA: 88.0
Benzoyl-CoA: 72.1
Acetyl-CoA: 59.9
fatty_acid: 43.7
3-Methylbutyryl-CoA: 36.7
inactive: 32.4

B053_RS01000000133440: pk - mmal

PKS_AT (694..993): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 219.6
Methylmalonyl-CoA: 219.0
Methoxymalonyl-CoA: 184.8
2-Methylbutyryl-CoA: 154.2
trans-1,2-CPDA: 122.5
Propionyl-CoA: 114.4
CHC-CoA: 111.7
Malonyl-CoA: 107.3
Isobutyryl-CoA: 83.1
Benzoyl-CoA: 71.1
Acetyl-CoA: 55.1
3-Methylbutyryl-CoA: 54.3
inactive: 39.2
fatty_acid: 38.3

PKS_AT (2286..2580): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 216.5
Ethylmalonyl-CoA: 207.1
Methoxymalonyl-CoA: 176.8
2-Methylbutyryl-CoA: 155.1
trans-1,2-CPDA: 133.0
Propionyl-CoA: 114.4
CHC-CoA: 101.2
Malonyl-CoA: 93.8
Isobutyryl-CoA: 86.8
Benzoyl-CoA: 84.7
Acetyl-CoA: 54.1
3-Methylbutyryl-CoA: 41.2
fatty_acid: 38.7
inactive: 26.9

B053_RS0103815: mmal

PKS_AT (574..869): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Methoxymalonyl-CoA: 87.5%; Ethylmalonyl-CoA: 83.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 200.1
Ethylmalonyl-CoA: 183.2
Methoxymalonyl-CoA: 169.2
2-Methylbutyryl-CoA: 153.7
trans-1,2-CPDA: 128.5
Propionyl-CoA: 113.7
Malonyl-CoA: 102.8
CHC-CoA: 94.2
Isobutyryl-CoA: 70.8
Benzoyl-CoA: 63.7
fatty_acid: 56.4
Acetyl-CoA: 35.2
3-Methylbutyryl-CoA: 33.2
inactive: 26.8

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB890916.1 - Region 2 - NRPS,RiPP-like,T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 154,653 - 220,941 nt. (total: 66,289 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

B053_RS0104060: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

B053_RS0104140: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B053_RS0104145: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B053_RS0104150: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

B053_RS0104155: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B053_RS0104180: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

B053_RS0104225: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

B053_RS0104235: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase

B053_RS0104125: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Lyases: decarboxylase

B053_RS0104210: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: synthase

B053_RS0104135: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport transporter

B053_RS0104075: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

B053_RS0104285: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002365.2	2.28	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001043.4	1.93	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001244.3	1.36	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	1.36	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	1.35	PKS	asperlactone	Aspergillus ochraceus
BGC0000996.5	1.33	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001726.4	1.12	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0002509.3	1.07	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001132.4	1.02	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.02	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002365.2	0.91	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001043.4	0.86	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001244.3	0.76	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0000996.5	0.75	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001726.4	0.70	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0002509.3	0.69	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001556.5	0.68	NRPS, PKS	combamide	Streptomyces sp.
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.92 out of 20.47

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.16 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.16 out of 30.11

Confidence: medium

Additional weak hits (18):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.74 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.68 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.28 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.84 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.85 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.66 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.11 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.25 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.72 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.61 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.01 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.94 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.15 out of 33.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.85 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 154652 - 220941:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0104135: pk - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (549..845): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; CE-Malonyl-CoA: 58.3%; Acetyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 124.8
Methoxymalonyl-CoA: 115.8
Malonyl-CoA: 113.5
Ethylmalonyl-CoA: 108.0
Isobutyryl-CoA: 89.4
Propionyl-CoA: 74.6
Acetyl-CoA: 72.8
trans-1,2-CPDA: 70.9
2-Methylbutyryl-CoA: 65.9
Benzoyl-CoA: 61.1
CHC-CoA: 51.0
fatty_acid: 37.7
inactive: 32.8
3-Methylbutyryl-CoA: 31.3

AMP-binding (2301..2713): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAFDVFTGDREFVVGSDVNSYGLTEATIDSAC
Nearest Stachelhaus code(s):: Orn DVGEVGSIDK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB890916.1 - Region 3 - NRPS,PKS-like,T2PKS,oligosaccharide,other

Download region GenBank file

Download region SVG

Location: 247,571 - 376,500 nt. (total: 128,930 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T2PKS: (t2ks and t2clf)
PKS-like: (t2pks2 or ksIII)
other: (Neocarzinostat or bcpB or frbD or mitE or prnB or CaiA or bacilysin or orf2_PTase)
oligosaccharide: (repeatable(3, [DUF1205, Glyco_transf_28, Glycos_transf_1, Glycos_transf_2, MGT]) and minscore(MGT, 150))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase oxygenase

B053_RS0104550: Dioxygenase TauD/TfdA

smcogs: SMCOG1046: Dioxygenase TauD/TfdA

B053_RS0104660: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

B053_RS0104695: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

B053_RS0104705: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

B053_RS0104740: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B053_RS0104780: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B053_RS0104820: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B053_RS0104865: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B053_RS0104870: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B053_RS0104945: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: PPTase acylase acyltransferase aminotransferase carbamoyltransferase formyltransferase glycosyltransferase methyltransferase transferase

B053_RS0104525: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B053_RS0104530: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

B053_RS0104545: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

B053_RS0104685: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

B053_RS0104690: methyltransferase

smcogs: SMCOG1089: methyltransferase

B053_RS0104715: methyltransferase

smcogs: SMCOG1248: methyltransferase

B053_RS0104730: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B053_RS0104745: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

B053_RS0104760: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B053_RS0104770: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B053_RS0104775: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B053_RS0104795: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B053_RS0104815: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B053_RS0104840: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

B053_RS0104845: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

B053_RS0104850: methyltransferase

smcogs: SMCOG1248: methyltransferase

B053_RS0104875: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

B053_RS0104895: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

B053_RS0104925: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

Hydrolases: deacetylase deaminase hydrolase

B053_RS0104445: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

B053_RS0104575: ornithine cyclodeaminase

smcogs: SMCOG1158: ornithine cyclodeaminase

B053_RS0104750: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase dehydratase

B053_RS01000000133495: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B053_RS0104490: diguanylate cyclase

smcogs: SMCOG1025: diguanylate cyclase

B053_RS0104700: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

B053_RS0104735: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

B053_RS0104835: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Isomerases: mutase

B053_RS0104930: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

B053_RS0104520: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B053_RS0104540: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0104580: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

B053_RS0104665: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B053_RS0104670: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

B053_RS0104680: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Translocases: transporter

B053_RS0104600: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	1.35	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000231.5	1.26	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000217.5	1.17	PKS	daunorubicin	Streptomyces sp.
BGC0000234.5	1.14	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000218.5	1.12	PKS	doxorubicin	Streptomyces peucetius
BGC0001723.5	0.98	PKS	oviedomycin	Streptomyces antibioticus
BGC0002000.4	0.88	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0002135.2	0.83	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000272.3	0.83	PKS	spore pigment	Streptomyces collinus
BGC0001197.5	0.82	PKS	frankiamicin	Frankia sp. EAN1pec

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.75	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.73	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.92 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.57 out of 36.53

Confidence: medium

Additional weak hits (19):

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.98 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.37 out of 21.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.58 out of 32.74

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.06 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.56 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.23 out of 29.38

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.08 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.07 out of 27.04

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.06 out of 23.43

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.72 out of 32.74

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.77 out of 33.14

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 21.12 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 247570 - 376500:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Ser - X) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 7, location 247570 - 310056:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Ser - X) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 276943 - 349429:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X) + (Ser - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0104520: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (479..880): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDPSLMELQALSGGEWDLYGPTETTVWSTT
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

B053_RS0104540: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (508..903): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFVCSGEHNLYGPTEAAVDVTH
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1560..1949): X

nrpys: Leu, Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDESFDASAFEGFLLTGGDSNMYGPTECTTFATG
Nearest Stachelhaus code(s):: Leu or Ile DAFFLGMTFK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

B053_RS0104545: X - X

AMP-binding (479..879): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWSTFDASLWESQLSSAGESNTYGPTECSIDSTA
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (65% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1559..1958): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HVASFDVSMEQAETNLSSDVCCYGPTEATVTCLL
Nearest Stachelhaus code(s):: Arg DVEEIGAITK (44% 8Å match); Ahp DVENAGVVTK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

B053_RS0104685: mal

PKS_AT (3..290): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 49.5
Methylmalonyl-CoA: 32.7
Methoxymalonyl-CoA: 31.2
fatty_acid: 14.8
Propionyl-CoA: 13.8
inactive: 11.1
2-Methylbutyryl-CoA: 10.2
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

Type II PKS gene cluster prediction details

Cluster section:: 276943 to 349429
Starter unit(s):: propionyl-CoA (Score: 875.0; E-value: 8.92e-179)
Malonyl elongations:: 8|9 (Score: 628.2; E-value: 1.2e-191)
Product class(es):: anthracycline
Product molecular weight(s):: propionyl-CoA_8: 1476 Da
propionyl-CoA_9: 1518 Da

B053_RS0104665: KS (Score: 718.4; E-value: 5.9e-219)
B053_RS0104670: CLF 8|9 (Score: 628.2; E-value: 1.2e-191)
B053_RS0104675: ACP (Score: 97.3; E-value: 9.1e-31)
B053_RS0104680: KSIII (Score: 523.1; E-value: 7.2e-160); KSIII ABC00733.1_Cosmomycin_propionyl-CoA (Score: 489.0; E-value: 8.92e-179)
B053_RS0104685: AT (Score: 444.1; E-value: 7.2e-136); AT BAB72049.1_Aklavinone_propionyl-CoA (Score: 386.0; E-value: 4.85e-138)
B053_RS0104690: MET carboxy_O (Score: 381.9; E-value: 2.9e-117)
B053_RS0104730: GT (Score: 444.4; E-value: 1.1e-135)
B053_RS0104735: CYC C7-C12 (Score: 466.0; E-value: 1.1e-142)
B053_RS0104740: KR C9 (Score: 467.5; E-value: 2.5e-143)
B053_RS0104745: MET (Score: 271.0; E-value: 3.1e-83)
B053_RS0104760: GT (Score: 290.0; E-value: 8.9e-89)
B053_RS0104770: GT (Score: 443.5; E-value: 2e-135)
B053_RS0104775: GT (Score: 447.6; E-value: 1.2e-136)
B053_RS0104795: GT (Score: 423.7; E-value: 2.1e-129)
B053_RS0104815: GT (Score: 459.2; E-value: 3.4e-140)
B053_RS0104820: KR C17 (Score: 388.3; E-value: 3.2e-119)
B053_RS0104830: CYC C2-C19 (Score: 245.1; E-value: 4e-76)

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_KB890916.1 - Region 4 - NRPS,RiPP-like

Download region GenBank file

Download region SVG

Location: 396,659 - 460,688 nt. (total: 64,030 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

B053_RS0105120: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Hydrolases: esterase

B053_RS0105165: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

B053_RS0105155: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B053_RS0105160: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B053_RS0105200: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.74	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001846.4	0.50	NRPS, saccharide	valinomycin, montanastatin	Streptomyces sp. CBMAI 2042
BGC0002075.3	0.41	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.36	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000357.5	0.34	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001132.4	0.34	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.34	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.33	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0000351.5	0.33	NRPS	exochelin	Mycolicibacterium smegmatis MC2 155
BGC0001758.4	0.33	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.82	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0001846.4	0.75	NRPS, saccharide	valinomycin, montanastatin	Streptomyces sp. CBMAI 2042
BGC0002075.3	0.73	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000357.5	0.67	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.67	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.74 out of 36.53

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.46 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 23.66 out of 28.19

Confidence: medium

Additional weak hits (23):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.58 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.81 out of 18.57

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.90 out of 29.38

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.64 out of 36.54

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.48 out of 21.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.60 out of 23.43

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.24 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.18 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.70 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.74 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.99 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.29 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.70 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.10 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.35 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.54 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.88 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.23 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.28 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 396658 - 460688:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Hiv - D-Val) + (shikimic_acid - Val)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 13, location 396658 - 454881:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Hiv - D-Val) + (shikimic_acid - Val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0105155: shikimic_acid - Val

Search NORINE for peptide: strict or relaxed

CAL_domain (212..646): shikimic_acid

minowa: shikimic_acid

Prediction, score:

shikimic_acid: 16.3
AHBA: 15.4
NH2: 9.9
fatty_acid: 7.6
Acetyl-CoA: 0.0

AMP-binding (1803..2194): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LEPGFDASTFEAWVVVGGDTNGYGPTENTTFSTT
Nearest Stachelhaus code(s):: Val DAFWVGGTFK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

