GCF_000177195.2 - 25 region(s)

Download region SVG

Location: 183,422 - 233,810 nt. (total: 50,389 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

SACTE_RS00880: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

SACTE_RS00945: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase

SACTE_RS00825: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Lyases: dehydratase

SACTE_RS00895: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001833.4	0.72	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.71	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.71	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.70	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.90 out of 23.79

Confidence: medium

Additional weak hits (13):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.20 out of 32.74

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.10 out of 20.01

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.65 out of 20.97

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.28 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.69 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.11 out of 30.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.42 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.99 out of 27.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.34 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.92 out of 29.65

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.40 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.18 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 183421 - 233810:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - OH-Orn - Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

SACTE_RS00825: X - OH-Orn - Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (477..872): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDASWDPWETALGGEFNYYGPTETTVDAVT
Nearest Stachelhaus code(s):: Lys DADDAGTVDK (74% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1541..1939): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LGHAFDASWDPWETALGGEWNLYGPTETTVDSVM
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (76% 8Å match); Lys DADDAGTVDK (71% 8Å match); OH-Orn DAQEGGLVDK (71% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2604..3000): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: LHHAFDAAWDPWESVLGGELNFYGPTEATVDTLT
Nearest Stachelhaus code(s):: Arg DADDVGLVDK (68% 8Å match); Lys DADDGGFVDK (56% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NC_015953.1 - Region 2 - T2PKS,terpene

Download region SVG

Location: 239,875 - 312,390 nt. (total: 72,516 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

SACTE_RS01005: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

SACTE_RS01200: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

SACTE_RS01240: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

SACTE_RS01285: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

SACTE_RS01295: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

Transferases: acetyltransferase methyltransferase

SACTE_RS01020: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

SACTE_RS01160: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: hydrolase

SACTE_RS01065: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

SACTE_RS01225: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase

SACTE_RS01140: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

SACTE_RS01165: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

SACTE_RS01170: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: ligase synthase

SACTE_RS01180: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

SACTE_RS01185: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

SACTE_RS01210: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

SACTE_RS01215: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	1.14	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000271.5	0.92	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.88	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.81	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.55	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.52	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.48	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.47	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0001273.3	0.45	PKS	asperlactone	Aspergillus ochraceus
BGC0000275.4	0.44	PKS	tetracenomycin C	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001181.4	0.83	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0000271.5	0.79	PKS	spore pigment	Streptomyces avermitilis
BGC0000272.3	0.74	PKS	spore pigment	Streptomyces collinus
BGC0000215.5	0.72	PKS	curamycin	Streptomyces cyaneus
BGC0000231.5	0.61	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001513.3	0.61	PKS	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.5	0.57	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001197.5	0.57	PKS	frankiamicin	Frankia sp. EAN1pec

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene		germacradienol	C15	C1-C10	OH
sesquiterpene		geosmin	C12	C1-C10	OH

Genes with terpene domains:

SACTE_RS01140: T1TS + T1TS

Domain 1 (2 - 326): Type 1 terpene synthase

Subtype: Geosmin synthase, N terminal domain

Reactions:: FPP → germacradienol

Domain 2 (337 - 697): Type 1 terpene synthase

Subtype: Geosmin synthase, C terminal domain

Reactions:: germacradienol → geosmin

Transcription Factor Binding Sites

Binding sites found:

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 28.65 out of 30.11

Confidence: strong

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 29.02 out of 30.11

Confidence: strong

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.76 out of 23.05

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.03 out of 20.97

Confidence: medium

CelR

Description: Cellobiose uptake repressor
Species: Streptomyces coelicolor
Score: 25.17 out of 30.11

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.25 out of 26.85

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.21 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.93 out of 23.79

Confidence: medium

Additional weak hits (18):

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.34 out of 36.54

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 16.06 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.33 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.05 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.72 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.17 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.32 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.03 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.89 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.24 out of 28.19

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.97 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.95 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.94 out of 33.14

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.33 out of 33.14

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.34 out of 27.04

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

Type II PKS

Terpene

TFBS Finder

NRPS/PKS substrate predictions

SACTE_RS01210: X

AMP-binding (82..332): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SAAVYGLFTGGGMIIFGAEVDIYGLSE----VMG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

SACTE_RS01215: Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (13..406): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: ESALAQMHVF-PFAYYGASYNCFGQSEIGPLAMV
Nearest Stachelhaus code(s):: Abu DAWFYGAPLK (21% 8Å match)
Stachelhaus code match:: 60% (weak)

Type II PKS gene cluster prediction details

Cluster section:: 239874 to 312390
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):: pentangular polyphenol
tetracenomycin

SACTE_RS01160: MET C6|C8 (Score: 531.2; E-value: 2e-162)
SACTE_RS01165: CYC C4-C21/C2-C23|C2-C19 (Score: 162.6; E-value: 5.5e-51)
SACTE_RS01170: CYC C9-C14 (Score: 244.6; E-value: 7e-76)
SACTE_RS01175: ACP (Score: 60.5; E-value: 2.7e-19)
SACTE_RS01180: CLF (Score: 542.9; E-value: 9.7e-166)
SACTE_RS01185: KS (Score: 723.4; E-value: 1.8e-220)
SACTE_RS01190: CYC C5-C18 (Score: 212.5; E-value: 3.8e-66)
SACTE_RS01200: OXY (Score: 296.3; E-value: 1.1e-90)
SACTE_RS01240: OXY (Score: 12.8; E-value: 0.0001)
SACTE_RS01260: MET (Score: 53.7; E-value: 4e-17)

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CcpA	Catabolite control protein A
CelR	Cellobiose uptake repressor
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NC_015953.1 - Region 3 - melanin

Download region SVG

Location: 333,103 - 343,633 nt. (total: 10,531 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxygenase

SACTE_RS01460: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

SACTE_RS01470: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: glycosyltransferase

SACTE_RS01430: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.81	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.44	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001624.3	0.39	other (other)	iso-A82775C	Pestalotiopsis fici
BGC0000662.5	0.39	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.38	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000911.3	0.81	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000910.3	0.80	other (other)	melanin	Streptomyces coelicolor A3(2)
BGC0000909.3	0.64	other (other)	melanin	Streptomyces avermitilis
BGC0000912.3	0.60	other (other)	melanin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000908.3	0.48	other (other)	melanin	Streptomyces avermitilis
BGC0000885.3	0.44	other (other)	4-hydroxy-3-nitrosobenzamide	Streptomyces murayamaensis
BGC0001624.3	0.39	other (other)	iso-A82775C	Pestalotiopsis fici
BGC0000662.5	0.39	terpene	grixazone A	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000889.5	0.38	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000470.6	0.37	ribosomal	bottromycin D	Streptomyces sp. WMMB272

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

Additional weak hits (2):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.09 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.94 out of 27.55

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator

NC_015953.1 - Region 4 - NRP-metallophore,NRPS

Download region SVG

Location: 689,835 - 748,274 nt. (total: 58,440 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

SACTE_RS02980: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

SACTE_RS03080: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Transferases: acyltransferase aminotransferase formyltransferase kinase

SACTE_RS03025: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

SACTE_RS03085: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

SACTE_RS03090: acyltransferase

smcogs: SMCOG1141: acyltransferase

SACTE_RS03190: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: deformylase esterase hydrolase

SACTE_RS02990: peptide deformylase

smcogs: SMCOG1275: peptide deformylase

SACTE_RS03020: isochorismatase

smcogs: SMCOG1027: isochorismatase

SACTE_RS03040: enterobactin/ferric enterobactin esterase

smcogs: SMCOG1098: enterobactin/ferric enterobactin esterase

Lyases: dehydratase

SACTE_RS03095: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

SACTE_RS03050: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

SACTE_RS03180: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	1.04	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.69	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001825.4	0.62	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.60	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.59	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.57	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.57	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae
BGC0001268.4	0.47	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002073.3	0.38	NRPS	dehydroxynocardamine	Corynebacterium propinquum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000325.5	0.80	NRPS	coelichelin	Streptomyces coelicolor A3(2)
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001239.3	0.67	other (other)	biotin	Aspergillus nidulans
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.62	NRPS	AbT1	Aureobasidium pullulans
BGC0001641.4	0.62	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001268.4	0.57	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.03 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 35.53 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 34.36 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 30.90 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.19 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 27.90 out of 36.53

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.09 out of 30.12

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (19):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.48 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.26 out of 39.62

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.56 out of 36.53

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.27 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.45 out of 29.25

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.52 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.39 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.50 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.08 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.99 out of 36.53

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.16 out of 35.63

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.49 out of 39.62

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.39 out of 36.53

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.85 out of 18.57

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.09 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.91 out of 24.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.97 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 689834 - 748274:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Fo-OH-Orn - D-Thr - OH-Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

SACTE_RS03050: Fo-OH-Orn - Thr - OH-Orn

Search NORINE for peptide: strict or relaxed

AMP-binding (144..542): Fo-OH-Orn

nrpys: Fo-OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: RWQAFDISVNELYLWCGGEYHGYGPAETTIGVSH
Nearest Stachelhaus code(s):: Fo-OH-Orn DINYWGGIGK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1623..2033): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LNTHFDFAVWEGNQVFGGEVNMYGITETTVHVTH
Nearest Stachelhaus code(s):: Thr DFWNVGMVHK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3047..3447): OH-Orn

nrpys: OH-Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: MNHVFDMSWEEWNVLLGGEYNLYGPTEYTINTLG
Nearest Stachelhaus code(s):: OH-Orn DMENLGLINK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
DmdR1	Iron(II)-dependent repressor
OsdR	Development and stress management regulator

