GCF_000317515.1 - 11 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NC_019738.1 (Allocoleopsis franciscana PCC 7113 (Microcoleus sp. PCC 7113))

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	azole-containing-RiPP	1,167,444	1,189,702
Region 1.2	NRPS,T1PKS,NRP-metallophore	1,982,830	2,063,198	Medium	anachelin	NRPS:Type I+PKS
Region 1.3	NRPS	2,400,980	2,469,774	Low	gramicidin	NRPS:Type I
Region 1.4	RiPP-like	2,995,017	3,006,969
Region 1.5	terpene	3,102,076	3,123,005
Region 1.6	lanthipeptide-class-ii	3,474,911	3,498,240
Region 1.7	terpene-precursor	3,660,001	3,680,930
Region 1.8	thioamitides	4,484,096	4,506,812
Region 1.9	NRPS-like	4,644,034	4,687,909
Region 1.10	terpene-precursor	6,478,177	6,499,763
Region 1.11	terpene	6,936,984	6,960,372

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	azole-containing-RiPP	1,167,444	1,189,702
Region 1.2	NRPS,T1PKS,NRP-metallophore	1,982,830	2,063,198	Medium	anachelin	NRPS:Type I+PKS
Region 1.3	NRPS	2,400,980	2,469,774	Low	gramicidin	NRPS:Type I
Region 1.4	RiPP-like	2,995,017	3,006,969
Region 1.5	terpene	3,102,076	3,123,005
Region 1.6	lanthipeptide-class-ii	3,474,911	3,498,240
Region 1.7	terpene-precursor	3,660,001	3,680,930
Region 1.8	thioamitides	4,484,096	4,506,812
Region 1.9	NRPS-like	4,644,034	4,687,909
Region 1.10	terpene-precursor	6,478,177	6,499,763
Region 1.11	terpene	6,936,984	6,960,372

No secondary metabolite regions were found in these records:: NC_019739.1 (Allocoleopsis franciscana PCC 7113 (Microcoleus sp. PCC 7113)); NC_019760.1 (Allocoleopsis franciscana PCC 7113 (Microcoleus sp. PCC 7113)); NC_019740.1 (Allocoleopsis franciscana PCC 7113 (Microcoleus sp. PCC 7113)); NC_019761.1 (Allocoleopsis franciscana PCC 7113 (Microcoleus sp. PCC 7113)); NC_019741.1 (Allocoleopsis franciscana PCC 7113 (Microcoleus sp. PCC 7113)); NC_019742.1 (Allocoleopsis franciscana PCC 7113 (Microcoleus sp. PCC 7113)); NC_019762.1 (Allocoleopsis franciscana PCC 7113 (Microcoleus sp. PCC 7113)); NC_019743.1 (Allocoleopsis franciscana PCC 7113 (Microcoleus sp. PCC 7113))

Compact view

NC_019738.1 - Region 1 - azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 1,167,444 - 1,189,702 nt. (total: 22,259 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.42	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001222.3	0.40	ribosomal	acidocin B	Lactobacillus acidophilus
BGC0000491.5	0.40	ribosomal	gassericin A	Lactobacillus gasseri
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0000565.5	0.39	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000483.5	0.38	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0001684.3	0.38	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0002551.2	0.36	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002115.3	0.42	ribosomal	streptamidine	Streptomyces albidoflavus J1074
BGC0000501.3	0.40	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001222.3	0.40	ribosomal	acidocin B	Lactobacillus acidophilus
BGC0000491.5	0.40	ribosomal	gassericin A	Lactobacillus gasseri
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0000565.5	0.39	ribosomal	goadsporin	Streptomyces sp. TP-A0584
BGC0000483.5	0.38	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0001684.3	0.38	other (other)	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0002551.2	0.36	other (other), ribosomal, terpene	muscoride A, muscoride B	Nostoc sp. UHCC-0398

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.16 out of 26.06

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.78 out of 24.78

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (9):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.28 out of 31.73

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.57 out of 36.53

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 21.79 out of 26.06

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.77 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.94 out of 32.93

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.79 out of 29.65

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.61 out of 30.11

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

RREFinder

TFBS Finder

Azole RiPPs

RRE predictions

: RRE type: NHLP_CD_RRE; Location: 2 - 93; Score: 69.1; RRE type: Cyanobactin_D_RRE; Location: 6 - 80; Score: 59.1; RRE type: Goadsporin_CD_RRE; Location: 6 - 83; Score: 46.2

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

Core peptide predictions

No core peptides found.