B053_RS0105160: D-Hiv - Val

Search NORINE for peptide: strict or relaxed

AMP-binding (14..452): D-Hiv

nrpys: D-Hiv

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RGVMAGILMSHGWAINAGEVPVWGMAETCSGVFY
Nearest Stachelhaus code(s):: D-Hiv GISWIAVSGK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1838..2228): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LEPGFDASTLEGWMLVGGDINGYGPTENTTFSTT
Nearest Stachelhaus code(s):: Val DALWLGGTFK (100% 8Å match); bOH-Val DALWLGGTFK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NZ_KB890916.1 - Region 5 - melanin,terpene-precursor

Download region GenBank file

Download region SVG

Location: 461,400 - 490,163 nt. (total: 28,764 nt) Show pHMM detection rules used

melanin: melC
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B053_RS0105300: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase

B053_RS0105330: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

B053_RS0105350: sugar transferase

smcogs: SMCOG1146: sugar transferase

B053_RS0105355: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: hydrolase

B053_RS0105360: isochorismatase

smcogs: SMCOG1027: isochorismatase

Ligases: synthetase

B053_RS0105365: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.58	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.53	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.30	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.26	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000800.5	0.26	saccharide	xanthan	Xanthomonas campestris
BGC0001529.5	0.20	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000908.3	0.17	other (other)	melanin	Streptomyces avermitilis
BGC0000742.3	0.16	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0000743.3	0.16	saccharide	capsular polysaccharide	Streptococcus agalactiae
BGC0002397.2	0.16	terpene	astallatene	Arabidopsis thaliana

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.83	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.53	other (other)	melanin	Streptomyces avermitilis
BGC0002397.2	0.53	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0000800.5	0.48	saccharide	xanthan	Xanthomonas campestris
BGC0000677.5	0.48	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000742.3	0.47	saccharide	capsular polysaccharide	Streptococcus agalactiae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

B053_RS0105365: PT_FPPS_like

Domain 1 (58 - 341): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (10):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.30 out of 31.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.71 out of 29.25

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.74 out of 26.33

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.29 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.32 out of 20.01

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.06 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.48 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.95 out of 32.93

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.92 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description

NZ_KB890916.1 - Region 6 - NRPS,T3PKS

Download region GenBank file

Download region SVG

Location: 504,763 - 607,731 nt. (total: 102,969 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

B053_RS0105600: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

B053_RS0105755: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

Transferases: methyltransferase

B053_RS0105595: Methylation

MITE: MITE0000155Methylation (identity: 81.50%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

Hydrolases: hydrolase

B053_RS0105695: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase synthase

B053_RS0105590: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

B053_RS0105635: carboxylate-amine ligase

smcogs: SMCOG1165: carboxylate-amine ligase

B053_RS0105670: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0105680: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	1.28	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.45	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002135.2	0.43	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002071.2	0.41	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001758.4	0.41	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.41	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.37	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.37	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.37	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.86	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002071.2	0.73	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0001758.4	0.73	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.70	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.20 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.19 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.73 out of 36.53

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.62 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.19 out of 30.11

Confidence: medium

Additional weak hits (17):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.75 out of 27.55

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.97 out of 26.06

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.40 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.53 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.23 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.12 out of 21.84

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.57 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.79 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.21 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.93 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.52 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.45 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.15 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.78 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 18, location 504762 - 607731:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Gly - Thr - Ser - D-Leu) + (Thr - D-His - Val - D-X) + (D-X - Gly - D-Ser - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 19, location 504762 - 545815:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Gly - Thr - Ser - D-Leu)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 20, location 519355 - 607731:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Gly - Thr - Ser - D-Leu) + (Thr - D-His - Val - D-X) + (D-X - Gly - D-Ser - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0105670: Gly - Gly - Thr - Ser - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (468..866): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LAMTFDIAALEVQALSGGEVNLYGPTETTVWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLVWK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1549..1943): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FCLTFDIAVPELQALVGGEVNLYGPTETTIWSTA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2599..3007): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVLGGEVNMYGITETTVHVTT
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3662..4059): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWATFDVSVWEWHFLASGEHNLYGPTEAAVDVTA
Nearest Stachelhaus code(s):: Ser DVWHLSLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4721..5104): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASVMEMLIVVGGEVNAYGPTEATACVTM
Nearest Stachelhaus code(s):: Leu DAMLVGAACK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

B053_RS0105675: Thr - His - Val - X

Search NORINE for peptide: strict or relaxed

AMP-binding (493..904): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LTTHFDFSVWEGNQVFGGEVNMYGITETTVHVTL
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1566..1963): His

nrpys: His

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTLAFDTSVWEMTVIVAGEFNSYGPTETTVDATL
Nearest Stachelhaus code(s):: His DTWTIASVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3059..3461): Val

nrpys: Val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDSSFDAATHEGWFWTGGDVNGYGPTETTTFATA
Nearest Stachelhaus code(s):: Val DAYWWGGTFK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4126..4524): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWTAFDVSVWEGHFFSGGEVNQYGPTEAAVDVTA
Nearest Stachelhaus code(s):: His DYWHFGAVDK (82% 8Å match); Ser DVWHFSLVDK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

B053_RS0105680: X - Gly - Ser - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (473..868): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWAAFDVTFCENVIIVGTEFNAYGPTEAVVNSAT
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWIIGAVNK (62% 8Å match); Trp or Pro DVMFIGAVNK (50% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1988..2368): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LAITFDIAALEVQALSGGELNLYGPTETTIWSTV
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3034..3426): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFIASGEHNLYGPTEAAIDVTA
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4530..4969): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSHWFDASWQPWEVGVGGEVNLYGPTEGTVDALV
Nearest Stachelhaus code(s):: OH-Orn DAQEGGLVDK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism

NZ_KB890916.1 - Region 7 - terpene

Download region GenBank file

Download region SVG

Location: 704,174 - 732,592 nt. (total: 28,419 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0106300: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B053_RS0106330: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

B053_RS0106335: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: methyltransferase

B053_RS0106280: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthetase

B053_RS0106305: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.86	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.78	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.76	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.71	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.71	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000645.3	0.55	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.86	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.78	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.76	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.71	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.71	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000645.3	0.55	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000639.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

B053_RS0106275: Lycopene_cycl

Domain 1 (5 - 380): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

B053_RS0106295: PT_phytoene_like

Domain 1 (16 - 313): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

B053_RS0106305: PT_FPPS_like

Domain 1 (74 - 371): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.03 out of 36.53

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.10 out of 23.43

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.61 out of 23.43

Confidence: medium

Additional weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.27 out of 32.74

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.94 out of 30.25

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
DmdR1	Iron(II)-dependent repressor

NZ_KB890916.1 - Region 8 - NRPS,T1PKS,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 741,755 - 788,939 nt. (total: 47,185 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0106400: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Hydrolases: hydrolase

B053_RS0106405: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthase

B053_RS1000000135485: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000606.5	0.68	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0002135.2	0.65	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001146.5	0.58	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001164.3	0.53	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.53	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001145.5	0.51	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.49	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0001174.4	0.49	ribosomal	corynazolicin	Corynebacterium urealyticum DSM 7111
BGC0001640.3	0.47	ribosomal	kocurin	Kocuria rosea
BGC0000903.3	0.45	other (other)	fluorometabolite	Streptomyces cattleya

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0000606.5	0.56	ribosomal	lactazole	Streptomyces lactacystinaeus
BGC0001146.5	0.52	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001145.5	0.49	ribosomal	cyclothiazomycin b1	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000603.5	0.48	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000903.3	0.48	other (other)	fluorometabolite	Streptomyces cattleya

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.54 out of 23.79

Confidence: medium

Additional weak hits (21):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.42 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.03 out of 26.33

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.10 out of 25.88

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.55 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.10 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 15.56 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.29 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.51 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.93 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.66 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.00 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.20 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.82 out of 18.57

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.94 out of 33.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.04 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.44 out of 25.88

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.23 out of 27.55

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.81 out of 24.78

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 22, location 741754 - 788939:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2 - ohmal - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS1000000135485: NH2 - mal - X

CAL_domain (33..455): NH2

minowa: NH2

Prediction, score:

NH2: 54.0
fatty_acid: 44.0
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1227..1521): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 114.2
Methylmalonyl-CoA: 70.9
Methoxymalonyl-CoA: 63.0
inactive: 40.1
Ethylmalonyl-CoA: 32.3
Isobutyryl-CoA: 30.4
Propionyl-CoA: 28.9
fatty_acid: 27.7
trans-1,2-CPDA: 17.9
2-Methylbutyryl-CoA: 17.9
Benzoyl-CoA: 14.7
CHC-CoA: 14.0
Acetyl-CoA: 11.3
3-Methylbutyryl-CoA: 8.5

AMP-binding (2719..3140): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWAAFDASVRQASSHVGGEANLYGPTEATINTTC
Nearest Stachelhaus code(s):: Gln DACSTGVINK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 21 - 74; Score: 39.7

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

Core peptide predictions

No core peptides found.

NZ_KB890918.1 - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 125,998 - 136,396 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

B053_RS0108355: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: aminotransferase

B053_RS0108375: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B053_RS0108385: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.91	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.91	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.63	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.63	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.62	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.13 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (7):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.72 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.51 out of 27.78

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.04 out of 26.12

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.16 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.76 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.16 out of 27.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein

NZ_KB890919.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 100,062 - 132,797 nt. (total: 32,736 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B053_RS0109135: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

B053_RS0109180: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

B053_RS0109130: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.55	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.52	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0002469.2	0.51	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0001531.5	0.51	other (other)	bisucaberin B	Tenacibaculum mesophilum
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000939.5	0.50	other (other)	aerobactin	Grimontia hollisae
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.79 out of 25.75

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 23.80 out of 27.18

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.17 out of 27.18

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

Additional weak hits (8):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.49 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.39 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.51 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.40 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
MatP	Cell cycle regulator
NrdR	Represses ribonucleotide reductase encoding genes

NZ_KB890921.1 - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 117,554 - 161,537 nt. (total: 43,984 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: reductase

B053_RS0110815: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

Transferases: phosphotransferase

B053_RS0110770: Glucose-specific phosphotransferase enzyme IIA

smcogs: SMCOG1145: Glucose-specific phosphotransferase enzyme IIA

Hydrolases: hydrolase

B053_RS0110880: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002295.3	0.69	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.61	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002295.3	0.69	NRPS, saccharide	minimycin, indigoidine	Streptomyces hygroscopicus
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.62	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.61	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.86 out of 27.04

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 24.95 out of 27.04

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.19 out of 27.04

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 19.28 out of 23.05

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.10 out of 21.84

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.33 out of 29.38

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.21 out of 30.22

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.60 out of 27.04

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.50 out of 26.85

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.60 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 19.54 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 117553 - 161537:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gln)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0110875: Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (31..470): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: gln (Gln)

Stachelhaus prediction details:

Stachelhaus sequence:: QWLTFDAAQWEAQGFSGGEINLYGPTEATINATS
Nearest Stachelhaus code(s):: Gln DAWQFGLINK (85% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
MexT	Global virulence regulator
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB890923.1 - Region 1 - NI-siderophore

Download region GenBank file

Download region SVG

Location: 48,997 - 78,775 nt. (total: 29,779 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B053_RS0112080: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Hydrolases: hydrolase

B053_RS0112055: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Lyases: decarboxylase

B053_RS0112085: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.87	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.78	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.71	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.71	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000941.3	0.87	other (other)	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001478.5	0.83	other (other)	desferrioxamine E	Streptomyces sp. ID38640
BGC0002305.2	0.78	other (other)	legonoxamine A, desferrioxamine B, legonoxamine B	Streptomyces sp.
BGC0000940.5	0.71	other (other)	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001453.5	0.71	other (other)	desferrioxamine	Streptomyces argillaceus
BGC0001572.3	0.70	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0002464.3	0.61	other (other)	alcaligin	Bordetella pertussis Tohama I
BGC0002690.2	0.59	other (other)	FW0622	Verrucosispora sp. FIM060022
BGC0002620.2	0.55	other (other)	fulvivirgamide A2, fulvivirgamide B2, fulvivirgamide B3, fulvivirgamide B4	Fulvivirga marina
BGC0002469.2	0.54	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.52 out of 19.26

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.15 out of 30.11

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.36 out of 25.31

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.62 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.77 out of 36.53

Confidence: medium

Additional weak hits (9):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.31 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.33 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.93 out of 35.63

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.84 out of 26.85

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.23 out of 23.43

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.26 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.12 out of 25.88

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.65 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor
CelR	Cellobiose uptake repressor
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator

NZ_KB890923.1 - Region 2 - lanthipeptide-class-ii,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 125,889 - 157,431 nt. (total: 31,543 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

B053_RS0112380: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Hydrolases: protease