NC_015953.1 - Region 5 - NRP-metallophore,NRPS,t3nrps-iterative

Download region SVG

Location: 798,737 - 875,302 nt. (total: 76,566 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

SACTE_RS03430: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

SACTE_RS03460: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS03465: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS03525: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

SACTE_RS03555: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: acetyltransferase aminotransferase methyltransferase

SACTE_RS03615: methyltransferase

smcogs: SMCOG1089: methyltransferase

SACTE_RS03620: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

SACTE_RS03650: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: esterase hydrolase

SACTE_RS03550: thioesterase

smcogs: SMCOG1004: thioesterase

SACTE_RS03695: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Lyases: decarboxylase hydratase

SACTE_RS03425: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

SACTE_RS03630: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

Isomerases: isomerase

SACTE_RS03530: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

SACTE_RS03575: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

SACTE_RS03580: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

SACTE_RS03625: cysteine synthase

smcogs: SMCOG1081: cysteine synthase

Translocases: permease

SACTE_RS03700: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	1.82	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0001758.4	0.91	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.91	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.91	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.91	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.90	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.90	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.89	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.89	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.89	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000324.5	0.84	NRPS	coelibactin	Streptomyces coelicolor A3(2)
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002286.3	0.64	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.64	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.64	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.63	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001133.4	0.63	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0002075.3	0.63	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.89 out of 23.79

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.75 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 26.21 out of 28.19

Confidence: strong

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 22.44 out of 27.18

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.23 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.23 out of 28.19

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.65 out of 28.19

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (31):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.22 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.04 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.87 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.04 out of 27.78

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 22.09 out of 36.54

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.45 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.38 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.78 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.59 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.68 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.43 out of 21.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.20 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 22.94 out of 30.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.69 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.22 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.51 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.15 out of 30.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.48 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.77 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.37 out of 30.25

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.83 out of 27.18

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.43 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.61 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.93 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.85 out of 20.01

Confidence: weak

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 17.99 out of 25.31

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.74 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.43 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.61 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.06 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 798736 - 875302:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Thr - Cys) + (Me-Cys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

SACTE_RS03570: Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (543..943): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDIAFDLSVYDGNSLISGDISLGGATEGSIWSIV
Nearest Stachelhaus code(s):: Cys DLYNLSLIWK (94% 8Å match)
Stachelhaus code match:: 100% (strong)

SACTE_RS03575: Thr - Cys

Search NORINE for peptide: strict or relaxed

AMP-binding (549..944): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TAMSFDLATWDAQCLLGGDVALGGMTEAAVHSTV
Nearest Stachelhaus code(s):: Thr DLWQLGLVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1603..1999): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TDISFDLSVYDGNTLVSGDVAMGGATEAAIWSNT
Nearest Stachelhaus code(s):: Cys DLYNLSMIWK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

SACTE_RS03580: diOH-Bz

Search NORINE for peptide: strict or relaxed

AMP-binding (31..457): diOH-Bz

nrpys: diOH-Bz

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NACLFAFACPGGSLQVGGAQQVFGMAEGLINLTR
Nearest Stachelhaus code(s):: Sal ALPSQGVLNK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
NrdR	Represses ribonucleotide reductase encoding genes
ZuR variant 1	Zinc-responsive repressor

NC_015953.1 - Region 6 - terpene

Download region SVG

Location: 989,127 - 1,010,161 nt. (total: 21,035 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

SACTE_RS04225: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: PPTase formyltransferase

SACTE_RS04190: 4'-phosphopantetheinyl transferase

smcogs: SMCOG1060: 4'-phosphopantetheinyl transferase

SACTE_RS04255: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

Lyases: cyclase hydratase

SACTE_RS04210: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

SACTE_RS04235: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.40	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002034.3	0.39	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000879.5	0.38	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000772.5	0.36	saccharide	lipopolysaccharide	Brucella melitensis
BGC0002474.2	0.35	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001937.4	0.35	other (other)	tubercidin	Streptomyces tubercidicus
BGC0000273.5	0.35	PKS, saccharide	steffimycin D	Streptomyces steffisburgensis
BGC0001865.4	0.35	PKS	elsinochrome C	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0002707.2	0.47	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0000631.5	0.40	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002034.3	0.39	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000879.5	0.38	other (other)	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0000772.5	0.36	saccharide	lipopolysaccharide	Brucella melitensis
BGC0002474.2	0.35	NRPS	agrobactin	Agrobacterium tumefaciens
BGC0001937.4	0.35	other (other)	tubercidin	Streptomyces tubercidicus
BGC0000273.5	0.35	PKS, saccharide	steffimycin D	Streptomyces steffisburgensis
BGC0001865.4	0.35	PKS	elsinochrome C	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C10	none
sesquiterpene			C15	C1-C10	none

Genes with terpene domains:

SACTE_RS04235: T1TS

Domain 1 (4 - 315): Type 1 terpene synthase

Subtype: Germacrene A synthase type

Reactions:: GPP → monoterpene_C1-C10; FPP → sesquiterpene_C1-C10

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.18 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.84 out of 30.12

Confidence: medium

Additional weak hits (16):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.13 out of 29.38

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.23 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 19.21 out of 26.33

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.12 out of 24.78

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.48 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.26 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.46 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.26 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.15 out of 18.57

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.76 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.18 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.15 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.70 out of 26.06

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.59 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.45 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.90 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator

NC_015953.1 - Region 7 - ectoine

Download region SVG

Location: 1,441,158 - 1,451,556 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

SACTE_RS06310: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

SACTE_RS06320: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.89	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.59	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000853.3	0.89	other (other)	ectoine	Streptomyces anulatus
BGC0002052.3	0.85	other (ectoine)	ectoine	Streptomyces sp.
BGC0000852.5	0.70	other (other)	ectoine	Sporosarcina pasteurii
BGC0000858.3	0.66	other (other)	ectoine	Methylobacter marinus
BGC0000859.3	0.66	other (other)	ectoine	Methylomicrobium alcaliphilum
BGC0000856.3	0.66	other (other)	ectoine	Methylophaga thalassica
BGC0000855.3	0.66	other (other)	ectoine	Methylomicrobium kenyense
BGC0000857.3	0.59	other (other)	ectoine	Methylophaga alcalica
BGC0000860.3	0.59	other (other)	ectoine	Methylarcula marina
BGC0000854.3	0.59	other (other)	ectoine	Methylomicrobium alcaliphilum 20Z

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.62 out of 19.52

Confidence: medium

Additional weak hits (4):

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.39 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.75 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.03 out of 19.26

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 14.08 out of 18.57

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

NC_015953.1 - Region 8 - NRPS-like,azole-containing-RiPP,benzoxazole

Download region SVG

Location: 1,915,585 - 1,978,417 nt. (total: 62,833 nt) Show pHMM detection rules used

azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)
benzoxazole: (ksIII and AMP-binding and PP-binding and Amidohydro_1)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase phosphate reductase

SACTE_RS08520: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS08550: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

SACTE_RS08570: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

SACTE_RS08625: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase transketolase

SACTE_RS08460: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

SACTE_RS08555: transketolase

smcogs: SMCOG1204: transketolase

Hydrolases: back translocase deacetylase dehalogenase hydrolase

SACTE_RS08500: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

SACTE_RS08515: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

SACTE_RS08595: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

SACTE_RS08620: isochorismatase

smcogs: SMCOG1027: isochorismatase

Isomerases: isomerase

SACTE_RS08615: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

SACTE_RS08650: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

SACTE_RS08560: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

SACTE_RS08565: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

SACTE_RS08600: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

SACTE_RS08610: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

SACTE_RS08640: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

SACTE_RS08645: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001444.5	0.85	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001249.5	0.77	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.62	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.61	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.56	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.56	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.55	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.55	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.54	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.54	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001444.5	0.74	other (shikimate-derived)	caboxamycin	Streptomyces sp. NTK 937
BGC0001249.5	0.71	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.65	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.64	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000307.4	0.61	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.33 out of 19.52

Confidence: strong

Additional weak hits (15):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.45 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.11 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 15.78 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.12 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.78 out of 27.78

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.24 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.49 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.61 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.50 out of 27.78

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.24 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.75 out of 28.19

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

RREFinder

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 9, location 1915584 - 1978417:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 1927622 - 1978417:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

SACTE_RS08565: X

AMP-binding (43..463): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: MAQSHQAFTWNMMGATGSAYALWGMTENCVTVTR
Nearest Stachelhaus code(s):: Asn DVAMAGMVTK (35% 8Å match); Leu DAWMYGAVIK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

SACTE_RS08600: X

AMP-binding (201..599): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSMAYGMIEVEPLLRVCGEINLYGSAEATVVASC
Nearest Stachelhaus code(s):: Boz GMVLRAVVVK (59% 8Å match)
Stachelhaus code match:: 80% (moderate)

SACTE_RS08640: X

AMP-binding (35..439): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: pip (Hpr)

Stachelhaus prediction details:

Stachelhaus sequence:: QTVLFTWGCPGGSAQIGGAQQVFGMAEGLLSMGR
Nearest Stachelhaus code(s):: Hpa TWPSQGVLCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

RRE predictions

: RRE type: Goadsporin_CD_RRE; Location: 11 - 106; Score: 77.0; RRE type: NHLP_CD_RRE; Location: 10 - 102; Score: 61.1; RRE type: Cyanobactin_D_RRE; Location: 7 - 86; Score: 60.5

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production

Core peptide predictions

No core peptides found.