NC_019738.1 - Region 2 - NRP-metallophore,NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 1,982,830 - 2,063,198 nt. (total: 80,369 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

MIC7113_RS08470: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

MIC7113_RS08505: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MIC7113_RS08515: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

Hydrolases: esterase phosphatase

MIC7113_RS08460: thioesterase

smcogs: SMCOG1004: thioesterase

MIC7113_RS08500: FkbH like protein

smcogs: SMCOG1256: FkbH like protein

Lyases: decarboxylase

MIC7113_RS08485: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

Isomerases: isomerase

MIC7113_RS08550: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

MIC7113_RS08475: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MIC7113_RS08480: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MIC7113_RS08490: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MIC7113_RS08495: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MIC7113_RS08520: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MIC7113_RS08525: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MIC7113_RS08530: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

MIC7113_RS08545: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	1.18	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	1.16	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	1.15	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	1.14	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	1.10	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	1.10	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	1.09	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	1.08	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	1.03	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	1.03	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001132.4	0.71	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.70	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0001758.4	0.69	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001641.4	0.67	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 24.45 out of 26.06

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.78 out of 20.97

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.54 out of 26.33

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.40 out of 27.55

Confidence: medium

Additional weak hits (6):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.37 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.71 out of 29.38

Confidence: weak

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 21.31 out of 29.72

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.55 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.91 out of 31.73

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.41 out of 29.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 2, location 1982829 - 2063198:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys) + (ohmal) + (Cys - D-Ser) + (bAla) + (ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MIC7113_RS08475: X

AMP-binding (501..903): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: GWLTFVDSVWEAVLITSGEINLYGSSEVSANVTY
Nearest Stachelhaus code(s):: bAla VDWVISLADK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

MIC7113_RS08480: mal

PKS_AT (539..841): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 170.8
inactive: 111.0
Methoxymalonyl-CoA: 71.7
Methylmalonyl-CoA: 54.6
Propionyl-CoA: 44.2
2-Methylbutyryl-CoA: 27.1
Isobutyryl-CoA: 24.4
Ethylmalonyl-CoA: 23.1
CHC-CoA: 23.0
Acetyl-CoA: 19.7
Benzoyl-CoA: 19.5
trans-1,2-CPDA: 12.1
3-Methylbutyryl-CoA: 10.0
fatty_acid: 0.0

MIC7113_RS08490: bAla

Search NORINE for peptide: strict or relaxed

AMP-binding (473..906): bAla

nrpys: bAla

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFVDSVWEGVLVTSGELNLYGSSEVSADVTC
Nearest Stachelhaus code(s):: bAla VDWVVSLADK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

MIC7113_RS08495: Cys - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (530..930): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSMLSGDISLGGATEASIWSIL
Nearest Stachelhaus code(s):: Cys DLYNMSLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1591..1991): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: ser (Ser)
Single AA prediction:: ser (Ser)

Stachelhaus prediction details:

Stachelhaus sequence:: RWMTFDVSVWEWHFICSGEHNLYGPTEAAIDVTF
Nearest Stachelhaus code(s):: Ser DVWHISLIDK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

MIC7113_RS08520: mal

PKS_AT (521..850): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 159.5
inactive: 103.3
Methoxymalonyl-CoA: 68.1
Methylmalonyl-CoA: 52.5
Isobutyryl-CoA: 34.0
Propionyl-CoA: 31.2
Benzoyl-CoA: 28.3
Ethylmalonyl-CoA: 25.7
2-Methylbutyryl-CoA: 20.0
CHC-CoA: 15.8
3-Methylbutyryl-CoA: 14.6
Acetyl-CoA: 14.2
trans-1,2-CPDA: 0.0
fatty_acid: 0.0

MIC7113_RS08525: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (557..957): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNSLLSGDISLGGATEASIWSIL
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MIC7113_RS08545: X

AMP-binding (26..415): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CRYVYGLGNT-MFGISAAECEGIGTTEFLHIFLA
Nearest Stachelhaus code(s):: Sma GLTSVAGNFK (32% 8Å match); Pro DMTFSAGIIK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
CcpA	Catabolite control protein A
GnfM	Regulator of nitrogen-fixation genes
MogR	Repressor of flagellar motility genes
ToxT	Regulator of MSHA biosynthesis

NC_019738.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 2,400,980 - 2,469,774 nt. (total: 68,795 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase

MIC7113_RS10270: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

MIC7113_RS10425: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Isomerases: isomerase racemase

MIC7113_RS10390: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

MIC7113_RS10400: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

MIC7113_RS10275: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MIC7113_RS10310: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MIC7113_RS10385: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MIC7113_RS10405: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.74	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.73	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.70	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.14 out of 23.43

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.48 out of 29.72

Confidence: medium

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 23.32 out of 30.25

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 23.25 out of 29.72

Confidence: medium

Additional weak hits (9):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.45 out of 29.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 23.31 out of 31.73

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.44 out of 36.53

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.96 out of 27.04

Confidence: weak

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 20.21 out of 30.11

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 27.34 out of 39.62

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.27 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.47 out of 32.74

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.25 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 2400979 - 2469774:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile) + (NMe-X) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MIC7113_RS10275: Ile

Search NORINE for peptide: strict or relaxed

AMP-binding (502..908): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: ile (Ile)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTSFDAATFEGFLLFGGESHVYGPTEGTTFSSF
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

MIC7113_RS10310: X

AMP-binding (548..950): X

nrpys: Leu, 3OH-Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: LWHAFDACGWEPFLLTGGDVNNYGLTETTVVATS
Nearest Stachelhaus code(s):: Leu or 3OH-Leu DAWFLGNVVK (94% 8Å match); Leu DAWFLGNVVK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

MIC7113_RS10385: X

AMP-binding (481..893): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LAQAFDASIFEMTLISAGEFNAYGPTEATVWSTV
Nearest Stachelhaus code(s):: Phe DAFTVAAVWK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

MIC7113_RS10405: X

AMP-binding (48..365): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NNSS----LMQRSLLLGGAAPTYGMTETASQVVT
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
ColR	Phenol-responsive regulator
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis

NC_019738.1 - Region 4 - RiPP-like

Download region GenBank file

Download region SVG

Location: 2,995,017 - 3,006,969 nt. (total: 11,953 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.39	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.39	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.39	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000598.5	0.37	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0000469.6	0.37	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0002699.2	0.36	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001753.3	0.31	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0001148.5	0.31	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0000986.5	0.24	NRPS, PKS	dkxanthene 530, dkxanthene 556, dkxanthene, dkxanthene 504, dkxanthene 508, dkxanthene 518, dkxanthene 520, dkxanthene 534, dkxanthene 544, dkxanthene 548, dkxanthene 560, dkxanthene 574, dkxanthene 586	Stigmatella aurantiaca DW4/3-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.4	0.41	other (other)	chuangxinmycin	Actinoplanes tsinanensis
BGC0000468.5	0.39	ribosomal	bottromycin A2	Streptomyces bottropensis DSM40262
BGC0001157.6	0.39	ribosomal	bottromycin A2	Streptomyces scabiei 87.22
BGC0000470.6	0.39	ribosomal	bottromycin D	Streptomyces sp. WMMB272
BGC0000598.5	0.37	ribosomal	polytheonamide A, polytheonamide B	Candidatus Entotheonella factor
BGC0000469.6	0.37	ribosomal	bottromycin A2	Streptomyces sp. BC16019
BGC0002699.2	0.36	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001753.3	0.31	ribosomal	radamycin, globimycin	Streptomyces globisporus subsp. globisporus
BGC0001148.5	0.31	NRPS, ribosomal	pheganomycin	Streptomyces cirratus
BGC0000986.5	0.24	NRPS, PKS	dkxanthene 530, dkxanthene 556, dkxanthene, dkxanthene 504, dkxanthene 508, dkxanthene 518, dkxanthene 520, dkxanthene 534, dkxanthene 544, dkxanthene 548, dkxanthene 560, dkxanthene 574, dkxanthene 586	Stigmatella aurantiaca DW4/3-1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.62 out of 27.78

Confidence: medium

RREFinder

TFBS Finder

RRE predictions

: RRE type: Proteusin_Methyltransferase_RRE; Location: 518 - 601; Score: 72.1

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria

NC_019738.1 - Region 5 - terpene

Download region GenBank file

Download region SVG

Location: 3,102,076 - 3,123,005 nt. (total: 20,930 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MIC7113_RS13085: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.46	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000640.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000646.5	0.39	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.38	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000527.5	0.38	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0000641.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.46	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000640.3	0.40	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000646.5	0.39	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.38	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000527.5	0.38	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000043.5	0.37	PKS	curacin A	Moorea producens 19L
BGC0000641.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000639.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0001456.3	0.37	terpene	isorenieratene	Streptomyces argillaceus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none
triterpene		PSPP	C30	acyclic	PP
triterpene	C30 carotenoid	diapophytoene	C30	acyclic	none
tetraterpene	C40 carotenoid	phytoene	C40	acyclic	none
triterpene		hydroxysqualene	C30	acyclic	OH