B053_RS0112315: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

B053_RS0112370: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.38	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000551.5	0.37	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000525.5	0.36	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000519.4	0.35	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.35	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.35	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000513.3	0.32	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001229.4	0.30	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000517.4	0.29	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000546.3	0.28	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002700.2	0.51	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000551.5	0.50	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000519.4	0.49	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.49	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000518.3	0.49	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000513.3	0.47	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001407.5	0.45	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0001229.4	0.45	ribosomal	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000517.4	0.44	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for B053_RS0112350

B053_RS1000000137140

Leader:

MSENTKPAADENNETETPEVEAHSVLDLQETPGVIDREIVPG

Core:

NCVSTVSLVLS

Core with dehydrations:

NCysVDhaDhbVDhaLVLDha

antiSMASH-DB 4.0 matches for B053_RS1000000137140

100.0%

NZ_AQRK01000090.1and 19 others:

NZ_AQRK01000090.1 Lanthipeptides: YUW_RS35860_lanthipeptideNZ_AQRK01000090.1 Lanthipeptides: YUW_RS35860_lanthipeptideNZ_AQRK01000090.1 Lanthipeptides: YUW_RS35860_lanthipeptideNZ_ARPF01000009.1 Lanthipeptides: B083_RS1000000136445_lanthipeptideNZ_BMSP01000007.1 Lanthipeptides: IE150_RS11895_lanthipeptideNZ_BMSP01000007.1 Lanthipeptides: IE150_RS11895_lanthipeptideNZ_BMSP01000007.1 Lanthipeptides: IE150_RS11895_lanthipeptideNZ_BMSP01000007.1 Lanthipeptides: IE150_RS11895_lanthipeptideNZ_CP015362.1 Lanthipeptides: A6E92_RS33505_lanthipeptideNZ_CP024957.1 Lanthipeptides: CVT27_RS32880_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS33175_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS33175_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS33175_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS33175_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS10800_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS10800_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS10800_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS10800_lanthipeptideNZ_KB890923.1 Lanthipeptides: B053_RS1000000137140_lanthipeptide

Lanthipeptides: YUW_RS35860_lanthipeptide

1

NCVSTVSLVLS

11

NCVSTVSLVLS

1

NCVSTVSLVLS

11

83.3%

NZ_LIXJ01000004.1:

Lanthipeptides: AMK22_RS39975_lanthipeptide

2

CVSTVSLVLS

11

CVSTVSLVLS

1

CVSTVSLVLS

10

72.7%

NZ_ML123034.1and 3 others:

NZ_ML123034.1 Lanthipeptides: EES43_RS30570_lanthipeptideNZ_ML123034.1 Lanthipeptides: EES43_RS30570_lanthipeptideNZ_ML123034.1 Lanthipeptides: EES43_RS30570_lanthipeptide

Lanthipeptides: EES43_RS30570_lanthipeptide

2

CVSTVSLVLS

11

CVST+SLVL

1

CVSTISLVLE

10

with 2 more sequence matches

58.3%

NZ_CP119145.1:

Lanthipeptides: PZB75_RS01650_lanthipeptide

2

CVSTVSLVLS

11

CVS +S+VLS

1

CVSVISVVLS

10

33.3%

NZ_BDHJ01000009.1and 17 others:

NZ_CP076457.1 Lanthipeptides: KME66_RS23045_lanthipeptideNZ_KB891297.1 Lanthipeptides: B061_RS39730_lanthipeptideNZ_KB891297.1 Lanthipeptides: B061_RS39730_lanthipeptideNZ_KB891297.1 Lanthipeptides: B061_RS39730_lanthipeptideNZ_KB891297.1 Lanthipeptides: B061_RS39730_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS37365_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS37365_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS37365_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS37365_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS23845_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS23845_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS23845_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS23845_lanthipeptideNZ_LZQS01000002.1 Lanthipeptides: STIB_RS38140_lanthipeptideNZ_LZQS01000002.1 Lanthipeptides: STIB_RS38140_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS11445_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS11445_lanthipeptide

Lanthipeptides: BHQ08_RS34920_lanthipeptide

1

NCVSTVSLVLS

11

NCVSTVSLVL

20

NCVSTVSLVLG

30

Lanthipeptide(s) for B053_RS0112370

allorf_153271_153477

Leader:

MDAGRSVDAGRSVARCTGWAAVAVCPSASRAASPSVTAPASRREGGMGVLLAG

Core:

ARRRGCERLSAGARA

Core with dehydrations:

ARRRGCysERLDhaAGARA

antiSMASH-DB 4.0 matches for allorf_153271_153477

93.3%

NZ_KB890923.1:

Lanthipeptides: allorf_153409_153477_lanthipeptide

2

RRRGCERLSAGARA

15

RRRGCERLSAGARA

1

RRRGCERLSAGARA

14

17.8%

NZ_AQRK01000090.1and 2 others:

NZ_ARPF01000009.1 Lanthipeptides: allorf_356500_356661_lanthipeptideNZ_CP015362.1 Lanthipeptides: allorf_5135739_5135900_lanthipeptide

Lanthipeptides: allorf_007637_007798_lanthipeptide

2

RRRGCERLSAGA

13

RRRGCE L+ A

1

RRRGCESLTESA

12

17.3%

NZ_CP022203.1:

Lanthipeptides: allorf_3347911_3348144_lanthipeptide

1

ARRRGCERLSAG

12

A RRGCER S G

2

APRRGCERCSFG

13

allorf_156768_156875

Leader:

MVRLGALVPYSIRWTVLRSIPVG

Core:

SPRCICVRRRSS

Core with dehydrations:

DhaPRCysICysVRRRDhaDha

antiSMASH-DB 4.0 matches for allorf_156768_156875

100.0%

NZ_KB890923.1:

Lanthipeptides: allorf_156768_156875_lanthipeptide

1

SPRCICVRRRSS

12

SPRCICVRRRSS

1

SPRCICVRRRSS

12

91.7%

NZ_CP015362.1:

Lanthipeptides: allorf_5139092_5139199_lanthipeptide

1

SPRCICVRRRSS

12

SPRCICVR RSS

1

SPRCICVRPRSS

12

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.07 out of 30.12

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 26.03 out of 30.11

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.16 out of 30.11

Confidence: medium

Additional weak hits (5):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 14.95 out of 20.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.75 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.13 out of 27.18

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

B053_RS1000000137140 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 1048.6 Da

Molecular weight: 1049.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1067.2 Da N = 1; 1085.3 Da N = 2; 1103.3 Da N = 3

allorf_153271_153477 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 1610.9 Da

Molecular weight: 1611.8 Da

Number of bridges: 1

allorf_156768_156875 - Class II

Cleavage pHMM score: -7.10

RODEO score: 0

Monoisotopic mass: 1364.7 Da

Molecular weight: 1365.6 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1383.6 Da N = 1

TFBS definitions

Regulator	Description
CelR	Cellobiose uptake repressor
OsdR	Development and stress management regulator

NZ_KB890924.1 - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 1 - 41,473 nt. (total: 41,473 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B053_RS0112480: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

B053_RS0112505: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B053_RS0112515: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

B053_RS0112565: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

Transferases: PPTase carboxylase glycosyltransferase transferase

B053_RS0112470: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

B053_RS0112530: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

B053_RS0112600: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

B053_RS1000000135075: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Lyases: cyclase

B053_RS0112485: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

B053_RS0112510: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

B053_RS0112490: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B053_RS0112495: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.84	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.80	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.78	PKS	oviedomycin	Streptomyces antibioticus
BGC0002047.2	0.66	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002000.4	0.64	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000235.5	0.62	PKS	kiamycin	Streptomyces sp. W007
BGC0002477.3	0.61	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0000253.4	0.60	PKS	oviedomycin	Streptomyces antibioticus
BGC0002369.2	0.59	PKS	maduralactomycin A, maduralactomycin B, actinospirol A, actinospirol B	Actinomadura rubteroloni
BGC0001904.2	0.58	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.84	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.80	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.78	PKS	oviedomycin	Streptomyces antibioticus
BGC0002047.2	0.66	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0002000.4	0.64	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000235.5	0.62	PKS	kiamycin	Streptomyces sp. W007
BGC0002477.3	0.61	PKS	thioangucycline A, thioangucycline B	Streptomyces sp. CB00072
BGC0000253.4	0.60	PKS	oviedomycin	Streptomyces antibioticus
BGC0002369.2	0.59	PKS	maduralactomycin A, maduralactomycin B, actinospirol A, actinospirol B	Actinomadura rubteroloni
BGC0001904.2	0.58	PKS	fluostatin L, fluostatin D, difluostatin A, fluostatin C, fluostatin F, fluostatin G/H, fluostatin J, fluostatin K, rabelomycin	Micromonospora rosaria

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.22 out of 18.46

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

Additional weak hits (17):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.05 out of 27.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.88 out of 25.88

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.25 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.77 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.52 out of 20.01

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.53 out of 28.14

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.61 out of 20.01

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.90 out of 26.06

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.33 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.13 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.53 out of 31.73

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.91 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.24 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.55 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 28.19

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

Type II PKS

TFBS Finder

Type II PKS gene cluster prediction details

Cluster section:: 0 to 41473
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:: 8|9 (Score: 707.1; E-value: 1.3e-215)
Product class(es):: angucycline
Product molecular weight(s):: acetyl-CoA_8: 367 Da
acetyl-CoA_9: 409 Da

B053_RS0112480: OXY (Score: 594.4; E-value: 4.1e-181)
B053_RS0112485: CYC C4-C17/C2-C19 (Score: 194.8; E-value: 3.1e-60)
B053_RS0112490: KS (Score: 798.8; E-value: 2.3e-243)
B053_RS0112495: CLF 8|9 (Score: 707.1; E-value: 1.3e-215)
B053_RS0112500: ACP (Score: 130.7; E-value: 3.5e-41)
B053_RS0112505: KR C9 (Score: 473.6; E-value: 3.4e-145)
B053_RS0112510: CYC C7-C12 (Score: 493.9; E-value: 3.4e-151)
B053_RS0112515: KR C15 (Score: 485.7; E-value: 6.6e-149)
B053_RS0112565: OXY (Score: 14.0; E-value: 4.5e-05)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
RpoN	Regulator of nitrogen assimilation and virulence

NZ_KB890924.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 98,537 - 121,333 nt. (total: 22,797 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lasso peptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

B053_RS0112990: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

Translocases: permease

B053_RS0113045: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001634.3	0.86	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001507.3	0.67	ribosomal	anantin C	Streptomyces olindensis
BGC0001548.4	0.65	ribosomal	citrulassin A	Streptomyces albulus
BGC0001550.3	0.63	ribosomal	citrulassin D	Streptomyces katrae
BGC0001645.3	0.61	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.4	0.61	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001539.4	0.59	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001781.4	0.59	ribosomal	sphaericin	Planomonospora sphaerica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001634.3	0.86	ribosomal	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001507.3	0.67	ribosomal	anantin C	Streptomyces olindensis
BGC0001548.4	0.65	ribosomal	citrulassin A	Streptomyces albulus
BGC0001550.3	0.63	ribosomal	citrulassin D	Streptomyces katrae
BGC0001645.3	0.61	ribosomal	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.4	0.61	ribosomal	citrulassin E	Streptomyces glaucescens
BGC0001493.5	0.60	ribosomal	achromosin	Streptomyces achromogenes subsp. achromogenes
BGC0001539.4	0.59	ribosomal	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001506.5	0.59	ribosomal	anantin B1, anantin B2	Streptomyces sp. NRRL S-146
BGC0001781.4	0.59	ribosomal	sphaericin	Planomonospora sphaerica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lasso peptide predictions

Lassopeptide(s) for B053_RS1000000136555

B053_RS1000000136555

Leader:

MKQQQEKAKKAYMKPSLFKQGDFSKKTA

Full core:

GYFYGSYKEYWVRRII

Putative macrolactam:

GYFYGSYKE

antiSMASH-DB 4.0 matches for B053_RS1000000136555

100.0%

NZ_AQRK01000073.1and 34 others:

NZ_ARPF01000020.1 Lassopeptides: B083_RS1000000135975_lassopeptideNZ_BMSP01000033.1 Lassopeptides: IE150_RS31095_lassopeptideNZ_BNBJ01000018.1 Lassopeptides: IE304_RS27885_lassopeptideNZ_CP011522.1 Lassopeptides: ABE83_RS36070_lassopeptideNZ_CP015362.1 Lassopeptides: A6E92_RS32825_lassopeptideNZ_CP020570.1 Lassopeptides: B1H20_RS34515_lassopeptideNZ_CP024957.1 Lassopeptides: CVT27_RS18750_lassopeptideNZ_CP030930.1 Lassopeptides: DTW94_RS18860_lassopeptideNZ_CP032543.1 Lassopeptides: D6270_RS18940_lassopeptideNZ_CP058556.1 Lassopeptides: HXS80_RS15025_lassopeptideNZ_CP059898.1 Lassopeptides: H3V39_RS14565_lassopeptideNZ_CP070242.1 Lassopeptides: I6J39_RS14950_lassopeptideNZ_CP070260.1 Lassopeptides: I6J40_RS19545_lassopeptideNZ_CP077652.1 Lassopeptides: KRR37_RS18710_lassopeptideNZ_CP079114.1 Lassopeptides: KV381_RS20695_lassopeptideNZ_CP101140.1 Lassopeptides: NF554_RS14180_lassopeptideNZ_CP101397.1 Lassopeptides: NLU04_RS02420_lassopeptideNZ_CP113262.1 Lassopeptides: OUQ49_RS18920_lassopeptideNZ_JAGGOV010000040.1 Lassopeptides: J7E92_RS24040_lassopeptideNZ_JAHHWT010000002.1 Lassopeptides: KM153_RS04955_lassopeptideNZ_JAJDST010000050.1 Lassopeptides: LJC81_RS32430_lassopeptideNZ_JALDPQ010000042.1 Lassopeptides: MQC87_RS04740_lassopeptideNZ_JAMFLF010000013.1 Lassopeptides: M1212_RS26530_lassopeptideNZ_JANRMN010000006.1 Lassopeptides: NW249_RS11850_lassopeptideNZ_KB890924.1 Lassopeptides: B053_RS1000000136555_lassopeptideNZ_KB891296.1 Lassopeptides: B061_RS39115_lassopeptideNZ_KL573564.1 Lassopeptides: BG84_RS1000000139430_lassopeptideNZ_KZ819159.1 Lassopeptides: DBP19_RS18270_lassopeptideNZ_LR881952.1 Lassopeptides: STRPST75_RS15280_lassopeptideNZ_LZQS01000001.1 Lassopeptides: STIB_RS37415_lassopeptideNZ_RCOL01000001.1 Lassopeptides: STAN_RS20170_lassopeptideNZ_VEHK01000003.1 Lassopeptides: FS984_RS09665_lassopeptideNZ_WUEJ01000001.1 Lassopeptides: GRQ63_RS00790_lassopeptideNZ_WWGL01000031.1 Lassopeptides: GTY38_RS20560_lassopeptide

Lassopeptides: YUW_RS35360_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYFYGSYKEYWVRRII

1

GYFYGSYKEYWVRRII

16

93.8%

NZ_CP110539.1and 1 other:

NZ_CP112880.1 Lassopeptides: N7925_RS15605_lassopeptide

Lassopeptides: OH133_RS17115_lassopeptide

1

GYFYGSYKEYWVRRI

15

GYFYGSYKEYWVRRI

1

GYFYGSYKEYWVRRI

15

87.5%

NZ_BMRY01000001.1and 14 others:

NZ_BMSZ01000030.1 Lassopeptides: IE135_RS32485_lassopeptideNZ_CP010833.1 Lassopeptides: TK78_RS35300_lassopeptideNZ_CP021707.1 Lassopeptides: CCZ36_RS19605_lassopeptideNZ_CP084357.1 Lassopeptides: LEL86_RS33655_lassopeptideNZ_DS999644.1 Lassopeptides: SSGG_RS36910_lassopeptideNZ_JNLT01000024.1 Lassopeptides: CD02_RS38355_lassopeptideNZ_KZ679082.1 Lassopeptides: C6W96_RS19995_lassopeptideNZ_KZ819154.1 Lassopeptides: DBP12_RS14735_lassopeptideNZ_KZ819178.1 Lassopeptides: DBP20_RS19850_lassopeptideNZ_KZ819182.1 Lassopeptides: DBP21_RS20195_lassopeptideNZ_LACR01000007.1 Lassopeptides: YW5_RS36195_lassopeptideNZ_LZRD01000023.1 Lassopeptides: A3Q37_RS36590_lassopeptideNZ_NNBN01000001.1 Lassopeptides: CG717_RS32755_lassopeptideNZ_WWGD01000017.1 Lassopeptides: GTY72_RS09250_lassopeptide

Lassopeptides: IE140_RS06105_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYF GSYKEYW RRII

1

GYFVGSYKEYWSRRII

16

with 12 more sequence matches

Only the first 10 are displayed here.

87.5%

NZ_CP013738.1and 4 others:

NZ_CP029361.1 Lassopeptides: DIJ69_RS14415_lassopeptideNZ_CP090837.1 Lassopeptides: LZ559_RS19885_lassopeptideNZ_JAJUKK010000001.1 Lassopeptides: LXH09_RS00260_lassopeptideNZ_LIXK01000001.1 Lassopeptides: AMK23_RS36895_lassopeptide

Lassopeptides: WQO_RS35795_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYF GSYKEYW RRII

1

GYFVGSYKEYWTRRII

16

82.4%

NC_021177.1and 5 others:

NZ_BMUG01000007.1 Lassopeptides: IE264_RS21365_lassopeptideNZ_CP054926.1 Lassopeptides: HUT09_RS19455_lassopeptideNZ_CP068598.1 Lassopeptides: IFE09_RS19740_lassopeptideNZ_CP071044.1 Lassopeptides: JHY03_RS19320_lassopeptideNZ_JOJC01000016.1 Lassopeptides: IO23_RS1000000136610_lassopeptide

Lassopeptides: SFUL_RS36235_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYF GSYKEYWVRRI+

1

GYFVGSYKEYWVRRIV

16

81.2%

NZ_BDHJ01000011.1and 4 others:

NZ_BMTW01000001.1 Lassopeptides: IE134_RS04135_lassopeptideNZ_CP076457.1 Lassopeptides: KME66_RS14195_lassopeptideNZ_KZ268499.1 Lassopeptides: CE422_RS34520_lassopeptideNZ_ML123117.1 Lassopeptides: EES46_RS05210_lassopeptide

Lassopeptides: BHQ08_RS34645_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYF GSYKEYW RRI+

1

GYFVGSYKEYWTRRIV

16

81.2%

NZ_CP020563.1:

Lassopeptides: B7C62_RS35255_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYF GSYKE+W RRII

1

GYFIGSYKEFWSRRII

16

75.0%

NZ_KB891808.1:

Lassopeptides: B072_RS47760_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYF GSYKE+ VRRI+

1

GYFVGSYKEWIVRRIV

16

75.0%

NZ_PGGW01000069.1:

Lassopeptides: CUT44_RS32610_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYFYGSYKE+ RRI+

1

GYFYGSYKEFLSRRIV

16

68.8%

NZ_CP061281.1:

Lassopeptides: IAG42_RS10065_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYF G YKE+ VRRI+

1

GYFVGPYKEWIVRRIV

16

62.5%

NZ_FOET01000001.1:

Lassopeptides: BMY40_RS27365_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYF G YKEY+ RR +

1

GYFVGKYKEYFSRRFV

16

62.5%

NZ_FOSG01000008.1and 1 other:

NZ_PDKQ02000012.1 Lassopeptides: BFM75_RS03245_lassopeptide

Lassopeptides: BM237_RS28735_lassopeptide

1

GYFYGSYKEYWVRRII

16

GYF+G YKEY+ RR +

1

GYFFGKYKEYFSRRFV

16

58.8%

NZ_JACHEM010000013.1:

Lassopeptides: HNQ79_RS23595_lassopeptide

1

GYFYGSYKEYWVRRII

16

G FY S KEYW RR+

1

GMFYASCKEYWSRRLC

16

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.07 out of 26.85

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 27.04

Confidence: medium

Additional weak hits (12):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.70 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.97 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.70 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.55 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 22.36 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.70 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.15 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.82 out of 24.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.78 out of 30.98

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.98 out of 28.14

Confidence: weak

Lasso peptides

RREFinder

TFBS Finder

Core peptide predictions

B053_RS1000000136555 - Class II: Cleavage pHMM score: 0.20; RODEO score: 20; Monoisotopic mass: 2081.0 Da; Molecular weight: 2082.4 Da; Number of bridges: 0

RRE predictions

: RRE type: Stand_Alone_Lasso_RRE; Location: 0 - 82; Score: 86.3

TFBS definitions

Regulator	Description
DasR	N-acetylglucosamine dependent repressor
RutR	Regulator of the pyrimidine and purine metabolism

NZ_KB890925.1 - Region 1 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 1 - 12,761 nt. (total: 12,761 nt) Show pHMM detection rules used

Region on contig edge.

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

B053_RS0113190: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000673.3	0.53	terpene	pimara-8(14),15-diene	Aspergillus nidulans FGSC A4
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000678.5	0.33	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.32	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000644.3	0.31	terpene	carotenoid	Dietzia sp. CQ4
BGC0001529.5	0.30	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000286.3	0.30	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000666.5	0.29	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000673.3	0.53	terpene	pimara-8(14),15-diene	Aspergillus nidulans FGSC A4
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0001911.3	0.34	terpene	raimonol	Streptomyces anulatus
BGC0001910.4	0.33	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000678.5	0.33	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000665.5	0.32	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000644.3	0.31	terpene	carotenoid	Dietzia sp. CQ4
BGC0001529.5	0.30	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0000286.3	0.30	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0000666.5	0.29	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

B053_RS0113190: PT_FPPS_like

Domain 1 (58 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.11 out of 23.79

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.29 out of 23.43

Confidence: medium

Additional weak hits (3):

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.47 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.03 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
IolR	Regulator of the inositol catabolism

NZ_KB890925.1 - Region 2 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 136,325 - 150,395 nt. (total: 14,071 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase aminotransferase

B053_RS0113810: aminotransferase

smcogs: SMCOG1019: aminotransferase

B053_RS0113855: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.86	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.67	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.54	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000501.3	0.53	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.51	ribosomal	SAL-2242	Streptomyces albidoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000496.5	0.86	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000553.3	0.67	ribosomal	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000551.5	0.66	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000513.3	0.60	ribosomal	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000519.4	0.60	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000518.3	0.54	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000501.3	0.53	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001226.4	0.52	ribosomal	streptocollin	Streptomyces collinus Tu 365
BGC0002700.2	0.52	ribosomal	bacinapeptin	Bacillus nakamurai
BGC0000546.3	0.51	ribosomal	SAL-2242	Streptomyces albidoflavus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for B053_RS0113850

B053_RS0113845

Leader:

MALLDLQAMETPAEESFGELAT

Core:

GSQVSLLVCEYSSLSVVLCTP

Core with dehydrations:

GDhaQVDhaLLVCysEYDhaDhaLDhaVVLCysDhbP

antiSMASH-DB 4.0 matches for B053_RS0113845

100.0%

NC_010572.1and 60 others:

NC_021177.1 Lanthipeptides: SFUL_RS24355_lanthipeptideNZ_AQRK01000102.1 Lanthipeptides: YUW_RS30025_lanthipeptideNZ_ARPF01000003.1 Lanthipeptides: B083_RS0107255_lanthipeptideNZ_BMRY01000001.1 Lanthipeptides: IE140_RS02070_lanthipeptideNZ_BMSP01000003.1 Lanthipeptides: IE150_RS06495_lanthipeptideNZ_BMSZ01000003.1 Lanthipeptides: IE135_RS07550_lanthipeptideNZ_BMTW01000017.1 Lanthipeptides: IE134_RS28550_lanthipeptideNZ_BMUG01000009.1 Lanthipeptides: IE264_RS25430_lanthipeptideNZ_BMVK01000002.1 Lanthipeptides: IE272_RS07115_lanthipeptideNZ_BNBJ01000002.1 Lanthipeptides: IE304_RS05195_lanthipeptideNZ_CM003601.1 Lanthipeptides: JI76_RS25200_lanthipeptideNZ_CP010833.1 Lanthipeptides: TK78_RS10875_lanthipeptideNZ_CP011522.1 Lanthipeptides: ABE83_RS11805_lanthipeptideNZ_CP013738.1 Lanthipeptides: WQO_RS23525_lanthipeptideNZ_CP015362.1 Lanthipeptides: A6E92_RS09975_lanthipeptideNZ_CP020563.1 Lanthipeptides: B7C62_RS24450_lanthipeptideNZ_CP020570.1 Lanthipeptides: B1H20_RS34690_lanthipeptideNZ_CP024957.1 Lanthipeptides: CVT27_RS22730_lanthipeptideNZ_CP029361.1 Lanthipeptides: DIJ69_RS10225_lanthipeptideNZ_CP030930.1 Lanthipeptides: DTW94_RS22865_lanthipeptideNZ_CP061072.1 Lanthipeptides: HYC88_RS10560_lanthipeptideNZ_CP079114.1 Lanthipeptides: KV381_RS24895_lanthipeptideNZ_CP084357.1 Lanthipeptides: LEL86_RS29435_lanthipeptideNZ_CP086102.1 Lanthipeptides: LK895_RS11660_lanthipeptideNZ_CP090837.1 Lanthipeptides: LZ559_RS24025_lanthipeptideNZ_CP096281.1 Lanthipeptides: MWG59_RS25685_lanthipeptideNZ_CP101397.1 Lanthipeptides: NLU04_RS06465_lanthipeptideNZ_CP110539.1 Lanthipeptides: OH133_RS12690_lanthipeptideNZ_CP112880.1 Lanthipeptides: N7925_RS11185_lanthipeptideNZ_CP113262.1 Lanthipeptides: OUQ49_RS22935_lanthipeptideNZ_CP117709.1 Lanthipeptides: PSQ21_RS24530_lanthipeptideNZ_DS999644.1 Lanthipeptides: SSGG_RS09925_lanthipeptideNZ_GL877172.1 Lanthipeptides: SACT1_RS12960_lanthipeptideNZ_JAAWWP010000002.1 Lanthipeptides: HFV08_RS04115_lanthipeptideNZ_JAGGOV010000004.1 Lanthipeptides: J7E92_RS02930_lanthipeptideNZ_JAHHWT010000009.1 Lanthipeptides: KM153_RS24430_lanthipeptideNZ_JALDPQ010000064.1 Lanthipeptides: MQC87_RS23965_lanthipeptideNZ_JAMFLF010000002.1 Lanthipeptides: M1212_RS07295_lanthipeptideNZ_JANRMN010000004.1 Lanthipeptides: NW249_RS08610_lanthipeptideNZ_JNLT01000003.1 Lanthipeptides: CD02_RS0108685_lanthipeptideNZ_KB890925.1 Lanthipeptides: B053_RS0113845_lanthipeptideNZ_KL573549.1 Lanthipeptides: BG84_RS0119125_lanthipeptideNZ_KQ257779.1 Lanthipeptides: IQ60_RS22540_lanthipeptideNZ_KZ195572.1 Lanthipeptides: B9W61_RS11940_lanthipeptideNZ_KZ679082.1 Lanthipeptides: C6W96_RS24050_lanthipeptideNZ_KZ819154.1 Lanthipeptides: DBP12_RS10285_lanthipeptideNZ_KZ819178.1 Lanthipeptides: DBP20_RS23960_lanthipeptideNZ_KZ819182.1 Lanthipeptides: DBP21_RS24660_lanthipeptideNZ_LACR01000009.1 Lanthipeptides: YW5_RS12280_lanthipeptideNZ_LIPB01000001.1 Lanthipeptides: AMK17_RS03280_lanthipeptideNZ_LIPE01000001.1 Lanthipeptides: AMK12_RS03355_lanthipeptideNZ_LIVT01000001.1 Lanthipeptides: AMK24_RS01700_lanthipeptideNZ_LIVW01000001.1 Lanthipeptides: AMK28_RS03165_lanthipeptideNZ_LIXK01000001.1 Lanthipeptides: AMK23_RS04085_lanthipeptideNZ_LMEL01000012.1 Lanthipeptides: ASD29_RS10010_lanthipeptideNZ_LZRD01000054.1 Lanthipeptides: A3Q37_RS33745_lanthipeptideNZ_ML123117.1 Lanthipeptides: EES46_RS10300_lanthipeptideNZ_NNBN01000004.1 Lanthipeptides: CG717_RS12310_lanthipeptideNZ_VEHK01000004.1 Lanthipeptides: FS984_RS13530_lanthipeptideNZ_WWGD01000029.1 Lanthipeptides: GTY72_RS23245_lanthipeptide

Lanthipeptides: SGR_RS11800_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCEYSSLSVVLCTP

1

GSQVSLLVCEYSSLSVVLCTP

21

95.2%

NZ_BDHJ01000008.1and 4 others:

NZ_CP032543.1 Lanthipeptides: D6270_RS22715_lanthipeptideNZ_CP076457.1 Lanthipeptides: KME66_RS09945_lanthipeptideNZ_CP077652.1 Lanthipeptides: KRR37_RS22855_lanthipeptideNZ_WUEJ01000001.1 Lanthipeptides: GRQ63_RS04560_lanthipeptide

Lanthipeptides: BHQ08_RS03045_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCEYSSLSV LCTP

1

GSQVSLLVCEYSSLSVTLCTP

21

95.2%

NZ_CP010519.1and 1 other:

NZ_CP092644.1 Lanthipeptides: MID12_RS21330_lanthipeptide

Lanthipeptides: SLNWT_RS22370_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCEYSSLSVVLC+P

1

GSQVSLLVCEYSSLSVVLCSP

21

with 77 more sequence matches

Only the first 10 are displayed here.

95.2%

NZ_CP045178.1:

Lanthipeptides: GBW32_RS28450_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLL+CEYSSLSVVLCTP

1

GSQVSLLICEYSSLSVVLCTP

21

95.2%

NZ_CP054926.1and 11 others:

NZ_CP068598.1 Lanthipeptides: IFE09_RS23820_lanthipeptideNZ_CP071044.1 Lanthipeptides: JHY03_RS23495_lanthipeptideNZ_CP080029.1 Lanthipeptides: KZO11_RS24935_lanthipeptideNZ_JAJUKK010000008.1 Lanthipeptides: LXH09_RS27635_lanthipeptideNZ_JOJC01000009.1 Lanthipeptides: IO23_RS0108435_lanthipeptideNZ_KB891296.1 Lanthipeptides: B061_RS0103425_lanthipeptideNZ_KZ268499.1 Lanthipeptides: CE422_RS23450_lanthipeptideNZ_KZ819159.1 Lanthipeptides: DBP19_RS22830_lanthipeptideNZ_LR881952.1 Lanthipeptides: STRPST75_RS10975_lanthipeptideNZ_LZQS01000001.1 Lanthipeptides: STIB_RS05225_lanthipeptideNZ_RCOL01000001.1 Lanthipeptides: STAN_RS24840_lanthipeptide

Lanthipeptides: HUT09_RS23550_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCE+SSLSVVLCTP

1

GSQVSLLVCEFSSLSVVLCTP

21

95.2%

NZ_CP058556.1and 5 others:

NZ_CP059898.1 Lanthipeptides: H3V39_RS22935_lanthipeptideNZ_CP070242.1 Lanthipeptides: I6J39_RS23755_lanthipeptideNZ_CP070260.1 Lanthipeptides: I6J40_RS10935_lanthipeptideNZ_JAJDST010000047.1 Lanthipeptides: LJC81_RS16960_lanthipeptideNZ_WWGL01000003.1 Lanthipeptides: GTY38_RS03410_lanthipeptide

Lanthipeptides: HXS80_RS11105_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVS+LVCEYSSLSVVLCTP

1

GSQVSVLVCEYSSLSVVLCTP

21

90.5%

NZ_CM001165.1and 4 others:

NZ_CP021118.1 Lanthipeptides: CAC01_RS28155_lanthipeptideNZ_CP049945.1 Lanthipeptides: G9U55_RS17850_lanthipeptideNZ_CP119149.1 Lanthipeptides: P0D76_RS02270_lanthipeptideNZ_RWGV01000033.1 Lanthipeptides: EJA11_RS20985_lanthipeptide

Lanthipeptides: STTU_RS29395_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLL+CEYSSLSV LCTP

1

GSQVSLLICEYSSLSVTLCTP

21

85.7%

NC_020990.1and 26 others:

NZ_AMPN02000002.1 Lanthipeptides: SM8_RS12785_lanthipeptideNZ_AP025692.1 Lanthipeptides: MTP06_RS18190_lanthipeptideNZ_CM002273.1 Lanthipeptides: B590_RS12280_lanthipeptideNZ_CP009802.1 Lanthipeptides: SFR_RS12925_lanthipeptideNZ_CP014485.1 Lanthipeptides: Salbus254_RS12710_lanthipeptideNZ_CP016824.1 Lanthipeptides: BEN82_RS18165_lanthipeptideNZ_CP026490.1 Lanthipeptides: C3K23_RS19520_lanthipeptideNZ_CP031742.1 Lanthipeptides: D0C37_RS13445_lanthipeptideNZ_CP047147.1 Lanthipeptides: GR131_RS18520_lanthipeptideNZ_CP053539.1 Lanthipeptides: HN026_RS11800_lanthipeptideNZ_CP056773.1 Lanthipeptides: HWN34_RS12245_lanthipeptideNZ_CP063844.1 Lanthipeptides: IPZ55_RS12410_lanthipeptideNZ_CP064783.1 Lanthipeptides: IT782_RS12060_lanthipeptideNZ_CP076385.1 Lanthipeptides: KNZ81_RS12450_lanthipeptideNZ_CP079112.1 Lanthipeptides: STALF2_RS18135_lanthipeptideNZ_CP091820.1 Lanthipeptides: L2I08_RS02835_lanthipeptideNZ_CP106650.1 Lanthipeptides: B591_RS12385_lanthipeptideNZ_CP113103.1 Lanthipeptides: OSU72_RS17905_lanthipeptideNZ_JAHUVY010000001.1 Lanthipeptides: STALF3_RS17905_lanthipeptideNZ_JALLPQ010000001.1 Lanthipeptides: MWG58_RS12385_lanthipeptideNZ_KB890715.1 Lanthipeptides: B048_RS0115750_lanthipeptideNZ_KN549183.1 Lanthipeptides: D076_RS30740_lanthipeptideNZ_KZ195583.1 Lanthipeptides: B9W68_RS12440_lanthipeptideNZ_MNPQ01000004.1 Lanthipeptides: BGV78_RS11170_lanthipeptideNZ_OX371412.1 Lanthipeptides: OZE77_RS18215_lanthipeptideNZ_VOGX01000092.1 Lanthipeptides: FRZ02_RS31600_lanthipeptide

Lanthipeptides: XNR_RS11575_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQ+SLL+CEYSSLSV LCTP

1

GSQISLLICEYSSLSVTLCTP

21

85.7%

NZ_AQRJ01000051.1and 1 other:

NZ_LFBV01000002.1 Lanthipeptides: AB852_RS09920_lanthipeptide

Lanthipeptides: YW7_RS14945_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSL+VCEYSSLS +LCTP

1

GSQVSLIVCEYSSLSALLCTP

21

85.7%

NZ_CP045702.1:

Lanthipeptides: F0344_RS33200_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCE+SSLS+ LCTP

1

GSQVSLLVCEHSSLSLTLCTP

21

85.7%

NZ_ML123034.1:

Lanthipeptides: EES43_RS19795_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLL+CE+SSLSV LCTP

1

GSQVSLLICEFSSLSVTLCTP

21

81.0%

NZ_LWLE01000019.1:

Lanthipeptides: A6A29_RS44250_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLL+CE+SSLS+ LCTP

1

GSQVSLLICEHSSLSLTLCTP

21

61.9%

NZ_QGGR01000008.1:

Lanthipeptides: BC793_RS19230_lanthipeptide

1

GSQVSLLVCEYSSLSVVLCT

20

GSQ SLL+C SSLSV C

2

GSQASLLLCGDSSLSVTTCN

21

MIBiG 4.0 matches for B053_RS0113845

95.5%

BGC0000553.3 (SSGG_RS09925):

Lanthipeptide: SRO15-2212

1

GSQVSLLVCEYSSLSVVLCTP

21

GSQVSLLVCEYSSLSVVLCTP

2

GSQVSLLVCEYSSLSVVLCTP

22

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (6):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.91 out of 20.01

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.65 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.42 out of 26.12

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 39.62

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.90 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.56 out of 27.78

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

B053_RS0113845 - Class III

Cleavage pHMM score: 31.50

RODEO score: 0

Monoisotopic mass: 2075.1 Da

Molecular weight: 2076.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2094.4 Da N = 1; 2112.4 Da N = 2; 2130.5 Da N = 3; 2148.5 Da N = 4

TFBS definitions

Regulator	Description

NZ_KB890926.1 - Region 1 - NRPS,lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 50,598 - 124,830 nt. (total: 74,233 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0114320: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B053_RS0114330: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase aminotransferase

B053_RS0114180: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

B053_RS0114335: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Hydrolases: esterase

B053_RS1000000137500: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Lyases: cyclase dehydratase

B053_RS0114145: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

B053_RS0114150: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Isomerases: mutase

B053_RS0114185: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase

B053_RS0114275: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0114280: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B053_RS0114285: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0114290: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B053_RS0114305: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B053_RS0114340: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.45	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002075.3	0.43	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.39	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.38	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.38	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.38	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	0.37	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.36	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.36	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.36	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.19 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.73 out of 36.53

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 23.69 out of 27.04

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

Additional weak hits (21):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.88 out of 19.26

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.84 out of 26.33

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.97 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.37 out of 39.62

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.41 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.85 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.29 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.30 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.67 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.89 out of 30.97

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.22 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.37 out of 31.73

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 20.83 out of 31.73

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.24 out of 26.06

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.02 out of 29.65

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.00 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

Lanthipeptides

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

Predicted core structure(s)

For candidate cluster 1, location 50597 - 124830:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Ser) + (Gly)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 70436 - 124830:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (Ser) + (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0114275: X