NC_015953.1 - Region 9 - terpene-precursor

Download region SVG

Location: 2,077,804 - 2,098,856 nt. (total: 21,053 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

SACTE_RS09210: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acylase glycosyltransferase

SACTE_RS09265: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

SACTE_RS09285: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: hydrolase

SACTE_RS09220: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthase synthetase

SACTE_RS09255: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

SACTE_RS09290: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

SACTE_RS09300: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002711.2	0.50	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000204.5	0.45	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002554.2	0.43	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0000272.3	0.42	PKS	spore pigment	Streptomyces collinus
BGC0000261.5	0.42	PKS	R1128	Streptomyces sp. R1128
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.57	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.57	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002711.2	0.50	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0002171.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.46	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0000204.5	0.45	PKS	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002554.2	0.43	other (other)	carquinostatin A, carquinostatin B	Streptomyces exfoliatus
BGC0000272.3	0.42	PKS	spore pigment	Streptomyces collinus
BGC0000261.5	0.42	PKS	R1128	Streptomyces sp. R1128
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

SACTE_RS09255: PT_FPPS_like

Domain 1 (48 - 344): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 19.79 out of 25.31

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (4):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.67 out of 30.22

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.65 out of 36.54

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.47 out of 30.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.70 out of 27.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor

NC_015953.1 - Region 10 - PKS-like

Download region SVG

Location: 2,409,002 - 2,449,961 nt. (total: 40,960 nt) Show pHMM detection rules used

PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

SACTE_RS10675: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

SACTE_RS10680: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

SACTE_RS10735: dioxygenase, TauD/TfdA

smcogs: SMCOG1121: dioxygenase, TauD/TfdA

SACTE_RS10755: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase kinase

SACTE_RS10695: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

SACTE_RS10765: aminotransferase

smcogs: SMCOG1019: aminotransferase

Hydrolases: hydrolase

SACTE_RS10770: amidohydrolase

smcogs: SMCOG1244: amidohydrolase

SACTE_RS10790: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthase

SACTE_RS10730: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

SACTE_RS10740: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.52	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0002458.3	0.48	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001238.3	0.47	other (other)	biotin	Aspergillus nidulans
BGC0001239.3	0.46	other (other)	biotin	Aspergillus nidulans
BGC0001302.5	0.45	other (other)	lomofungin	Streptomyces lomondensis
BGC0001633.3	0.44	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002034.3	0.43	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000632.5	0.43	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001965.4	0.42	other (other)	nybomycin	Streptomyces albus subsp. chlorinus
BGC0002536.3	0.42	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.52	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0002458.3	0.48	NRPS	alazopeptin	Streptacidiphilus griseoplanus
BGC0001238.3	0.47	other (other)	biotin	Aspergillus nidulans
BGC0001239.3	0.46	other (other)	biotin	Aspergillus nidulans
BGC0001302.5	0.45	other (other)	lomofungin	Streptomyces lomondensis
BGC0001633.3	0.44	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0002034.3	0.43	other (other)	perquinoline A, perquinoline B, perquinoline C	Streptomyces sp. IB2014 016-6
BGC0000632.5	0.43	saccharide, terpene	brasilicardin A	Nocardia terpenica
BGC0001965.4	0.42	other (other)	nybomycin	Streptomyces albus subsp. chlorinus
BGC0002536.3	0.42	NRPS	alazopeptin	Kitasatospora azatica KCTC 9699

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 19.52 out of 19.52

Confidence: strong

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 31.35 out of 32.93

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.37 out of 20.97

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 31.91 out of 32.38

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (10):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.28 out of 29.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.10 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.47 out of 26.33

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.74 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.93 out of 27.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 24.53 out of 32.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.07 out of 33.73

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.48 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.26 out of 20.01

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

TFBS Finder

NRPS/PKS substrate predictions

SACTE_RS10750: X

AMP-binding (370..536): X

No predictions made

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CcpA	Catabolite control protein A
CsoR	Copper-responsive repressor
RicR	Copper-responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence

NC_015953.1 - Region 11 - lanthipeptide-class-ii,lanthipeptide-class-iii

BGC0000535.4 (ADJ56352.1):

Download region SVG

Location: 2,462,212 - 2,493,307 nt. (total: 31,096 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

SACTE_RS10920: oxidoreductase

smcogs: SMCOG1079: oxidoreductase

Transferases: methyltransferase

SACTE_RS10905: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: protease

SACTE_RS10985: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: cyclase

SACTE_RS10935: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.38	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000525.5	0.36	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000496.5	0.32	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.32	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000518.3	0.31	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000519.4	0.31	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.30	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000517.4	0.29	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000520.5	0.27	ribosomal	lacticin 3147 A1, lacticin 3147 A2	Lactococcus lactis
BGC0000527.5	0.27	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002337.2	0.51	ribosomal	class IV lanthipeptide, SflA	Streptomyces sp. NRRL S-1022
BGC0000525.5	0.50	ribosomal	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000496.5	0.47	ribosomal	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000551.5	0.47	ribosomal	SapB	Streptomyces coelicolor A3(2)
BGC0000518.3	0.46	ribosomal	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000519.4	0.46	ribosomal	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.3	0.45	ribosomal	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001407.5	0.45	ribosomal	bicereucin	Bacillus cereus SJ1
BGC0000517.4	0.44	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001387.5	0.44	other (other)	nucleocidin	Streptomyces calvus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for SACTE_RS10935

allorf_2465299_2465448

Leader:

MPRSGGVRVALQGA

Core:

RWRPRGTVRADCLPAGRARPAHGLSGAPTGCFRLP

Core with dehydrations:

RWRPRGDhbVRADCysLPAGRARPAHGLDhaGAPDhbGCysFRLP

antiSMASH-DB 4.0 matches for allorf_2465299_2465448

100.0%

NC_015953.1:

Lanthipeptides: allorf_2465299_2465448_lanthipeptide

1

RWRPRGTVRADCLPAGRARPAHGLSGAPTGCFRLP

35

RWRPRGTVRADCLPAGRARPAHGLSGAPTGCFRLP

1

RWRPRGTVRADCLPAGRARPAHGLSGAPTGCFRLP

35

97.1%

NZ_WWGT01000021.1:

Lanthipeptides: allorf_053338_053487_lanthipeptide

1

RWRPRGTVRADCLPAGRARPAHGLSGAPTGCFRLP

35

RWRPRGTVRADCLPAGRARPAHGLSGAP GCFRLP

1

RWRPRGTVRADCLPAGRARPAHGLSGAPRGCFRLP

35

MIBiG 4.0 matches for allorf_2465299_2465448

11.4%

Lanthipeptide: nisin A

25

SGAPTGC

31

+GA GC

13

TGALMGC

19

allorf_2471042_2471248

Leader:

MAAAPIGPGARPAGASRAYRPVRAWTASRSSCPPARHCRRGGTLGA

allorf_2471042_2471248

Leader:

MAAAPIGPGARPAGASRAYRPVRAWTASRSSCPPARHCRRGGTLGA

Shared core:

AAPPCGPRPTFVAGRSDEGPPR

Core with dehydrations:

AAPPCysGPRPDhbFVAGRDhaDEGPPR

antiSMASH-DB 4.0 matches for allorf_2471042_2471248

100.0%

NC_015953.1and 2 others:

NZ_WWGT01000021.1 Lanthipeptides: allorf_047538_047744_lanthipeptideNZ_WWGT01000021.1 Lanthipeptides: allorf_047538_047744_lanthipeptide

Lanthipeptides: allorf_2471042_2471248_lanthipeptide

1

AAPPCGPRPTFVAGRSDEGPPR

22

AAPPCGPRPTFVAGRSDEGPPR

1

AAPPCGPRPTFVAGRSDEGPPR

22

31.8%

NZ_CP059997.1:

Lanthipeptides: allorf_02572182_02572382_lanthipeptide

1

AAPPCGPRPTFVAGR

15

A PC RP F+ G+

8

AYSPCARRPGFLTGQ

22

28.2%

NZ_CP047147.1and 3 others:

NZ_CP047147.1 Lanthipeptides: allorf_0132945_0133133_lanthipeptideNZ_KB890710.1 Lanthipeptides: allorf_068944_069132_lanthipeptideNZ_KB890710.1 Lanthipeptides: allorf_068944_069132_lanthipeptide

Lanthipeptides: allorf_0132945_0133133_lanthipeptide

1

AAPPCGPRPTFVAGRSDEGPP

21

A+PPCG PT G S G P

5

ASPPCGWAPTPPRGHSGTGMP

25

with 3 more sequence matches

28.0%

NZ_CP021080.1and 1 other:

NZ_CP021080.1 Lanthipeptides: allorf_6260770_6260997_lanthipeptide

Lanthipeptides: allorf_6260770_6260997_lanthipeptide

7

PRPTFVAGRSDEGPPR

22

PRP+ + G PPR

3

PRPSLLRGSDTACPPR

18

20.0%

NZ_KQ061217.1:

Lanthipeptides: allorf_4226176_4226289_lanthipeptide

5

CGPRPTFVAGRSD

17

C PRP+++ R+

3

CSPRPSWIPARAQ

15

14.0%

NZ_CP035495.1and 1 other:

NZ_CP035495.1 Lanthipeptides: ET495_RS04095_lanthipeptide

Lanthipeptides: ET495_RS04095_lanthipeptide

4

PCGPRPTFVAGRSDEGP

20

P G +AGRS+ G

32

PLGGIVYLLAGRSETGS

48

allorf_2472063_2472194

Leader:

MGGGGSGPGGAVRVGELPAVVGS

allorf_2472063_2472194

Leader:

MGGGGSGPGGAVRVGELPAVVGS

Shared core:

RGISSDGCGVCFRPHFMSGA

Core with dehydrations:

RGIDhaDhaDGCysGVCysFRPHFMDhaGA

antiSMASH-DB 4.0 matches for allorf_2472063_2472194

100.0%

NC_015953.1and 2 others:

NZ_WWGT01000021.1 Lanthipeptides: allorf_046592_046723_lanthipeptideNZ_WWGT01000021.1 Lanthipeptides: allorf_046592_046723_lanthipeptide

Lanthipeptides: allorf_2472063_2472194_lanthipeptide

1

RGISSDGCGVCFRPHFMSGA

20

RGISSDGCGVCFRPHFMSGA

1

RGISSDGCGVCFRPHFMSGA

20

allorf_2484670_2484879

Leader:

MDRGIGLPRGARPVGEWGGSVVDGDRPVAAS

allorf_2484670_2484879

Leader:

MDRGIGLPRGARPVGEWGGSVVDGDRPVAAS

Shared core:

GPSRPGSAFRRTTAPGFRPGGRPARTTCHDPMTTGSYR

Core with dehydrations:

GPDhaRPGDhaAFRRDhbDhbAPGFRPGGRPARDhbDhbCysHDPMDhbDhbGDhaYR

antiSMASH-DB 4.0 matches for allorf_2484670_2484879

100.0%

NC_015953.1:

Lanthipeptides: allorf_2484670_2484879_lanthipeptide

1

GPSRPGSAFRRTTAPGFRPGGRPARTTCHDPMTTGSYR

38

GPSRPGSAFRRTTAPGFRPGGRPARTTCHDPMTTGSYR

1

GPSRPGSAFRRTTAPGFRPGGRPARTTCHDPMTTGSYR

38

MIBiG 4.0 matches for allorf_2484670_2484879

10.5%

BGC0001229.4 (SBI_06989):

Lanthipeptide: SBI-06990 A1 or SBI-06989 A2

30

DPMTTG

35

DP TG

2

DPAVTG

7

9.8%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

20

GGRPARTTCH

29

RPA CH

32

SSRPAAPACH

41

allorf_2485079_2485273

Leader:

MTALVPGGPEVPGS

allorf_2485079_2485273

Leader:

MTALVPGGPEVPGS

Shared core:

GGASRCPPLPRKLGGPACGTLRRRYGAGIAPARRGCTASRAARPRPARSG

Core with dehydrations:

GGADhaRCysPPLPRKLGGPACysGDhbLRRRYGAGIAPARRGCysDhbADhaRAARPRPARDhaG

antiSMASH-DB 4.0 matches for allorf_2485079_2485273

100.0%

NC_015953.1:

Lanthipeptides: allorf_2485079_2485273_lanthipeptide

1

GGASRCPPLPRKLGGPACGTLRRRYGAGIAPARRGCTASRAARPRPARSG

50

GGASRCPPLPRKLGGPACGTLRRRYGAGIAPARRGCTASRAARPRPARSG

1

GGASRCPPLPRKLGGPACGTLRRRYGAGIAPARRGCTASRAARPRPARSG

50

96.0%

NZ_WWGT01000021.1and 1 other:

NZ_WWGT01000021.1 Lanthipeptides: allorf_033513_033707_lanthipeptide

Lanthipeptides: allorf_033513_033707_lanthipeptide

1

GGASRCPPLPRKLGGPACGTLRRRYGAGIAPARRGCTASRAARPRPARSG

50

G ASRCPPLPRKLG PACGTLRRRYGAGIAPARRGCTASRAARPRPARSG

1

GAASRCPPLPRKLGAPACGTLRRRYGAGIAPARRGCTASRAARPRPARSG

50

50.0%

NZ_CP032543.1and 2 others:

NZ_WUEJ01000002.1 Lanthipeptides: allorf_305249_305419_lanthipeptideNZ_WUEJ01000002.1 Lanthipeptides: allorf_305249_305419_lanthipeptide

Lanthipeptides: allorf_2370163_2370333_lanthipeptide

3

ASRCPPLPRKLGGPACGTLRRRYGAGIAPARRGCT

37

A RC PLPRKLG PA TLRRRYG G+ PARR T

1

AGRCLPLPRKLGAPASKTLRRRYGGGMGPARRPWT

35

with 6 more sequence matches

46.0%

NZ_LR881952.1and 4 others:

NZ_LR881952.1 Lanthipeptides: allorf_5341425_5341625_lanthipeptideNZ_LR881952.1 Lanthipeptides: allorf_5341425_5341625_lanthipeptideNZ_LR881952.1 Lanthipeptides: allorf_5341425_5341625_lanthipeptideNZ_LZQS01000002.1 Lanthipeptides: allorf_595585_595785_lanthipeptide

Lanthipeptides: allorf_5341425_5341625_lanthipeptide

5

RCPPLPRKLGGPACGTLRRRYGAGIAPARRG

35

RC PLPRKLG PA TLR RYGAG+ P RRG

1

RCLPLPRKLGAPAWETLRLRYGAGMGPVRRG

31

41.5%

NZ_JAGGOV010000059.1and 1 other:

NZ_JAGGOV010000059.1 Lanthipeptides: allorf_076869_077090_lanthipeptide

Lanthipeptides: allorf_076869_077090_lanthipeptide

5

RCPPLPRKLGGPACGTLRRRYGAGIAPARRG

35

RC PLPRKLGG A TLR RYG+G+ P RRG

1

RCLPLPRKLGGAAWETLRLRYGSGMGPVRRG

31

22.0%

NZ_PVTF01000002.1:

Lanthipeptides: allorf_811997_812170_lanthipeptide

12

KLGGPACGTLRRRYGAGIAPARRGCTAS

39

+G P G + G PARR CT S

10

DMGEPIWGLV------GSTPARRACTCS

31

20.0%

NZ_CP061072.1:

Lanthipeptides: allorf_5553739_5553861_lanthipeptide

3

ASRCPPLPRKLG

14

A RC PLPRKLG

1

AGRCLPLPRKLG

12

16.0%

NZ_CP011522.1and 3 others:

NZ_CP101397.1 Lanthipeptides: allorf_6479399_6479464_lanthipeptideNZ_CP113262.1 Lanthipeptides: allorf_2462854_2462919_lanthipeptideNZ_JAHHWT010000005.1 Lanthipeptides: allorf_308237_308302_lanthipeptide

Lanthipeptides: allorf_5832250_5832315_lanthipeptide

5

RCPPLPRKLGGPA

17

RC P+PR LG A

1

RCLPVPRTLGTAA

13

16.0%

NZ_CP033724.1and 2 others:

NZ_CP085140.1 Lanthipeptides: allorf_2184591_2184773_lanthipeptideNZ_PSTW01000024.1 Lanthipeptides: allorf_09852_10034_lanthipeptide

Lanthipeptides: allorf_2184604_2184786_lanthipeptide

16

PACGTLRRRYGAG

28

PAC LRRR A

2

PACSPLRRRRDAS

14

MIBiG 4.0 matches for allorf_2485079_2485273

12.0%

BGC0000581.6 (AAD28494.1):

Lasso peptide: microcin J25

1

GGASRCPPLPRKLGGP

16

GGA P +G P

1

GGAGHVPEYFVGIGTP

16

9.8%

BGC0002120.3 (NQE92413.1):

Lanthipeptide: nocathioamide A

14

GGPACGTL

21

PAC TL

36

AAPACHTL

43

6.0%

BGC0002110.3 (QKV49893.1):

Lanthipeptide: birimositide

36

CTASRAARPR

45

CT ++ +P

19

CTLTKECQPN

28

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.56 out of 23.79

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 25.37 out of 30.12

Confidence: medium

Additional weak hits (6):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 16.37 out of 26.12

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.41 out of 18.57

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.83 out of 20.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 18.92 out of 26.33

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 15.15 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.80 out of 28.19

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

allorf_2465299_2465448 - Class II

Cleavage pHMM score: -3.60

RODEO score: 0

Monoisotopic mass: 3701.0 Da

Molecular weight: 3703.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3721.3 Da N = 1

allorf_2471042_2471248 - Class II

Cleavage pHMM score: -4.40

RODEO score: 0

Monoisotopic mass: 2198.1 Da

Molecular weight: 2199.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2217.5 Da N = 1

allorf_2472063_2472194 - Class II

Cleavage pHMM score: -1.40

RODEO score: 0

Monoisotopic mass: 2028.9 Da

Molecular weight: 2030.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2048.3 Da N = 1

allorf_2484670_2484879 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 3897.0 Da

Molecular weight: 3899.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3917.3 Da N = 1; 3935.3 Da N = 2; 3953.4 Da N = 3; 3971.4 Da N = 4; 3989.4 Da N = 5; 4007.4 Da N = 6; 4025.4 Da N = 7; 4043.5 Da N = 8

allorf_2485079_2485273 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 4992.7 Da

Molecular weight: 4995.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 5013.8 Da N = 1; 5031.8 Da N = 2

allorf_2471042_2471248 - Class II

Cleavage pHMM score: -4.40

RODEO score: 0

Monoisotopic mass: 2198.1 Da

Molecular weight: 2199.4 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2217.5 Da N = 1

allorf_2472063_2472194 - Class II

Cleavage pHMM score: -1.40

RODEO score: 0

Monoisotopic mass: 2028.9 Da

Molecular weight: 2030.3 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2048.3 Da N = 1

allorf_2484670_2484879 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 3897.0 Da

Molecular weight: 3899.3 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3917.3 Da N = 1; 3935.3 Da N = 2; 3953.4 Da N = 3; 3971.4 Da N = 4; 3989.4 Da N = 5; 4007.4 Da N = 6; 4025.4 Da N = 7; 4043.5 Da N = 8

allorf_2485079_2485273 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 4992.7 Da

Molecular weight: 4995.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 5013.8 Da N = 1; 5031.8 Da N = 2

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NC_015953.1 - Region 12 - terpene-precursor

Download region SVG

Location: 3,098,525 - 3,119,601 nt. (total: 21,077 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

SACTE_RS13700: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.43	terpene	stellatic acid	Aspergillus stellatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000640.3	0.32	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000646.5	0.31	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.31	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0001911.3	0.30	terpene	raimonol	Streptomyces anulatus
BGC0000641.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0002425.3	0.30	ribosomal	stlassin	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.43	terpene	stellatic acid	Aspergillus stellatus
BGC0002309.2	0.36	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0000640.3	0.32	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000646.5	0.31	terpene	β-carotein	uncultured bacterium
BGC0000630.3	0.31	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0001911.3	0.30	terpene	raimonol	Streptomyces anulatus
BGC0000641.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC260
BGC0000642.3	0.30	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0002425.3	0.30	ribosomal	stlassin	Streptomyces sp.