Genes with terpene domains:

MIC7113_RS13080: PT_phytoene_like

Domain 1 (18 - 307): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → PSPP; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

Additional weak hits (3):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.86 out of 30.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 23.53 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.70 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PP	Diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
MexT	Global virulence regulator

NC_019738.1 - Region 6 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 3,474,911 - 3,498,240 nt. (total: 23,330 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

MIC7113_RS14510: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.54	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000525.5	0.51	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001579.4	0.49	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001660.3	0.47	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001210.5	0.47	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002699.2	0.46	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001685.3	0.46	other (other)	N-acyloxyacyl lysine	Raoultella ornithinolytica 10-5246
BGC0000503.5	0.45	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000527.5	0.43	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.54	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000525.5	0.51	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001579.4	0.49	ribosomal	duramycin	Streptomyces cinnamoneus
BGC0000528.5	0.47	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001660.3	0.47	ribosomal	mathermycin	Marinactinospora thermotolerans
BGC0001210.5	0.47	ribosomal	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0002699.2	0.46	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0001685.3	0.46	other (other)	N-acyloxyacyl lysine	Raoultella ornithinolytica 10-5246
BGC0000503.5	0.45	ribosomal	cinnamycin	Streptomyces cinnamoneus
BGC0000527.5	0.43	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for MIC7113_RS14510

MIC7113_RS14485

Leader:

MSNADIIRAWKDEDYRASLSDEQKALLPENPVGLIELSDEDLSSVSGG

Core:

CTPCGNPLHTRIACFADTIATDIA

Core with dehydrations:

CysDhbPCysGNPLHDhbRIACysFADDhbIADhbDIA

antiSMASH-DB 4.0 matches for MIC7113_RS14485

100.0%

NC_019738.1:

Lanthipeptides: MIC7113_RS14485_lanthipeptide

1

CTPCGNPLHTRIACFADTIATDIA

24

CTPCGNPLHTRIACFADTIATDIA

1

CTPCGNPLHTRIACFADTIATDIA

24

37.0%

NC_019684.1and 1 other:

NZ_CP034058.1 Lanthipeptides: EH233_RS23850_lanthipeptide

Lanthipeptides: NOS7524_RS02390_lanthipeptide

1

CTPCGNPLHTRI

12

CT CGNPLHT I

1

CTTCGNPLHTPI

12

34.6%

NZ_CP051206.1:

Lanthipeptides: HGD76_RS14160_lanthipeptide

1

CTPCGNPLHT

10

CT CGNPLHT

1

CTTCGNPLHT

10

with 4 more sequence matches

29.2%

NZ_QUCI01000001.1:

Lanthipeptides: allorf_220218_220367_lanthipeptide

3

PCGNPLHTRIACFADTIATDI

23

P G+P H RI C ++ ++

1

PRGSPSHKRI-CLLYSVVKEL

20

28.0%

NZ_CP060140.1and 1 other:

NZ_VIKW01000003.1 Lanthipeptides: FJR04_RS03310_lanthipeptide

Lanthipeptides: BDGGKGIB_RS05565_lanthipeptide

1

CTPCGNPLHT

10

CT CG+P HT

1

CTTCGDPFHT

10

24.1%

NZ_CP095072.1:

Lanthipeptides: MUN88_RS06690_lanthipeptide

12

IACFADTIATDIA

24

ACF +TIA+ I+

13

FACFGNTIASTIS

25

12.3%

NZ_CP018937.1and 13 others:

NZ_CP018937.1 Lanthipeptides: BUN20_RS17050_lanthipeptideNZ_CP037440.1 Lanthipeptides: IB64_RS01195_lanthipeptideNZ_CP037440.1 Lanthipeptides: IB64_RS01195_lanthipeptideNZ_CP080296.1 Lanthipeptides: K0E65_RS01140_lanthipeptideNZ_CP080296.1 Lanthipeptides: K0E65_RS01140_lanthipeptideNZ_JADKYL010000013.1 Lanthipeptides: ISX59_RS17325_lanthipeptideNZ_JADKYL010000013.1 Lanthipeptides: ISX59_RS17325_lanthipeptideNZ_JADNBK010000016.1 Lanthipeptides: I2C48_RS13935_lanthipeptideNZ_JADNBK010000016.1 Lanthipeptides: I2C48_RS13935_lanthipeptideNZ_JAFKPO010000008.1 Lanthipeptides: K5L50_RS18715_lanthipeptideNZ_JAFKPO010000008.1 Lanthipeptides: K5L50_RS18715_lanthipeptideNZ_QRZH01000013.1 Lanthipeptides: DWW08_RS14950_lanthipeptideNZ_QRZH01000013.1 Lanthipeptides: DWW08_RS14950_lanthipeptide

Lanthipeptides: BUN20_RS17050_lanthipeptide

2

TPCGNPLHTRIACF

15

T CGNP +AC

13

TVCGNPTTETVACL

26

MIC7113_RS34760

Leader:

NPSSDLQIARISNISHWYFERVVFPGDLLLFEAVAGA

Core:

TLEIYSGDDITTLLSDRIPCESLQITTPNYSIS

Core with dehydrations:

DhbLEIYDhaGDDIDhbDhbLLDhaDRIPCysEDhaLQIDhbDhbPNYDhaIDha

antiSMASH-DB 4.0 matches for MIC7113_RS34760

100.0%

NC_019738.1:

Lanthipeptides: MIC7113_RS34760_lanthipeptide

1

TLEIYSGDDITTLLSDRIPCESLQITTPNYSIS

33

TLEIYSGDDITTLLSDRIPCESLQITTPNYSIS

1

TLEIYSGDDITTLLSDRIPCESLQITTPNYSIS

33

25.0%

NZ_JH600294.1:

Lanthipeptides: allorf_051692_051835_lanthipeptide

8

DDITTLLSDRIPCESLQITTP

28

D+I+ + SDRI + +ITTP

17

DNISRMPSDRIHVKPKRITTP

37

allorf_3484475_3484621

Leader:

MLNGDVRDSLTCMGTLTAHCGIIISFAAEVFGK

Core:

SGSVRRSVRCLLKVL

Core with dehydrations:

DhaGDhaVRRDhaVRCysLLKVL

antiSMASH-DB 4.0 matches for allorf_3484475_3484621

100.0%

NC_019738.1:

Lanthipeptides: allorf_3484475_3484621_lanthipeptide

1

SGSVRRSVRCLLKVL

15

SGSVRRSVRCLLKVL

1

SGSVRRSVRCLLKVL

15

24.1%

NZ_FZOF01000076.1:

Lanthipeptides: allorf_3532_3681_lanthipeptide

3

SVRRSVRCLLK

13

VRRS RC L+

16

PVRRSPRCPLR

26

allorf_3488315_3488419

Leader:

MIMIIILIVESVVFS

Core:

REQLDSRERVELCQSQRSR

Core with dehydrations:

REQLDDhaRERVELCysQDhaQRDhaR

antiSMASH-DB 4.0 matches for allorf_3488315_3488419

100.0%

NC_019738.1:

Lanthipeptides: allorf_3488315_3488419_lanthipeptide

1

REQLDSRERVELCQSQRSR

19

REQLDSRERVELCQSQRSR

1

REQLDSRERVELCQSQRSR

19

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 23.79 out of 27.55

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 28.07 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 27.23 out of 29.38

Confidence: strong

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 27.74 out of 32.74

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 27.55 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 29.38 out of 29.38

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.68 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 26.08 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.53 out of 29.38

Confidence: medium

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 25.99 out of 33.73

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 24.99 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.69 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.68 out of 29.38

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.00 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 22.98 out of 28.19

Confidence: medium

Additional weak hits (13):

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.79 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.05 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.37 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.36 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.22 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.42 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.34 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.24 out of 28.14

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.99 out of 32.74

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.46 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.73 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.80 out of 28.14

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

MIC7113_RS14485 - Class II

Cleavage pHMM score: -3.20

RODEO score: 0

Monoisotopic mass: 2431.2 Da

Molecular weight: 2432.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2450.8 Da N = 1