AMP-binding (496..932): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RWMAFDTHAEEPDLILGADVNSYGPTETTIIATT
Nearest Stachelhaus code(s):: Lys DTEDIGSVIK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

B053_RS0114280: Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (615..1008): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWELHFVCSGEANLYGPTEAAVDVTS
Nearest Stachelhaus code(s):: Ser DVWHVSLVDK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

B053_RS0114285: X

AMP-binding (26..418): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GLDFTNAGQTMNFLGSTAAVNYYTSTEAAPAQVT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

B053_RS0114290: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (445..836): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: LTMTFDISTVELQAVAGGEVNVYGPTETTVWSTL
Nearest Stachelhaus code(s):: Gly DILQLGVVWK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

B053_RS0114340: X

AMP-binding (54..509): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TATAFDRAAR-I--ICGGSFEGYGLTETTAAHTV
Nearest Stachelhaus code(s):: nDodec DVLFIGGVAK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 115 - 207; Score: 66.1

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor

NZ_KB890927.1 - Region 1 - butyrolactone,ectoine

Download region GenBank file

Download region SVG

Location: 263,723 - 279,107 nt. (total: 15,385 nt) Show pHMM detection rules used

ectoine: ectoine_synt
butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase synthase

B053_RS0115645: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B053_RS0115685: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B053_RS0115700: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Transferases: PPTase

B053_RS0115665: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Hydrolases: synthase

B053_RS0115700: riboflavin biosynthesis protein RibD

smcogs: SMCOG1240: riboflavin biosynthesis protein RibD

Ligases: ligase

B053_RS0115630: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001778.5	0.51	other (other)	showdomycin	Streptomyces showdoensis
BGC0000849.4	0.48	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.48	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000131.5	0.30	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0000706.3	0.29	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0002276.2	0.25	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001723.5	0.25	PKS	oviedomycin	Streptomyces antibioticus
BGC0000003.3	0.24	PKS	AF-toxin	Alternaria alternata
BGC0000258.3	0.24	PKS	prodigiosin	Serratia sp.
BGC0000207.5	0.24	PKS	chartreusin	Streptomyces chartreusis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001778.5	0.57	other (other)	showdomycin	Streptomyces showdoensis
BGC0000850.5	0.55	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000894.4	0.50	other (other)	citrinin	Monascus aurantiacus
BGC0002578.2	0.48	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000231.5	0.47	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000131.5	0.46	PKS	pyrrolomycin	Streptomyces sp. UC 11065
BGC0001723.5	0.46	PKS	oviedomycin	Streptomyces antibioticus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.67 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.24 out of 28.14

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.91 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.74 out of 20.01

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.84 out of 29.38

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.74 out of 20.01

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB890927.1 - Region 2 - betalactone

Download region GenBank file

Download region SVG

Location: 386,410 - 414,177 nt. (total: 27,768 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase phosphate reductase

B053_RS01000000134050: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B053_RS0116250: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

B053_RS0116285: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

B053_RS0116310: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: aminotransferase kinase

B053_RS01000000134055: aminotransferase

smcogs: SMCOG1019: aminotransferase

B053_RS0116255: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

Ligases: ligase synthase

B053_RS0116235: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

B053_RS0116270: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000895.5	0.44	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002282.2	0.41	other (other)	formycin A	Streptomyces kaniharaensis
BGC0002040.3	0.41	other (other)	coformycin, formycin A	Streptomyces kaniharaensis
BGC0001294.5	0.41	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002000.4	0.40	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001903.3	0.40	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0002047.2	0.39	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0001895.4	0.39	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000904.5	0.39	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0002514.3	0.39	PKS	julichrome Q6.6	Streptomyces sampsonii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000895.5	0.44	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0002282.2	0.41	other (other)	formycin A	Streptomyces kaniharaensis
BGC0002040.3	0.41	other (other)	coformycin, formycin A	Streptomyces kaniharaensis
BGC0001294.5	0.41	other (other)	7-prenylisatin	Streptomyces sp. MBT28
BGC0002000.4	0.40	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0001903.3	0.40	other (other)	neocarazostatin A	Streptomyces sp. MA37
BGC0002047.2	0.39	PKS	brasiliquinone A, brasiliquinone B	Nocardia brasiliensis
BGC0001895.4	0.39	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000904.5	0.39	other (other)	FR-900098	Streptomyces rubellomurinus
BGC0002514.3	0.39	PKS	julichrome Q6.6	Streptomyces sampsonii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.98 out of 23.79

Confidence: strong

Additional weak hits (6):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.94 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 22.00 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.03 out of 27.78

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.56 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.33 out of 27.18

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_KB890930.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 67,631 - 88,725 nt. (total: 21,095 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0118955: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: formyltransferase

B053_RS0118985: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Lyases: cyclase hydratase

B053_RS0118945: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

B053_RS0118965: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.76	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.37	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002034.3	0.36	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000879.5	0.35	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000881.3	0.33	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.33	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000772.5	0.33	saccharide	lipopolysaccharide	Brucella melitensis
BGC0002255.3	0.32	PKS	lijiquinone	Ascomycota sp. F53
BGC0001865.4	0.32	PKS	elsinochrome C	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.76	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.37	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002034.3	0.36	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000879.5	0.35	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000881.3	0.33	other (other)	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001808.5	0.33	other (other)	toyocamycin	Streptomyces diastatochromogenes
BGC0000772.5	0.33	saccharide	lipopolysaccharide	Brucella melitensis
BGC0002255.3	0.32	PKS	lijiquinone	Ascomycota sp. F53
BGC0001865.4	0.32	PKS	elsinochrome C	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

B053_RS0118965: T1TS

Domain 1 (4 - 315): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.10 out of 23.79

Confidence: medium

Additional weak hits (14):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.94 out of 23.43

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.12 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.74 out of 29.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.76 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.18 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.70 out of 26.06

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.65 out of 26.12

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.43 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.47 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.72 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism

NZ_KB890938.1 - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 93,139 - 118,407 nt. (total: 25,269 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase

B053_RS0120965: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B053_RS0120970: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B053_RS0120995: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Lyases: cyclase dehydratase

B053_RS0121010: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

B053_RS0121015: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002084.4	0.56	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0001483.4	0.50	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001910.4	0.49	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001197.5	0.46	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002635.2	0.46	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001911.3	0.44	terpene	raimonol	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002084.4	0.56	ribosomal	biarylitide YYH	Planomonospora sp. ID82291
BGC0001483.4	0.50	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0001910.4	0.49	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001289.5	0.49	ribosomal	penisin	Paenibacillus ehimensis
BGC0000844.5	0.48	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0000542.3	0.46	ribosomal	paenicidin B	Paenibacillus terrae
BGC0001197.5	0.46	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002635.2	0.46	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001911.3	0.44	terpene	raimonol	Streptomyces anulatus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (5):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.42 out of 20.01

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.81 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.12 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.22 out of 30.22

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 156 - 248; Score: 57.6

TFBS definitions

Regulator	Description

NZ_KB890945.1 - Region 1 - NRPS-like,arylpolyene

Download region GenBank file

Download region SVG

Location: 1 - 31,545 nt. (total: 31,545 nt) Show pHMM detection rules used

Region on contig edge.

arylpolyene: (APE_KS1 or APE_KS2)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B053_RS0123560: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B053_RS0123625: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: methyltransferase

B053_RS0123640: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: esterase hydrolase

B053_RS0123520: asparagine synthase (glutamine-hydrolyzing)

smcogs: SMCOG1177: asparagine synthase (glutamine-hydrolyzing)

B053_RS0123530: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Ligases: ligase synthase

B053_RS0123535: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0123540: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0123545: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B053_RS0123550: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.52	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.51	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002631.2	0.41	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000885.3	0.35	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001374.5	0.34	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000867.3	0.34	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002510.2	0.33	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0002127.3	0.33	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001075.5	0.33	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001197.5	0.32	PKS	frankiamicin	Frankia sp. EAN1pec

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001275.3	0.59	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000885.3	0.49	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001374.5	0.48	other (other)	thienodolin	Streptomyces albogriseolus
BGC0000867.3	0.48	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002510.2	0.48	PKS	youssoufene A1, youssoufene B1, youssoufene B2, youssoufene B3, youssoufene B4	Streptomyces sp.
BGC0002127.3	0.48	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0001075.5	0.47	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001197.5	0.46	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 20.58 out of 23.05

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (11):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.21 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.58 out of 30.25

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.06 out of 32.93

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.99 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.62 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.89 out of 29.65

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 26.85

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.11 out of 25.75

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 19.95 out of 30.98

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

B053_RS0123535: X

AMP-binding (58..444): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GFRAHSSAIAFYLAVNLGD-----------HTTA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

B053_RS0123540: X

AMP-binding (183..574): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MGFAFGSSVLCDCSLTAGEMNCLGATEVMHVVVA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production

NZ_KB890945.1 - Region 2 - butyrolactone

Download region GenBank file

Download region SVG

Location: 41,350 - 52,219 nt. (total: 10,870 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0123710: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.83	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.82	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.42	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000188.5	0.36	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000559.4	0.35	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000515.4	0.35	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.34	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0002673.2	0.33	PKS, other (other)	iminimycin A, iminimycin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000848.5	0.83	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000849.4	0.82	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000850.5	0.69	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002578.2	0.42	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0000188.5	0.36	other (other)	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000559.4	0.35	ribosomal	subtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000515.4	0.35	ribosomal	geobacillin I	Geobacillus thermodenitrificans NG80-2
BGC0000506.4	0.34	ribosomal	entianin	Bacillus subtilis subsp. spizizenii
BGC0002673.2	0.33	PKS, other (other)	iminimycin A, iminimycin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001789.3	0.33	ribosomal	suicin 90-1330	Streptococcus suis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

No hits above weak threshold.

Weak hits (9):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.32 out of 31.73

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.66 out of 26.06

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.49 out of 19.26

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.74 out of 25.31

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 39.62

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.62 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.00 out of 26.06

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description

NZ_KB890945.1 - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 80,372 - 102,585 nt. (total: 22,214 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase hydratase

B053_RS0123950: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

B053_RS0123980: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

B053_RS0123985: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001844.4	0.41	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0000649.3	0.41	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000393.5	0.38	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.82	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.55	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001844.4	0.41	NRPS	holrhizin A, holrhizin B, holrhizin C, holrhizin D	Paraburkholderia rhizoxinica HKI 454
BGC0000649.3	0.41	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000393.5	0.38	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

B053_RS0123950: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (336 - 697): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.10 out of 27.78

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.12 out of 23.79

Confidence: medium

Additional weak hits (7):

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.74 out of 25.31

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.81 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.70 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.75 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.75 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.29 out of 28.19

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB890945.1 - Region 4 - NRP-metallophore,NRPS,PKS-like,T1PKS,terpene,transAT-PKS

Download region GenBank file

Download region SVG

Location: 105,329 - 241,057 nt. (total: 135,729 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

B053_RS0124040: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

B053_RS0124095: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B053_RS0124135: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

B053_RS0124140: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B053_RS0124150: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

B053_RS0124170: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

B053_RS0124285: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

B053_RS0124375: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Transferases: acylase

B053_RS0124070: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase

B053_RS01000000134570: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

B053_RS0124035: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

B053_RS0124255: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

B053_RS0124275: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

B053_RS0124300: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

B053_RS0124290: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

B053_RS0124015: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0124025: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0124075: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B053_RS0124080: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B053_RS0124085: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B053_RS0124090: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0124260: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0124295: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001845.2	2.25	NRPS, PKS, other (aminocoumarin)	alpiniamide	Streptomyces sp. CBMAI 2042
BGC0001268.4	1.65	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002135.2	1.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	1.57	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	1.51	NRPS	AbT1	Aureobasidium pullulans
BGC0000368.5	1.47	NRPS	griseobactin	Streptomyces sp. ATCC 700974
BGC0001273.3	1.24	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	1.22	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	1.22	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	1.21	PKS	(-)-Mellein	Parastagonospora nodorum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000368.5	0.86	NRPS	griseobactin	Streptomyces sp. ATCC 700974
BGC0001845.2	0.84	NRPS, PKS, other (aminocoumarin)	alpiniamide	Streptomyces sp. CBMAI 2042
BGC0000401.5	0.72	NRPS	paenibactin	Paenibacillus elgii B69
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001185.5	0.70	NRPS	bacillibactin	Bacillus velezensis FZB42
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000309.5	0.69	NRPS	bacillibactin	Bacillus subtilis subsp. subtilis str. 168

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.40 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 31.35 out of 32.93

Confidence: strong

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 31.91 out of 32.38

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 33.07 out of 36.53

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.23 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.44 out of 23.79

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.63 out of 27.04

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 21.41 out of 27.04

Confidence: medium

Additional weak hits (43):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.30 out of 27.78

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 17.99 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.52 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.99 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.92 out of 25.88

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.18 out of 26.33

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.29 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.42 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.14 out of 26.06