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

SACTE_RS13700: PT_FPPS_like

Domain 1 (66 - 356): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 22.75 out of 27.04

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (2):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.68 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.91 out of 29.38

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
DasR	N-acetylglucosamine dependent repressor

NC_015953.1 - Region 13 - butyrolactone

Download region SVG

Location: 3,534,233 - 3,545,165 nt. (total: 10,933 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

SACTE_RS15730: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS15740: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Hydrolases: hydrolase

SACTE_RS15705: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0002578.2	0.43	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000671.3	0.41	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002228.3	0.41	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	0.78	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.76	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.65	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0002404.2	0.46	other (other)	falcarindiol	Solanum lycopersicum
BGC0002578.2	0.43	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0001633.3	0.41	other (other)	ketomemicin B3, ketomemicin B4	Streptomyces mobaraensis NBRC 13819 = DSM 40847
BGC0000671.3	0.41	terpene	momilactone B	Oryza sativa Japonica Group
BGC0002228.3	0.41	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 18.31 out of 18.57

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.49 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.95 out of 26.85

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.09 out of 23.79

Confidence: medium

Additional weak hits (7):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.20 out of 39.62

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 21.53 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.95 out of 28.19

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.50 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.68 out of 23.43

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.36 out of 23.43

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis

NC_015953.1 - Region 14 - terpene-precursor

Download region SVG

Location: 4,947,661 - 4,968,704 nt. (total: 21,044 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

SACTE_RS22330: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

SACTE_RS22305: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

SACTE_RS22270: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000666.5	0.36	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000948.5	0.45	other (other)	α-galactosylceramide	Bacteroides fragilis NCTC 9343
BGC0000657.5	0.44	terpene	2-methylisoborneol	Pseudanabaena sp. dqh15
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0000665.5	0.39	other (other), terpene	xiamycin, indosespene, sespenine, dixiamycin A, dixiamycin B, sulfadixiamycin A, sulfadixiamycin B, sulfadixiamycin C	Streptomyces sp. HKI0576
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001910.4	0.38	terpene	cyslabdan A, cyslabdan B, cyslabdan C	Streptomyces cyslabdanicus
BGC0000664.5	0.38	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001911.3	0.37	terpene	raimonol	Streptomyces anulatus
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0000666.5	0.36	terpene	xiamycin A	Streptomyces sp. SCSIO 02999

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

SACTE_RS22270: PT_FPPS_like

Domain 1 (59 - 345): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.86 out of 18.57

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 22.69 out of 23.43

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.77 out of 23.79

Confidence: medium

Additional weak hits (9):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.69 out of 20.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 16.99 out of 30.97

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.67 out of 24.78

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.15 out of 23.43

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.63 out of 18.57

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.32 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.96 out of 35.63

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.52 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.91 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis

NC_015953.1 - Region 15 - terpene

Download region SVG

Location: 5,143,473 - 5,164,450 nt. (total: 20,978 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: deacetylase glucanase

SACTE_RS23095: Pullulanase, type I

smcogs: SMCOG1297: Pullulanase, type I

SACTE_RS23120: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: cyclase hydratase

SACTE_RS23110: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

SACTE_RS23125: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000903.3	0.39	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000545.5	0.37	ribosomal	ruminococcin A	[Ruminococcus] gnavus E1
BGC0001618.3	0.37	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0000527.5	0.36	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000547.5	0.36	ribosomal	salivaricin 9	Streptococcus salivarius
BGC0001285.5	0.36	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.5	0.41	ribosomal	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000486.4	0.40	ribosomal	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000903.3	0.39	other (other)	fluorometabolite	Streptomyces cattleya
BGC0001743.3	0.39	ribosomal	plantaricyclin	Lactobacillus plantarum
BGC0002316.2	0.37	ribosomal	cebulantin	Saccharopolyspora cebuensis
BGC0000545.5	0.37	ribosomal	ruminococcin A	[Ruminococcus] gnavus E1
BGC0001618.3	0.37	ribosomal	hyicin 3682	Staphylococcus hyicus
BGC0000527.5	0.36	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000547.5	0.36	ribosomal	salivaricin 9	Streptococcus salivarius
BGC0001285.5	0.36	other (fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

SACTE_RS23125: T1TS

Domain 1 (1 - 305): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 24.85 out of 30.12

Confidence: medium

Additional weak hits (8):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.41 out of 25.75

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.65 out of 27.55

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.41 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.70 out of 21.55

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.82 out of 27.55

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.83 out of 29.38

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.72 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.98 out of 35.63

Confidence: weak

Terpene

TFBS Finder

Glossary

No acronyms to display

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
OsdR	Development and stress management regulator
VqsM	Regulator of quorum-sensing signalling systems

NC_015953.1 - Region 16 - NI-siderophore

Download region SVG

Location: 5,502,501 - 5,535,094 nt. (total: 32,594 nt) Show pHMM detection rules used

NI-siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

SACTE_RS24720: Antibiotic biosynthesis monooxygenase

smcogs: SMCOG1258: Antibiotic biosynthesis monooxygenase

Transferases: aminotransferase

SACTE_RS24675: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Isomerases: mutase

SACTE_RS24725: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002692.2	0.55	other (other)	speibonoxamine, desoxy-desferrioxamine D1, desferrioxamine D1, desferrioxamine B, didesoxy-desferrioxamine D1, desoxy-desferrioxamine B, didesoxy-desferrioxamine B	Kribbella speibonae
BGC0000942.4	0.54	other (other)	petrobactin	Bacillus anthracis str. Ames
BGC0001713.5	0.53	other (other)	ochrobactin	Ochrobactrum anthropi
BGC0002683.2	0.51	NRPS	schizokinen	Nostoc sp. PCC 7120 = FACHB-418
BGC0000295.5	0.51	NRPS	acinetoferrin	Acinetobacter haemolyticus
BGC0002633.2	0.51	other (other)	schizokinen	Leptolyngbya sp. PCC 7376
BGC0002469.2	0.50	other (other)	woodybactin A, woodybactin B, woodybactin C, woodybactin D	Shewanella woodyi ATCC 51908
BGC0002470.2	0.50	other (other)	synechobactin C9, synechobactin C11, synechobactin 13, synechobactin 14, synechobactin 16, synechobactin A, synechobactin B, synechobactin C	Synechococcus sp. PCC 7002
BGC0001572.3	0.50	other (other)	desferrioxamine E	Pantoea agglomerans
BGC0000852.5	0.49	other (other)	ectoine	Sporosarcina pasteurii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.93 out of 24.78

Confidence: medium

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 24.17 out of 27.18

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.48 out of 23.43

Confidence: medium

Additional weak hits (8):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.39 out of 30.25

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.88 out of 29.65

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.92 out of 25.75

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.09 out of 29.65

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.77 out of 25.88

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.40 out of 21.84

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.61 out of 27.18

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.44 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
CRP	Cyclic AMP receptor protein
LexA variant 2	Repressor of DNA damage response
NrdR	Represses ribonucleotide reductase encoding genes

NC_015953.1 - Region 17 - NRPS

Download region SVG

Location: 5,617,605 - 5,679,551 nt. (total: 61,947 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

SACTE_RS25195: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS25205: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS25215: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Transferases: acyltransferase methyltransferase

SACTE_RS25175: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

SACTE_RS25255: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: deacetylase

SACTE_RS25200: acetylornithine deacetylase

smcogs: SMCOG1247: acetylornithine deacetylase

Ligases: ligase

SACTE_RS25170: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.71	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001133.4	0.71	NRPS	taxlllaid A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001758.4	0.70	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0002286.3	0.69	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.38 out of 23.79

Confidence: medium

Additional weak hits (16):

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.44 out of 30.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 39.62

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.06 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.40 out of 18.57

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.93 out of 32.74

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.50 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.12 out of 26.06

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.03 out of 25.88

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.54 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.33 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.93 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.55 out of 27.78

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.32 out of 32.93

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.53 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 22, location 5617604 - 5679551:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Ile - Gln - Ile - D-Gln) + (X - Phe)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

SACTE_RS25170: Ile - Gln - Ile - Gln

Search NORINE for peptide: strict or relaxed

AMP-binding (501..902): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDTSFDASTFEVFLAAGGELHVYGPTETTTFATR
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1570..1976): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDASVWELQFLCGGEHNLYGPTEATIDATV
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2638..3040): Ile

nrpys: Ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDASFDASTFEAFLCAGGELHVYGPTETTTFATR
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3701..4101): Gln

nrpys: Gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: glu,gln (Glu, Gln)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDASVWELQFLCGGEHNLYGPTEATIDTAA
Nearest Stachelhaus code(s):: Gln DAWQCGLIDK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

SACTE_RS25175: X - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (477..877): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: val (Val)