MIC7113_RS34760 - Class II

Cleavage pHMM score: -3.90

RODEO score: 0

Monoisotopic mass: 3477.8 Da

Molecular weight: 3479.8 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3497.8 Da N = 1; 3515.9 Da N = 2; 3533.9 Da N = 3; 3551.9 Da N = 4; 3569.9 Da N = 5; 3587.9 Da N = 6; 3606.0 Da N = 7; 3624.0 Da N = 8; 3642.0 Da N = 9

allorf_3484475_3484621 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 1618.0 Da

Molecular weight: 1619.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1637.0 Da N = 1; 1655.0 Da N = 2

allorf_3488315_3488419 - Class II

Cleavage pHMM score: -5.80

RODEO score: 0

Monoisotopic mass: 2320.2 Da

Molecular weight: 2321.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2339.5 Da N = 1; 2357.6 Da N = 2

TFBS definitions

Regulator	Description
FuR variant 1	Ferric Uptake Regulator
FuR variant 2	Ferric Uptake Regulator
GnfM	Regulator of nitrogen-fixation genes
HipB	Bacterial antitoxin HipB
ZuR variant 1	Zinc-responsive repressor

NC_019738.1 - Region 7 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 3,660,001 - 3,680,930 nt. (total: 20,930 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthetase

MIC7113_RS15380: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MIC7113_RS15410: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002397.2	0.48	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.45	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001668.4	0.39	NRPS	microperfuranone	Aspergillus nidulans FGSC A4
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001605.3	0.35	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002706.2	0.34	NRPS	saframycin Mx1	Myxococcus xanthus
BGC0000871.4	0.34	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.52	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002397.2	0.48	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.45	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002398.2	0.39	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0001668.4	0.39	NRPS	microperfuranone	Aspergillus nidulans FGSC A4
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001605.3	0.35	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002706.2	0.34	NRPS	saframycin Mx1	Myxococcus xanthus
BGC0000871.4	0.34	other (nucleoside)	VEPE, AEPE, TG-1	Myxococcus xanthus DK 1622

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

MIC7113_RS15410: PT_FPPS_like

Domain 1 (45 - 309): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, bacterial or Geranylgeranyl diphosphate synthase or geranylfarnesyl diphosphate synthase, bacterial

Transcription Factor Binding Sites

Binding sites found:

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.79 out of 27.78

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 22.64 out of 26.06

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.40 out of 22.40

Confidence: strong

Additional weak hits (3):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.36 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.71 out of 30.25

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 19.82 out of 30.12

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
HypR	L-hydroxyproline utilization repressor
MogR	Repressor of flagellar motility genes

NC_019738.1 - Region 8 - thioamitides

Download region GenBank file

Download region SVG

Location: 4,484,096 - 4,506,812 nt. (total: 22,717 nt) Show pHMM detection rules used

thioamitides: ((YcaO or TIGR03604) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

MIC7113_RS18705: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.46	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.45	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001696.5	0.40	ribosomal	neothioviridamide	Streptomyces sp.
BGC0001802.5	0.40	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0000625.5	0.38	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0000255.5	0.37	PKS	pederin	Uncultured bacterium
BGC0000483.5	0.37	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0002669.2	0.34	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000477.3	0.34	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001849.4	0.46	ribosomal	thiovarsolin A, thiovarsolin B, thiovarsolin C, thiovarsolin D	Streptomyces varsoviensis
BGC0002560.3	0.45	ribosomal	thiostreptamide S4	Streptomyces sp. NRRL S-4
BGC0001696.5	0.40	ribosomal	neothioviridamide	Streptomyces sp.
BGC0001802.5	0.40	ribosomal	thioholgamide A, thioholgamide B	Streptomyces malaysiense
BGC0000625.5	0.38	ribosomal	thioviridamide	Streptomyces olivoviridis
BGC0000255.5	0.37	PKS	pederin	Uncultured bacterium
BGC0000483.5	0.37	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002120.3	0.37	ribosomal	nocathioamide A	Nocardia terpenica IFM 0706
BGC0002669.2	0.34	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0000477.3	0.34	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 23.06 out of 26.06

Confidence: medium

Additional weak hits (1):

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.18 out of 29.51

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CatR	H2O2-responsive repressor
MogR	Repressor of flagellar motility genes

NC_019738.1 - Region 9 - NRPS-like

Download region GenBank file

Download region SVG

Location: 4,644,034 - 4,687,909 nt. (total: 43,876 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

MIC7113_RS19255: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: dehalogenase