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.71 out of 27.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.31 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.10 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.28 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.17 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.38 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.90 out of 35.63

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 18.99 out of 27.04

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.73 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.45 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.29 out of 24.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.15 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.41 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.48 out of 29.65

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.13 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.46 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.07 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.45 out of 29.65

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 24.53 out of 32.38

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.23 out of 23.43

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.71 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.24 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 20.81 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.40 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.14 out of 39.62

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.87 out of 20.01

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.82 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.26 out of 26.85

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.72 out of 20.01

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.62 out of 25.75

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.45 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 4, location 105328 - 241057:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Me-mal) + (mal) + (Gly - Me-mal - Me-ccmal) + (Arg - Thr)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 105328 - 171514:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly - Me-mal - Me-ccmal) + (mal) + (Me-mal) + (mal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 163894 - 218848:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Arg - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0124015: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (13..406): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: ESALAQMHVF-PFAYYGASYNCFGQSEIGPLATV
Nearest Stachelhaus code(s):: Abu DAWFYGAPLK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

B053_RS0124025: X

AMP-binding (7..410): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSPA-------AHMIHGAAEEYYAASEGGGAFAT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

B053_RS0124070: mal

PKS_AT (4..287): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 106.5
Methoxymalonyl-CoA: 29.7
inactive: 25.5
Propionyl-CoA: 20.7
Methylmalonyl-CoA: 18.3
fatty_acid: 12.7
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

B053_RS0124080: mmal

PKS_AT (537..834): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 83.3%; Methoxymalonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 187.1
Ethylmalonyl-CoA: 183.3
Methoxymalonyl-CoA: 151.8
2-Methylbutyryl-CoA: 129.2
Malonyl-CoA: 121.1
Propionyl-CoA: 116.8
trans-1,2-CPDA: 103.4
CHC-CoA: 85.1
Isobutyryl-CoA: 84.4
Acetyl-CoA: 63.7
Benzoyl-CoA: 63.4
fatty_acid: 46.1
inactive: 34.6
3-Methylbutyryl-CoA: 27.2

B053_RS0124090: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (494..894): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FAMTFDIAALELQALCGGEWNLYGPTETTIWSAA
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

B053_RS0124260: Arg - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (473..899): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHAFDASWDPWDVVVGGEVNLYGPTETTVDAYY
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1571..1979): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQVFGGEVNMYGITETTVHVSY
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

B053_RS0124295: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (32..439): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: SGSLFPLSSPGGGLLVGGAQQVFGMAEGLVNYTR
Nearest Stachelhaus code(s):: diOH-Bz PLPGLGVVNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CsoR	Copper-responsive repressor
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
RicR	Copper-responsive regulator

NZ_KB890945.1 - Region 5 - NRP-metallophore,NRPS,terpene

Download region GenBank file

Download region SVG

Location: 242,054 - 310,912 nt. (total: 68,859 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B053_RS0124450: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

B053_RS0124555: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

B053_RS0124605: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

B053_RS0124640: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: esterase

B053_RS0124515: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Lyases: cyclase

B053_RS0124645: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

B053_RS0124525: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: transporter

B053_RS0124465: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	0.86	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.69	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.57	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.57	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002476.2	0.41	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002494.3	0.40	NRPS	vibriobactin	Vibrio cholerae
BGC0002073.3	0.38	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002531.3	0.38	NRPS	cepaciachelin	Burkholderia ambifaria AMMD

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	0.74	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.67	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002073.3	0.59	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002476.2	0.54	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002494.3	0.53	NRPS	vibriobactin	Vibrio cholerae
BGC0000674.5	0.51	terpene	(-)-δ-cadinene	Streptomyces clavuligerus ATCC 27064

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

B053_RS0124645: T1TS

Domain 1 (30 - 315): Type 1 terpene synthase

Subtype: unknown

B053_RS0124655: T2TS

Domain 1 (215 - 517): Type 2 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.90 out of 30.12

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.68 out of 30.12

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.53 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.19 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (24):

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.65 out of 26.85

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.33 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.46 out of 31.73

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.52 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.74 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.96 out of 36.54

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.72 out of 29.38

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 22.07 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.63 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.30 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 17.88 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.10 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.81 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.47 out of 36.54

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.17 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.06 out of 29.38

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.89 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.67 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 8, location 242053 - 310912:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 9, location 242053 - 300762:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0124525: Fo-OH-Orn - Thr - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (145..543): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISLNELYLWCGGEYHGYGPAETTIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1627..2040): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTHFDFAVWEGNQIFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3056..3454): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator

NZ_KB890945.1 - Region 6 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 349,709 - 400,453 nt. (total: 50,745 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer

B053_RS0124930: flavodoxin

smcogs: SMCOG1134: flavodoxin

B053_RS0125040: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

B053_RS0125045: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: aminotransferase

B053_RS01000000134590: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: lyase

B053_RS0124885: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: synthase

B053_RS0124975: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002135.2	0.59	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.58	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001641.4	0.57	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.57	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.57	NRPS	AM-toxin	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002135.2	0.63	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.63	NRPS	AbT1	Aureobasidium pullulans
BGC0001249.5	0.63	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.62	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 24.59 out of 29.72

Confidence: medium

Additional weak hits (26):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.49 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.82 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.67 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.72 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.05 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.78 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.11 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.84 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.98 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.63 out of 20.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.18 out of 21.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.42 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.73 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.41 out of 36.53

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.48 out of 27.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.64 out of 21.84

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.48 out of 27.18

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.52 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.99 out of 32.93

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.19 out of 18.57

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.42 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.73 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.98 out of 28.19

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.27 out of 30.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 11, location 349708 - 400453:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS01000000134590: X

AMP-binding (1402..1804): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWHCFDASLMEPIMLLGGELNVYGPTEATVLCVV
Nearest Stachelhaus code(s):: ndmHex DAMVLGVVAK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

B053_RS0124975: mal

PKS_AT (549..842): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 66.7%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 149.7
inactive: 82.7
Methylmalonyl-CoA: 71.7
Methoxymalonyl-CoA: 58.9
Propionyl-CoA: 46.5
Ethylmalonyl-CoA: 45.0
Isobutyryl-CoA: 29.6
2-Methylbutyryl-CoA: 24.7
trans-1,2-CPDA: 23.9
Acetyl-CoA: 23.9
fatty_acid: 13.9
3-Methylbutyryl-CoA: 10.2
CHC-CoA: 8.9
Benzoyl-CoA: 8.9

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C

NZ_KB890945.1 - Region 7 - T3PKS

Download region GenBank file

Download region SVG

Location: 406,986 - 448,119 nt. (total: 41,134 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B053_RS0125105: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B053_RS0125155: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

B053_RS0125185: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: kinase

B053_RS0125120: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

Hydrolases: glucosidase protease

B053_RS0125175: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

B053_RS0125225: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Ligases: synthase

B053_RS0125110: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

B053_RS0125115: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B053_RS0125180: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.61	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000280.5	0.53	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002711.2	0.52	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000281.3	0.52	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002476.2	0.51	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002285.2	0.49	ribosomal	aborycin	Streptomyces sp. ZS0098

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.5	0.83	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0002127.3	0.71	PKS	flaviolin, 1,3,6,8-tetrahydroxynaphthalene	Streptomyces coelicolor A3(2)
BGC0000902.4	0.67	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000285.5	0.61	PKS, saccharide	flaviolin, flaviolin rhamnoside, 3,3'-diflaviolin	Saccharopolyspora erythraea
BGC0000280.5	0.53	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002711.2	0.52	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0000281.3	0.52	PKS	2,4-diacetylphloroglucinol	Pseudomonas fluorescens
BGC0002476.2	0.51	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655
BGC0002073.3	0.50	NRPS	dehydroxynocardamine	Corynebacterium propinquum
BGC0002285.2	0.49	ribosomal	aborycin	Streptomyces sp. ZS0098

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.21 out of 27.78

Confidence: medium

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.28 out of 29.51

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.62 out of 36.53

Confidence: medium

Additional weak hits (15):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.84 out of 21.55

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.86 out of 19.52

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.12 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.50 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.92 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.49 out of 27.78

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.09 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.28 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.55 out of 27.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.54 out of 20.01

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.99 out of 25.88

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.56 out of 25.88

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.68 out of 33.14

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
DmdR1	Iron(II)-dependent repressor
DosR	Hypoxia stress response regulator

NZ_KB890946.1 - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 111,646 - 158,647 nt. (total: 47,002 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

B053_RS0126070: 3-hydroxyisobutyrate dehydrogenase

smcogs: SMCOG1100: 3-hydroxyisobutyrate dehydrogenase

B053_RS0126140: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: aminotransferase

B053_RS0126095: aminotransferase

smcogs: SMCOG1019: aminotransferase

Ligases: ligase

B053_RS0126100: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B053_RS0126110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0126160: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

B053_RS0126165: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transporter

B053_RS0126040: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.83	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.76	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.75	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.73	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.70	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.68	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.73	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.69	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.68	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.67	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.25 out of 20.47

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (14):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.55 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.67 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.35 out of 30.25

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.68 out of 27.04

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.80 out of 23.43

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.07 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.55 out of 30.25

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.81 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.03 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.87 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.86 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.89 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 111645 - 158647:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 111645 - 154825:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 116262 - 158647:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0126100: X

AMP-binding (476..871): X

nrpys: Phe, Trp, Ph-Gly, Tyr, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAYPFDMSQGEAGLMGGAEVNLYGPTEASIATTE
Nearest Stachelhaus code(s):: OH-Orn DMENMGLINK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

B053_RS0126110: X

AMP-binding (199..603): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: NDLSFDMSVYEGNSLLGGDVALGGATESSIHSTV
Nearest Stachelhaus code(s):: Lys DMYNFGLIHK (85% 8Å match); Ser DLYNLGLIHK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

B053_RS0126160: X

AMP-binding (31..444): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NFVVFGMVMGNAYGIMAGSSICYGMTETSPVSTQ
Nearest Stachelhaus code(s):: Abu or Ival DMGFIAGVVK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

B053_RS0126165: X

AMP-binding (49..448): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GATSWAKHAWSACAVAAGERDGFGQTETAVQVAN
Nearest Stachelhaus code(s):: Phe or Tyr DAACVAGVAK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB890946.1 - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 286,179 - 297,669 nt. (total: 11,491 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002387.2	0.27	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002788.2	0.26	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001377.5	0.24	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.24	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0001060.5	0.22	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.20	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000241.5	0.19	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.18	PKS	nenestatin	Micromonospora echinospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002387.2	0.27	PKS	yangpumicin A	Micromonospora yangpuensis
BGC0002788.2	0.26	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0001377.5	0.24	PKS	uncialamycin	Streptomyces uncialis
BGC0000874.5	0.24	other (other)	blasticidin S	Streptomyces griseochromogenes
BGC0001060.5	0.22	PKS	dynemicin A	Micromonospora chersina
BGC0001984.3	0.20	NRPS	sarpeptin A, sarpeptin B	Streptomyces sp.
BGC0000241.5	0.19	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.18	PKS	nenestatin	Micromonospora echinospora

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (1):

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.94 out of 19.52

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB890946.1 - Region 3 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 350,511 - 375,954 nt. (total: 25,444 nt) Show pHMM detection rules used

lanthipeptide-class-i: (((Lant_dehydr_N or Lant_dehydr_C) and cds(LANC_like and not Pkinase)) and not (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0127040: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: methyltransferase

B053_RS0127035: methyltransferase

smcogs: SMCOG1248: methyltransferase

Lyases: cyclase dehydratase

B053_RS01000000134705: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

B053_RS0127025: Lanthionine synthetase C family protein

smcogs: SMCOG1140: Lanthionine synthetase C family protein

Translocases: permease

B053_RS0127045: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.50	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000556.5	0.41	ribosomal	streptin	Streptococcus pyogenes
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000894.4	0.40	other (other)	citrinin	Monascus aurantiacus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002576.2	0.75	ribosomal	mechercharmycin	Thermoactinomyces sp.
BGC0002635.2	0.52	ribosomal	daspyromycin A, daspyromycin B	Actinokineospora diospyrosa
BGC0001289.5	0.50	ribosomal	penisin	Paenibacillus ehimensis
BGC0000560.5	0.45	ribosomal	subtilomycin	Bacillus subtilis
BGC0000542.3	0.44	ribosomal	paenicidin B	Paenibacillus terrae
BGC0000541.5	0.44	ribosomal	paenicidin A	Paenibacillus polymyxa
BGC0001727.3	0.42	ribosomal	paenilan	Paenibacillus polymyxa E681
BGC0000556.5	0.41	ribosomal	streptin	Streptococcus pyogenes
BGC0000544.4	0.41	ribosomal	planosporicin	Planomonospora alba
BGC0000894.4	0.40	other (other)	citrinin	Monascus aurantiacus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.13 out of 23.79

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.54 out of 27.04

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.42 out of 36.53

Confidence: medium

Additional weak hits (9):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.91 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.19 out of 26.85

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.13 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.80 out of 26.06

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 24.18 out of 30.98

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.42 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.57 out of 29.65

Confidence: weak

Lanthipeptides

RREFinder

TFBS Finder

Core peptide predictions

No core peptides found.