Stachelhaus prediction details:

Stachelhaus sequence:: LDHSFDASTFEVFLATGGELHVYGPTETTTFATA
Nearest Stachelhaus code(s):: Ile DAFFLGVTFK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1540..1937): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: MTQAFDAAFWEMTLVLAGEVNAYGPTETTVCATM
Nearest Stachelhaus code(s):: Phe DAWTVAAVCK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism

NC_015953.1 - Region 18 - terpene

Download region SVG

Location: 5,745,560 - 5,773,762 nt. (total: 28,203 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

SACTE_RS25565: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS25605: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

SACTE_RS25635: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: acetyltransferase methyltransferase

SACTE_RS25560: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

SACTE_RS25615: methyltransferase

smcogs: SMCOG1089: methyltransferase

SACTE_RS25645: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Isomerases: racemase

SACTE_RS25555: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: synthase synthetase

SACTE_RS25570: argininosuccinate synthase

smcogs: SMCOG1291: argininosuccinate synthase

SACTE_RS25640: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.83	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.73	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.71	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.70	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000664.5	0.83	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000649.3	0.75	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001456.3	0.73	terpene	isorenieratene	Streptomyces argillaceus
BGC0000633.3	0.71	terpene	carotenoid	Streptomyces avermitilis
BGC0001227.3	0.70	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000648.3	0.53	terpene	carotenoid	Myxococcus xanthus
BGC0000646.5	0.51	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.50	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000641.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC416
BGC0000639.3	0.49	terpene	carotenoid	Enterobacteriaceae bacterium DC260

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

SACTE_RS25610: Lycopene_cycl

Domain 1 (14 - 386): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

SACTE_RS25630: PT_phytoene_like

Domain 1 (16 - 311): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

SACTE_RS25640: PT_FPPS_like

Domain 1 (62 - 367): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.46 out of 20.01

Confidence: strong

Additional weak hits (9):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.22 out of 26.12

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.33 out of 30.97

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.43 out of 21.55

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.65 out of 20.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 13.67 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.00 out of 21.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.25 out of 20.01

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.38 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
VqsM	Regulator of quorum-sensing signalling systems

NC_015953.1 - Region 19 - PKS-like,T1PKS,T2PKS

Download region SVG

Location: 5,826,512 - 5,903,128 nt. (total: 76,617 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)
PKS-like: (t2pks2 or ksIII)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

SACTE_RS25815: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS25825: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

SACTE_RS25855: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

SACTE_RS25860: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

SACTE_RS25895: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase kinase methyltransferase

SACTE_RS25790: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

SACTE_RS25840: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

SACTE_RS25885: methyltransferase

smcogs: SMCOG1089: methyltransferase

SACTE_RS25905: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: phosphatase

SACTE_RS25780: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Lyases: cyclase

SACTE_RS25830: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

SACTE_RS25835: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Ligases: synthase

SACTE_RS25865: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

SACTE_RS25870: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

SACTE_RS25875: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	1.35	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	1.35	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	1.34	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000231.5	1.06	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001276.3	0.98	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000272.3	0.85	PKS	spore pigment	Streptomyces collinus
BGC0000234.5	0.81	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.74	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002276.2	0.74	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000221.5	0.73	PKS	erdacin	uncultured soil bacterium V167

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000231.5	0.68	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0000272.3	0.62	PKS	spore pigment	Streptomyces collinus
BGC0000234.5	0.62	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001197.5	0.58	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002276.2	0.58	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000221.5	0.58	PKS	erdacin	uncultured soil bacterium V167

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.35 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.60 out of 23.79

Confidence: strong

Additional weak hits (16):

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.23 out of 20.01

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.69 out of 26.85

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.93 out of 19.26

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.02 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.52 out of 26.06

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 19.07 out of 36.54

Confidence: weak

HgtR

Description: Hydrogen-dependent regulator
Species: Geobacter sulfurreducens PCA
Score: 18.49 out of 36.54

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 16.68 out of 29.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.98 out of 25.88

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.30 out of 32.74

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 39.62

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.28 out of 27.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.73 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.06 out of 24.78

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.68 out of 39.62

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.23 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

TFBS Finder

Predicted core structure(s)

For candidate cluster 24, location 5826511 - 5903128:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal - Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 25, location 5826511 - 5899020:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal - Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 26, location 5844124 - 5885129:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal - Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 27, location 5849793 - 5903128:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - Me-ccmal - Me-ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

SACTE_RS25905: mal - mmal - mmal

PKS_AT (526..817): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 215.7
inactive: 116.2
Methoxymalonyl-CoA: 72.4
Methylmalonyl-CoA: 52.1
Isobutyryl-CoA: 35.7
Propionyl-CoA: 34.7
Acetyl-CoA: 16.2
Ethylmalonyl-CoA: 14.5
fatty_acid: 12.8
Benzoyl-CoA: 10.7
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: -2.4

PKS_AT (1524..1821): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.6
Ethylmalonyl-CoA: 197.6
Methoxymalonyl-CoA: 166.1
2-Methylbutyryl-CoA: 139.6
trans-1,2-CPDA: 107.5
Propionyl-CoA: 106.6
CHC-CoA: 100.2
Malonyl-CoA: 89.2
Isobutyryl-CoA: 69.6
Benzoyl-CoA: 53.4
fatty_acid: 45.0
Acetyl-CoA: 44.7
3-Methylbutyryl-CoA: 33.8
inactive: 22.6

PKS_AT (3278..3574): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 206.6
Ethylmalonyl-CoA: 201.1
Methoxymalonyl-CoA: 168.4
2-Methylbutyryl-CoA: 146.4
trans-1,2-CPDA: 113.2
Propionyl-CoA: 110.9
CHC-CoA: 104.1
Malonyl-CoA: 92.1
Isobutyryl-CoA: 73.7
Benzoyl-CoA: 56.8
Acetyl-CoA: 49.3
fatty_acid: 44.1
3-Methylbutyryl-CoA: 34.5
inactive: 22.3

Type II PKS gene cluster prediction details

Cluster section:: 5826511 to 5899020
Starter unit(s):: 2-methylbutyryl-CoA (Score: 374.0; E-value: 3.21e-133)
hexadienyl-CoA (Score: 108.0; E-value: 6.55e-28)
Malonyl elongations:: 8|9 (Score: 612.4; E-value: 7.2e-187)
Product class(es):: angucycline
Product molecular weight(s):: 2-methylbutyryl-CoA_8: 408 Da
2-methylbutyryl-CoA_9: 450 Da
hexadienyl-CoA_8: 418 Da
hexadienyl-CoA_9: 460 Da

SACTE_RS25815: KR (Score: 155.2; E-value: 5.8e-48)
SACTE_RS25830: CYC C4-C17/C2-C19 (Score: 432.1; E-value: 9.3e-133)
SACTE_RS25835: CYC C7-C12 (Score: 377.2; E-value: 1.1e-115)
SACTE_RS25840: MET (Score: 242.6; E-value: 1.4e-74)
SACTE_RS25855: OXY (Score: 226.1; E-value: 2e-69)
SACTE_RS25865: KS (Score: 728.6; E-value: 4.5e-222)
SACTE_RS25870: CLF 8|9 (Score: 612.4; E-value: 7.2e-187)
SACTE_RS25875: KSIII (Score: 395.2; E-value: 5.4e-121); KSIII ADB23398.1_TLN-05220/TLN-05223_2-methylbutyryl-CoA (Score: 374.0; E-value: 3.21e-133)
SACTE_RS25880: ACP (Score: 96.1; E-value: 2.2e-30)
SACTE_RS25895: KR (Score: 159.2; E-value: 3.6e-49)
SACTE_RS25905: AT (Score: 156.4; E-value: 2.2e-48); AT ADG86309.1_A-74528_hexadienyl-CoA (Score: 108.0; E-value: 6.55e-28)

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
VqsM	Regulator of quorum-sensing signalling systems

NC_015953.1 - Region 20 - RiPP-like

Download region SVG

Location: 5,953,056 - 5,964,366 nt. (total: 11,311 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

SACTE_RS26160: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Hydrolases: deacetylase

SACTE_RS26205: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002788.2	0.26	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000241.5	0.21	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.20	PKS	nenestatin	Micromonospora echinospora
BGC0000240.5	0.20	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002788.2	0.26	PKS	14-hydroxyisochainin	Streptomyces peucetius subsp. caesius ATCC 27952
BGC0000241.5	0.21	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora tropica CNB-440
BGC0001693.3	0.20	PKS	nenestatin	Micromonospora echinospora
BGC0000240.5	0.20	PKS, saccharide	lomaiviticin A, lomaiviticin C, lomaiviticin D, lomaiviticin E	Salinispora pacifica

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 24.25 out of 26.33

Confidence: strong

Additional weak hits (3):

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.26 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.42 out of 39.62

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 17.20 out of 30.25

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator

NC_015953.1 - Region 21 - T1PKS,t3nrps-iterative

Download region SVG

Location: 6,253,679 - 6,354,741 nt. (total: 101,063 nt) Show pHMM detection rules used

t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

SACTE_RS27595: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS27625: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS27640: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

SACTE_RS27645: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

SACTE_RS27695: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS27710: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase glycosyltransferase transferase

SACTE_RS27655: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

SACTE_RS27780: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

SACTE_RS27795: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Hydrolases: dehalogenase esterase hydrolase peptidase

SACTE_RS27580: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

SACTE_RS27650: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

SACTE_RS27745: thioesterase

smcogs: SMCOG1004: thioesterase

SACTE_RS27750: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Lyases: decarboxylase dehydratase

SACTE_RS27675: diaminopimelate decarboxylase

smcogs: SMCOG1264: diaminopimelate decarboxylase

SACTE_RS27775: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

SACTE_RS27785: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

SACTE_RS27665: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

SACTE_RS27670: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

SACTE_RS27690: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

SACTE_RS27705: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

SACTE_RS27715: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

SACTE_RS27720: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.86	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.86	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.85	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.85	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001770.4	0.80	PKS	sceliphrolactam	Streptomyces sp. SD85
BGC0002517.3	0.78	PKS	tripartilactam, niizalactam C	Streptomyces sp.
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.60	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002517.3	0.78	PKS	tripartilactam, niizalactam C	Streptomyces sp.
BGC0001770.4	0.77	PKS	sceliphrolactam	Streptomyces sp. SD85
BGC0001275.3	0.74	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.74	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002276.2	0.65	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001160.5	0.64	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002154.2	0.64	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.00 out of 20.47

Confidence: medium

Additional weak hits (20):

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.04 out of 20.97

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.15 out of 30.25

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.57 out of 29.51

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.77 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.60 out of 30.25

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.83 out of 21.55

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.28 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.34 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.52 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 18.89 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.98 out of 32.93

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 12.86 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 12.72 out of 28.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.80 out of 28.19

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.20 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.25 out of 32.93

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.42 out of 36.53

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 21.62 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 29, location 6253678 - 6354741:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-ccmal - ccmal) + (ccmal) + (ccmal - ccmal) + (ohmal) + (ccmal - Me-ccmal - ccmal) + (mal)
Non-colinear ordering:: SACTE_RS27695 + SACTE_RS27705 + SACTE_RS27690 + SACTE_RS27710 + SACTE_RS27715 + SACTE_RS27720

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

SACTE_RS27655: pk

PKS_AT (28..281): pk

ATSignature: (unknown)

No matches above 50%

minowa: CHC-CoA

Prediction, score:

CHC-CoA: 11.4
Propionyl-CoA: 4.9
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Malonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

SACTE_RS27665: X

AMP-binding (13..411): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YLLFFDCAMFDCFSLFAGEENLYGPTELTVTVTA
Nearest Stachelhaus code(s):: bMe-Asp DCFFFALITK (88% 8Å match); Ala DCFFFALITK (85% 8Å match)
Stachelhaus code match:: 80% (moderate)

SACTE_RS27670: X

AMP-binding (19..415): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAIFWDYGLYKLPITNTGAVIQFGQTECKRVSVL
Nearest Stachelhaus code(s):: 3S-Abu DYYPTTQRIK (91% 8Å match); Asp DYYPTTMRVK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

SACTE_RS27690: mal - mal

PKS_AT (652..947): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 216.6
inactive: 97.9
Methoxymalonyl-CoA: 69.9
Methylmalonyl-CoA: 59.4
Isobutyryl-CoA: 36.9
Propionyl-CoA: 27.7
Ethylmalonyl-CoA: 22.2
CHC-CoA: 20.5
Acetyl-CoA: 17.2
Benzoyl-CoA: 15.9
fatty_acid: 13.3
2-Methylbutyryl-CoA: 12.6
trans-1,2-CPDA: 4.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2363..2651): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 185.9
inactive: 103.8
Methoxymalonyl-CoA: 57.5
Methylmalonyl-CoA: 51.2
Isobutyryl-CoA: 27.4
Propionyl-CoA: 26.0
Ethylmalonyl-CoA: 18.6
Acetyl-CoA: 17.7
Benzoyl-CoA: 17.3
fatty_acid: 14.5
2-Methylbutyryl-CoA: 1.9
trans-1,2-CPDA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

SACTE_RS27695: mmal - mal

PKS_AT (562..857): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 222.0
Ethylmalonyl-CoA: 210.6
Methoxymalonyl-CoA: 181.1
2-Methylbutyryl-CoA: 141.5
trans-1,2-CPDA: 140.9
Malonyl-CoA: 111.3
CHC-CoA: 110.5
Propionyl-CoA: 107.7
Isobutyryl-CoA: 97.6
Benzoyl-CoA: 88.7
Acetyl-CoA: 54.7
3-Methylbutyryl-CoA: 47.0
fatty_acid: 36.9
inactive: 30.7

PKS_AT (2265..2559): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 211.1
inactive: 109.6
Methoxymalonyl-CoA: 58.4
Methylmalonyl-CoA: 41.4
Isobutyryl-CoA: 29.0
Propionyl-CoA: 28.8
Acetyl-CoA: 24.0
Benzoyl-CoA: 15.7
CHC-CoA: 7.1
Ethylmalonyl-CoA: 7.0
trans-1,2-CPDA: 4.0
2-Methylbutyryl-CoA: 2.8
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

SACTE_RS27705: mal

PKS_AT (566..852): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 181.6
inactive: 86.0
Methoxymalonyl-CoA: 51.8
Methylmalonyl-CoA: 46.1
Isobutyryl-CoA: 24.3
Propionyl-CoA: 19.1
Benzoyl-CoA: 12.3
CHC-CoA: 11.9
fatty_acid: 8.9
Ethylmalonyl-CoA: 7.9
trans-1,2-CPDA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

SACTE_RS27710: mal

PKS_AT (548..827): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 218.0
inactive: 121.8
Methoxymalonyl-CoA: 58.9
Methylmalonyl-CoA: 47.8
Isobutyryl-CoA: 33.7
Benzoyl-CoA: 23.1
Ethylmalonyl-CoA: 22.9
Propionyl-CoA: 22.1
Acetyl-CoA: 15.2
fatty_acid: 14.6
CHC-CoA: 8.7
2-Methylbutyryl-CoA: 7.0
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

SACTE_RS27715: mal - mmal - mal

PKS_AT (560..842): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 87.5%; 2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 208.8
inactive: 111.3
Methoxymalonyl-CoA: 58.3
Methylmalonyl-CoA: 52.9
Propionyl-CoA: 23.3
Ethylmalonyl-CoA: 21.6
Isobutyryl-CoA: 21.2
Benzoyl-CoA: 20.4
Acetyl-CoA: 15.3
CHC-CoA: 12.0
fatty_acid: 11.6
2-Methylbutyryl-CoA: 8.3
trans-1,2-CPDA: 7.4
3-Methylbutyryl-CoA: 0.0

PKS_AT (2237..2526): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 220.0
Ethylmalonyl-CoA: 211.4
Methoxymalonyl-CoA: 176.0
2-Methylbutyryl-CoA: 141.5
trans-1,2-CPDA: 129.8
Propionyl-CoA: 106.4
CHC-CoA: 101.5
Malonyl-CoA: 101.4
Isobutyryl-CoA: 81.1
Benzoyl-CoA: 67.5
fatty_acid: 40.4
Acetyl-CoA: 39.6
3-Methylbutyryl-CoA: 35.7
inactive: 23.6

PKS_AT (3920..4204): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 83.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 186.2
inactive: 88.2
Methoxymalonyl-CoA: 54.0
Methylmalonyl-CoA: 47.1
Propionyl-CoA: 26.9
Isobutyryl-CoA: 25.2
CHC-CoA: 17.3
Acetyl-CoA: 17.0
Benzoyl-CoA: 16.9
fatty_acid: 12.6
Ethylmalonyl-CoA: 11.7
trans-1,2-CPDA: 9.6
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

SACTE_RS27720: mal

PKS_AT (553..832): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; Methylmalonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 193.9
inactive: 97.2
Methoxymalonyl-CoA: 63.3
Methylmalonyl-CoA: 54.4
Propionyl-CoA: 29.9
Isobutyryl-CoA: 25.5
Ethylmalonyl-CoA: 21.2
Acetyl-CoA: 18.6
Benzoyl-CoA: 16.8
CHC-CoA: 15.4
fatty_acid: 9.2
2-Methylbutyryl-CoA: 8.4
trans-1,2-CPDA: 5.0
3-Methylbutyryl-CoA: 0.0

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NC_015953.1 - Region 22 - terpene

Download region SVG

Location: 6,577,011 - 6,599,080 nt. (total: 22,070 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

SACTE_RS28770: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: hydrolase

SACTE_RS28725: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthetase

SACTE_RS28760: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.52	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001868.4	0.45	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001484.3	0.33	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0000495.5	0.32	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001596.3	0.32	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001756.3	0.32	terpene	retigeranin, arathanatriene	Arabidopsis thaliana
BGC0002805.2	0.31	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000668.5	0.31	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001221.5	0.31	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.52	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.49	terpene	boleracene	Brassica oleracea var. oleracea
BGC0001868.4	0.45	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001484.3	0.33	other (other)	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0000495.5	0.32	ribosomal	actagardine	Actinoplanes garbadinensis
BGC0001596.3	0.32	PKS	fluostatin M, fluostatin N, fluostatin O, fluostatin P, fluostatin Q	Streptomyces albus
BGC0001756.3	0.32	terpene	retigeranin, arathanatriene	Arabidopsis thaliana
BGC0002805.2	0.31	other (other)	Azodyrecin A, Azodyrecin B, Azodyrecin C	Streptomyces mirabilis strain P8-A
BGC0000668.5	0.31	other (other), terpene	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001221.5	0.31	other (phenazine)	marinophenazine A, phenaziterpene A	Streptomyces sp. CNQ-509

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

SACTE_RS28760: PT_FPPS_like

Domain 1 (72 - 314): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.39 out of 19.26

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 18.86 out of 25.31

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (3):

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.79 out of 22.40

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 17.53 out of 24.78

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor

NC_015953.1 - Region 23 - terpene

Download region SVG

Location: 6,730,096 - 6,756,683 nt. (total: 26,588 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

SACTE_RS29370: dehydrogenase

smcogs: SMCOG1181: dehydrogenase

SACTE_RS29405: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

Transferases: aminotransferase transferase

SACTE_RS29365: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

SACTE_RS29430: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Lyases: dehydratase

SACTE_RS29355: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

SACTE_RS29410: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0002508.2	0.48	other (other)	8-azaguanine	Streptomyces pathocidini

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000663.5	0.69	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000656.5	0.51	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0002162.3	0.49	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000630.3	0.49	terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0000646.5	0.49	terpene	β-carotein	uncultured bacterium
BGC0000640.3	0.48	terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0002173.2	0.48	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0002508.2	0.48	other (other)	8-azaguanine	Streptomyces pathocidini

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

SACTE_RS29395: PT_phytoene_like

Domain 1 (18 - 280): Prenyltransferase; Phytoene synthase like

Subtype: Hydroxysqualene synthase

Reactions:: PSPP → hydroxysqualene

SACTE_RS29400: PT_phytoene_like

Domain 1 (6 - 292): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → PSPP; FPP → squalene; FPP → diapophytoene; GGPP → phytoene; PSPP → hydroxysqualene

SACTE_RS29410: PT_FPPS_like

Domain 1 (74 - 366): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

SACTE_RS29415: T2TS

Domain 1 (27 - 652): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Transcription Factor Binding Sites

Binding sites found:

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 20.76 out of 21.84

Confidence: strong

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.54 out of 23.79

Confidence: strong

Additional weak hits (7):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.91 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.51 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 16.08 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 15.37 out of 27.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.72 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.34 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
NtrC	Nitrogen regulatory protein C

NC_015953.1 - Region 24 - NRPS,T1PKS

Download region SVG

Location: 6,922,336 - 6,971,791 nt. (total: 49,456 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

SACTE_RS30265: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS30270: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

SACTE_RS30310: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

SACTE_RS30315: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

SACTE_RS30320: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

SACTE_RS30325: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

SACTE_RS30330: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

SACTE_RS30335: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

SACTE_RS30350: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

SACTE_RS30390: methyltransferase

smcogs: SMCOG1089: methyltransferase

Ligases: synthase

SACTE_RS30305: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

SACTE_RS30360: cobalamin synthesis protein/P47K family protein

smcogs: SMCOG1178: cobalamin synthesis protein/P47K family protein

Translocases: transport

SACTE_RS30250: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	1.28	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	1.28	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001273.3	0.90	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.90	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.90	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000996.5	0.89	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001726.4	0.75	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0002509.3	0.70	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001556.5	0.69	NRPS, PKS	combamide	Streptomyces sp.
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001043.4	0.86	NRPS, PKS	SGR PTMs, SGR PTM Compound b, SGR PTM Compound c, SGR PTM Compound d	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002365.2	0.86	PKS, other (other)	10-epi-HSAF, 10-epi-3-deOH-HSAF, 10-epi-maltophilin, 10-epi-xanthobaccin C, 10-epi-hydroxymaltophilin, 10-epi-FI-2	Streptomyces sp.
BGC0001273.3	0.75	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.75	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.75	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000996.5	0.75	NRPS, PKS	frontalamide B, frontalamide A	Streptomyces sp. SPB78
BGC0001726.4	0.70	NRPS, PKS	pactamide A, pactamide B, pactamide C, pactamide D, pactamide E, pactamide F	Streptomyces pactum
BGC0002509.3	0.68	NRPS	montamide A, capsimycin, clifednamide A, frontalamide A, combamide A	Streptomyces sp.
BGC0001556.5	0.68	NRPS, PKS	combamide	Streptomyces sp.
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 28.65 out of 30.98

Confidence: strong

Additional weak hits (11):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.33 out of 30.22

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.28 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.46 out of 29.38

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 21.46 out of 30.97

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 17.13 out of 30.97

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.71 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.64 out of 32.93

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.01 out of 39.62

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.67 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 32, location 6922335 - 6971791:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - Orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

SACTE_RS30305: pk - Orn

Search NORINE for peptide: strict or relaxed

PKS_AT (569..865): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; CE-Malonyl-CoA: 54.2%; Acetyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 113.3
Methoxymalonyl-CoA: 107.5
Malonyl-CoA: 105.8
Isobutyryl-CoA: 94.1
Ethylmalonyl-CoA: 93.8
Propionyl-CoA: 69.7
Acetyl-CoA: 69.4
trans-1,2-CPDA: 63.9
Benzoyl-CoA: 62.4
2-Methylbutyryl-CoA: 61.5
fatty_acid: 49.5
CHC-CoA: 46.8
inactive: 41.1
3-Methylbutyryl-CoA: 36.6

AMP-binding (2322..2738): Orn

nrpys: Orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: Orn and hydroxy-Orn specific (Orn, OH-Orn)
Single AA prediction:: orn (Orn)

Stachelhaus prediction details:

Stachelhaus sequence:: AAWAFDVFTGDREFVVGSDVNSYGLTEATVDSAF
Nearest Stachelhaus code(s):: Orn DVGEVGSIDK (85% 8Å match)
Stachelhaus code match:: 90% (moderate)

TFBS definitions

Regulator	Description
NuR	Nickel-responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

NC_015953.1 - Region 25 - NRP-metallophore,NRPS,T2PKS,butyrolactone,terpene-precursor

Download region SVG

Location: 7,138,102 - 7,245,746 nt. (total: 107,645 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T2PKS: (t2ks and t2clf)
butyrolactone: AfsA
terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

SACTE_RS31250: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

SACTE_RS31275: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS31450: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

SACTE_RS31465: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

SACTE_RS31490: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

SACTE_RS31500: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acyltransferase carboxylase halogenase kinase methyltransferase transferase

SACTE_RS31375: PfkB domain protein

smcogs: SMCOG1276: PfkB domain protein

SACTE_RS31395: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

SACTE_RS31435: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

SACTE_RS31445: conventional flavin-dependent halogenase

halogenases: conventional flavin-dependent halogenase
smcogs: SMCOG1119: halogenase

SACTE_RS31455: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

SACTE_RS31510: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Hydrolases: hydrolase

SACTE_RS31580: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Lyases: cyclase dehydratase

SACTE_RS31350: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

SACTE_RS31470: Polyketide synthesis cyclase

smcogs: SMCOG1225: Polyketide synthesis cyclase

SACTE_RS31495: cyclase/dehydrase

smcogs: SMCOG1128: cyclase/dehydrase

Isomerases: isomerase

SACTE_RS31270: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase synthetase

SACTE_RS31310: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

SACTE_RS31475: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

SACTE_RS31480: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

SACTE_RS31575: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000849.4	1.92	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	1.87	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	1.40	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000392.5	0.75	NRPS	mirubactin	Actinosynnema mirum DSM 43827
BGC0002578.2	0.68	other (other)	gaburedin A, gaburedin B, gaburedin C, gaburedin D, gaburedin E, gaburedin F	Streptomyces venezuelae ATCC 10712
BGC0002000.4	0.67	PKS	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000253.4	0.62	PKS	oviedomycin	Streptomyces antibioticus
BGC0001825.4	0.61	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.61	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000231.5	0.84	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0000234.5	0.83	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001723.5	0.78	PKS	oviedomycin	Streptomyces antibioticus
BGC0000849.4	0.77	other (butyrolactone)	SCB1, SCB2, SCB3	Streptomyces coelicolor A3(2)
BGC0000848.5	0.77	other (other)	A-factor	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000850.5	0.68	other (other)	γ-butyrolactone	Streptomyces acidiscabies
BGC0000392.5	0.65	NRPS	mirubactin	Actinosynnema mirum DSM 43827
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.64	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.64	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

SACTE_RS31575: PT_FPPS_like

Domain 1 (54 - 340): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.99 out of 20.97

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 32.03 out of 36.53

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 28.57 out of 36.53

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.28 out of 23.43

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

Additional weak hits (45):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.61 out of 30.22

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.81 out of 30.22

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.09 out of 30.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 14.82 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.59 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.01 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 14.78 out of 21.55

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 19.58 out of 29.65

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.52 out of 36.53

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.25 out of 33.14

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.94 out of 32.93

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.10 out of 28.14

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 23.57 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 25.13 out of 36.53

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.96 out of 23.43

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.49 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.29 out of 20.01

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.43 out of 30.25

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.21 out of 20.97

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.76 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 20.92 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.15 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.99 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.57 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 13.09 out of 26.06

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.39 out of 28.14

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.70 out of 29.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.89 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.79 out of 27.78

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 15.68 out of 20.97

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 16.07 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.73 out of 28.19

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.70 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.02 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 13.49 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 14.86 out of 27.78

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 21.08 out of 36.53

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.69 out of 26.85

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.85 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 16.54 out of 28.19

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.22 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Type II PKS

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 33, location 7138101 - 7245746:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-Arg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 34, location 7138101 - 7195699:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-Arg)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 35, location 7173263 - 7245746:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - D-Arg)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

SACTE_RS31310: X - Arg

Search NORINE for peptide: strict or relaxed

AMP-binding (466..859): X

nrpys: Ser, Thr, Dhpg, Hpg

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LHQYFD-SAFDVDTVLGGERNIYGPTEATVDSTT
Nearest Stachelhaus code(s):: Arg DSDDVGAVDK (68% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1927..2321): Arg

nrpys: Arg

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LLQAFDVAFWQVNLVVGAEFNAYGPTEVTINSTT
Nearest Stachelhaus code(s):: Fo-OH-Orn DVWNVGAVNK (94% 8Å match); Arg DVENVGAINK (50% 8Å match)
Stachelhaus code match:: 90% (moderate)