MIC7113_RS19375: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase

MIC7113_RS33590: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

MIC7113_RS19310: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.61	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.61	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0002164.2	0.61	NRPS	peramine	Epichloe festucae
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0002276.2	0.60	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001758.4	0.59	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.97 out of 27.78

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.45 out of 26.85

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 22.65 out of 27.78

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.00 out of 27.55

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

Additional weak hits (4):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.87 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.86 out of 26.06

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 25.75 out of 39.62

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 4644033 - >4687909:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Gly)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MIC7113_RS33590: Gly

Search NORINE for peptide: strict or relaxed

AMP-binding (32..453): Gly

nrpys: Gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: gly (Gly)

Stachelhaus prediction details:

Stachelhaus sequence:: FSMTFDIAALELQALCGGEWNMYGPTETTIWSAV
Nearest Stachelhaus code(s):: Gly DILQLGMIWK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
GnfM	Regulator of nitrogen-fixation genes
HypR	L-hydroxyproline utilization repressor
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis

NC_019738.1 - Region 10 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 6,478,177 - 6,499,763 nt. (total: 21,587 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: glycosyltransferase

MIC7113_RS26690: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Isomerases: mutase

MIC7113_RS26705: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthetase

MIC7113_RS26680: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000646.5	0.38	terpene	β-carotein	uncultured bacterium
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001521.3	0.37	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000286.3	0.34	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001529.5	0.34	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0000677.5	0.41	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000646.5	0.38	terpene	β-carotein	uncultured bacterium
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0001521.3	0.37	NRPS	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000665.5	0.36	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0000286.3	0.34	PKS	viguiepinol	Streptomyces sp. KO-3988
BGC0001529.5	0.34	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

MIC7113_RS26680: PT_FPPS_like

Domain 1 (214 - 493): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.04 out of 18.57

Confidence: strong

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.58 out of 20.97

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.08 out of 24.78

Confidence: medium

Additional weak hits (3):

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.02 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 21.69 out of 28.14

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
LexA variant 2	Repressor of DNA damage response
ToxT	Regulator of MSHA biosynthesis

NC_019738.1 - Region 11 - terpene

Download region GenBank file

Download region SVG

Location: 6,936,984 - 6,960,372 nt. (total: 23,389 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000670.4	0.37	terpene	thalianol, thaliandiol, thalianin	Arabidopsis thaliana
BGC0000663.5	0.36	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001363.5	0.36	NRPS, PKS	ralsolamycin	Ralstonia solanacearum GMI1000
BGC0000624.3	0.35	ribosomal	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0000488.4	0.32	ribosomal	circularin A	Clostridium beijerinckii
BGC0002668.2	0.31	ribosomal	cesin A	Clostridium estertheticum
BGC0001630.4	0.31	NRPS, PKS	kasumigamide	uncultured Candidatus Entotheonella sp.
BGC0001716.4	0.31	NRPS	odilorhabdin NOSO-95A, odilorhabdin NOSO-95B, odilorhabdin NOSO-95C	Xenorhabdus nematophila AN6/1
BGC0001788.3	0.31	ribosomal	suicin 65	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0000670.4	0.37	terpene	thalianol, thaliandiol, thalianin	Arabidopsis thaliana
BGC0000663.5	0.36	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001363.5	0.36	NRPS, PKS	ralsolamycin	Ralstonia solanacearum GMI1000
BGC0000624.3	0.35	ribosomal	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0000488.4	0.32	ribosomal	circularin A	Clostridium beijerinckii
BGC0002668.2	0.31	ribosomal	cesin A	Clostridium estertheticum
BGC0001630.4	0.31	NRPS, PKS	kasumigamide	uncultured Candidatus Entotheonella sp.
BGC0001716.4	0.31	NRPS	odilorhabdin NOSO-95A, odilorhabdin NOSO-95B, odilorhabdin NOSO-95C	Xenorhabdus nematophila AN6/1
BGC0001788.3	0.31	ribosomal	suicin 65	Streptococcus suis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

MIC7113_RS28650: T2TS

Domain 1 (4 - 636): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

MIC7113_RS28655: PT_phytoene_like

Domain 1 (10 - 207): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Transcription Factor Binding Sites

Binding sites found:

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 23.46 out of 29.25

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.06 out of 24.78

Confidence: medium

Additional weak hits (5):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.56 out of 29.38

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 25.27 out of 31.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.41 out of 32.74

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.28 out of 32.74

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.92 out of 27.18

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response
SypG	Regulator of biofilm formation and host colonization