RRE predictions

: RRE type: Lanthipeptide_LanB_RRE; Location: 122 - 218; Score: 39.5

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DasR	N-acetylglucosamine dependent repressor
DmdR1	Iron(II)-dependent repressor
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NZ_KB890946.1 - Region 4 - NRPS,hydrogen-cyanide

Download region GenBank file

Download region SVG

Location: 417,435 - 461,319 nt. (total: 43,885 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
hydrogen-cyanide: (Fer2_4 and cds(Pyr_redox_2 and Fer2_BFD) and DAO)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase reductase

B053_RS0127255: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

B053_RS0127395: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

B053_RS1000000137740: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Transferases: aminotransferase

B053_RS0127410: aminotransferase

smcogs: SMCOG1019: aminotransferase

Lyases: lyase

B053_RS0127325: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase

B053_RS0127330: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002345.2	0.42	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0001135.5	0.29	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.29	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.29	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.27	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.27	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002286.3	0.27	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002174.2	0.26	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002285.2	0.26	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0000595.3	0.19	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002075.3	0.61	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0002286.3	0.61	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0002345.2	0.54	other (other)	hydrogen cyanide	Pseudomonas fluorescens
BGC0002494.3	0.50	NRPS	vibriobactin	Vibrio cholerae
BGC0002476.2	0.50	NRPS	enterobactin	Escherichia coli str. K-12 substr. MG1655

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.71 out of 26.85

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.71 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 31.19 out of 36.53

Confidence: medium

Additional weak hits (12):

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.35 out of 26.33

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.31 out of 21.55

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 22.96 out of 30.11

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 15.56 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.45 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.45 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.21 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.41 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.15 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 16.96 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.13 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 417434 - 461319:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0127330: X

AMP-binding (279..668): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWQTFDVVLRDTHTFFAGEINLYGPTETTLAKFW
Nearest Stachelhaus code(s):: Asp DVRHFALMAK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
DmdR1	Iron(II)-dependent repressor
HypR	L-hydroxyproline utilization repressor
RutR	Regulator of the pyrimidine and purine metabolism

NZ_KB890947.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 280,610 - 307,183 nt. (total: 26,574 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0128610: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

B053_RS0128645: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase transferase

B053_RS0128605: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

B053_RS0128670: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase

B053_RS0128595: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

B053_RS0128650: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.68	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002508.2	0.48	other (other)	8-azaguanine	Streptomyces pathocidini

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.68	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001839.3	0.51	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002508.2	0.48	other (other)	8-azaguanine	Streptomyces pathocidini

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

B053_RS0128635: PT_phytoene_like

Domain 1 (16 - 292): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

B053_RS0128640: PT_phytoene_like

Domain 1 (13 - 296): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → diapophytoene; FPP → squalene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

B053_RS0128650: PT_FPPS_like

Domain 1 (74 - 366): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

B053_RS0128655: T2TS

Domain 1 (26 - 652): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.16 out of 18.46

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.09 out of 23.79

Confidence: medium

Additional weak hits (5):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.37 out of 27.78

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.04 out of 29.65

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 17.16 out of 22.40

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RpoN	Regulator of nitrogen assimilation and virulence

NZ_KB890947.1 - Region 2 - thioamide-NRP

Download region GenBank file

Download region SVG

Location: 334,857 - 366,432 nt. (total: 31,576 nt) Show pHMM detection rules used

Region on contig edge.

thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

B053_RS0128845: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B053_RS0128930: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B053_RS0128970: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

B053_RS0128975: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: PPTase

B053_RS0128915: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1012: 4'-phosphopantetheinyl transferase

Lyases: decarboxylase

B053_RS0128950: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

B053_RS0128905: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

B053_RS0128920: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

B053_RS0128960: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B053_RS0128980: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002277.2	0.62	NRPS	atromentin	Suillus grevillei
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002499.2	0.49	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus
BGC0001831.3	0.47	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001163.3	0.46	PKS	1-heptadecene	Moorea producens 3L
BGC0001197.5	0.46	PKS	frankiamicin	Frankia sp. EAN1pec

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002277.2	0.62	NRPS	atromentin	Suillus grevillei
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002499.2	0.49	NRPS, PKS	enteromycin	Streptomyces achromogenes subsp. streptozoticus
BGC0001831.3	0.47	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001163.3	0.46	PKS	1-heptadecene	Moorea producens 3L
BGC0001197.5	0.46	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.49 out of 20.97

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.51 out of 25.31

Confidence: medium

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.63 out of 27.04

Confidence: medium

Additional weak hits (19):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.93 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.71 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.17 out of 28.14

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.57 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.81 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.83 out of 27.78

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.59 out of 27.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.47 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.26 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.91 out of 36.54

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.14 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.35 out of 30.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.86 out of 27.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 18.45 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.05 out of 24.78

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.04 out of 33.14

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.27 out of 35.63

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.41 out of 29.65

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.09 out of 32.93

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

B053_RS0128980: NH2

CAL_domain (39..487): NH2

minowa: NH2

Prediction, score:

NH2: 134.0
Acetyl-CoA: 48.0
fatty_acid: 14.7
AHBA: 11.4
shikimic_acid: 6.3

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
CcpA	Catabolite control protein A
DasR	N-acetylglucosamine dependent repressor
OsdR	Development and stress management regulator

NZ_KB890948.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 199,867 - 220,844 nt. (total: 20,978 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase hydrolase

B053_RS0129860: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

B053_RS0129875: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: cyclase hydratase

B053_RS0129850: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

B053_RS0129885: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002196.2	0.30	PKS	clavatol	Penicillium crustosum
BGC0000913.3	0.29	other (other)	MK-8	Enterobacter cloacae
BGC0002553.2	0.29	other (other)	tunicamycin	Rathayibacter iranicus
BGC0001866.4	0.28	PKS	viriditoxin	Byssochlamys spectabilis
BGC0002034.3	0.28	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000252.5	0.28	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0000875.4	0.28	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0000518.3	0.28	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000243.4	0.27	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0000157.5	0.27	PKS	tautomycetin	Streptomyces sp. CK4412

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002196.2	0.30	PKS	clavatol	Penicillium crustosum
BGC0000913.3	0.29	other (other)	MK-8	Enterobacter cloacae
BGC0002553.2	0.29	other (other)	tunicamycin	Rathayibacter iranicus
BGC0001866.4	0.28	PKS	viriditoxin	Byssochlamys spectabilis
BGC0002034.3	0.28	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000252.5	0.28	PKS	nonactin	Streptomyces griseus subsp. griseus
BGC0000875.4	0.28	other (nucleoside), saccharide	caprazamycin, caprazamycin aglycon	Streptomyces sp. MK730-62F2
BGC0000518.3	0.28	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000243.4	0.27	PKS	nonactin, monactin, dinactin, trinactin, tetranactin	Streptomyces griseus subsp. griseus
BGC0000157.5	0.27	PKS	tautomycetin	Streptomyces sp. CK4412

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

B053_RS0129885: T1TS

Domain 1 (1 - 305): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (10):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 17.67 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.27 out of 27.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.28 out of 28.14

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.11 out of 27.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.36 out of 20.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.43 out of 32.93

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.76 out of 23.43

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.27 out of 30.97

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 16.79 out of 19.52

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NZ_KB890950.1 - Region 1 - RRE-containing,azole-containing-RiPP,ectoine,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 105,228 - 173,964 nt. (total: 68,737 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

B053_RS0132585: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

B053_RS0132590: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: transferase

B053_RS0132490: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Hydrolases: hydrolase

B053_RS01000000134950: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

Lyases: decarboxylase dehydratase

B053_RS0132530: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

B053_RS0132655: Lantibiotic dehydratase domain protein

smcogs: SMCOG1155: Lantibiotic dehydratase domain protein

Ligases: ligase

B053_RS0132545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002116.3	0.40	ribosomal	darobactin A	Photorhabdus khanii HGB 1456
BGC0002120.3	0.39	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0001146.5	0.37	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000603.5	0.37	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000857.3	0.36	other (other)	ectoine	Methylophaga alcalica
BGC0000855.3	0.36	other (other)	ectoine	Methylomicrobium kenyense
BGC0001660.3	0.36	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0000856.3	0.36	other (other)	ectoine	Methylophaga thalassica
BGC0000616.4	0.36	ribosomal	amylocyclicin	Bacillus velezensis FZB42
BGC0000853.3	0.35	other (other)	ectoine	Streptomyces anulatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.54	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.54	other (ectoine)	ectoine	Streptomyces sp.
BGC0001860.4	0.53	ribosomal	thiomuracin	Thermobispora bispora DSM 43833
BGC0000613.5	0.53	ribosomal	thiomuracin A	Nonomuraea sp. Bp3714-39
BGC0000855.3	0.53	other (other)	ectoine	Methylomicrobium kenyense
BGC0000856.3	0.53	other (other)	ectoine	Methylophaga thalassica
BGC0000857.3	0.52	other (other)	ectoine	Methylophaga alcalica
BGC0000603.5	0.52	ribosomal	cyclothiazomycin	Streptomyces hygroscopicus
BGC0000852.5	0.51	other (other)	ectoine	Sporosarcina pasteurii
BGC0001146.5	0.51	ribosomal	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.68 out of 20.47

Confidence: medium

Additional weak hits (15):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.91 out of 19.26

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.01 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.23 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.87 out of 27.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.69 out of 19.26

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.97 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.75 out of 27.78

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.14 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.31 out of 29.65

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.77 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.26 out of 32.93

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.39 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

NRPS/PKS substrate predictions

B053_RS0132545: X

AMP-binding (11..426): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGLYQLASTNTGAQLMYGLTECKRTTIM
Nearest Stachelhaus code(s):: Asp DYYPTTMRAK (82% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

RRE predictions

: RRE type: Thiopeptide_F_RRE; Location: 37 - 116; Score: 63.0; RRE type: Heterocycloanthracin_C_RRE; Location: 36 - 120; Score: 41.1
: RRE type: Thiopeptide_F_RRE; Location: 37 - 116; Score: 63.0; RRE type: Heterocycloanthracin_C_RRE; Location: 36 - 120; Score: 41.1

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
VqsM	Regulator of quorum-sensing signalling systems

Core peptide predictions

No core peptides found.

NZ_KB890950.1 - Region 2 - PKS-like,T1PKS,t3nrps-iterative,thioamide-NRP

Download region GenBank file

Download region SVG

Location: 215,760 - 282,726 nt. (total: 66,967 nt) Show pHMM detection rules used

thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))
PKS-like: (t2pks2 or ksIII)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

B053_RS0133010: nucleotide sugar dehydrogenase

smcogs: SMCOG1152: nucleotide sugar dehydrogenase

B053_RS0133015: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: halogenase transferase

B053_RS01000000134965: halogenase

smcogs: SMCOG1119: halogenase

B053_RS0133150: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

Lyases: decarboxylase

B053_RS0133050: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Ligases: ligase synthase

B053_RS0133020: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B053_RS0133040: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B053_RS0133045: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

B053_RS0133085: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	1.32	PKS	oronofacic acid	Pseudomonas syringae
BGC0002154.2	1.20	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	1.20	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	1.15	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	1.13	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.12	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	1.11	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	1.10	PKS	FR901512	fungal sp. No.14919
BGC0001825.4	1.07	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001268.4	1.06	NRPS, PKS	fusarin C	Fusarium fujikuroi

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	0.66	PKS	oronofacic acid	Pseudomonas syringae
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.64	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.62	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001825.4	0.60	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.24 out of 19.26

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (9):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.31 out of 21.55

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 23.39 out of 30.22

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.20 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.51 out of 29.65

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.58 out of 26.12

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.17 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.24 out of 28.19

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 215759 - 282726:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ccmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

B053_RS0133035: mal

PKS_AT (561..859): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 75.0%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 201.0
inactive: 87.9
Methoxymalonyl-CoA: 65.8
Methylmalonyl-CoA: 54.4
Acetyl-CoA: 34.4
Propionyl-CoA: 28.4
Isobutyryl-CoA: 28.3
Benzoyl-CoA: 22.9
Ethylmalonyl-CoA: 20.4
trans-1,2-CPDA: 18.7
CHC-CoA: 17.9
2-Methylbutyryl-CoA: 12.9
fatty_acid: 8.5
3-Methylbutyryl-CoA: 0.0

B053_RS0133085: X

AMP-binding (11..408): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAILFDYGLYQLAATNTGAQVMFGLTECKRATIM
Nearest Stachelhaus code(s):: Asp DYYPTTMRAK (88% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems