GCF_000149955.1 - 57 region(s)

Download region SVG

Location: 290,453 - 358,256 nt. (total: 67,804 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_10934: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: acetyltransferase

FOXG_10920: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: decarboxylase

FOXG_10933: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: ligase

FOXG_10932: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.70	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.66	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 290452 - 358256:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_10932: X - X

AMP-binding (461..851): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GHHYFSAAQRTSGITLVGERNTYGLSECTQLNFG
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

AMP-binding (1500..1901): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ASMAFDASVQDNIIIVGGELNVYGPTETSMVVTT
Nearest Stachelhaus code(s):: Leu DAWIIGAIVK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

NC_030986.1 - Region 2 - NRPS-like

Download region SVG

Location: 852,244 - 916,004 nt. (total: 63,761 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_11118: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_11118_8c9b6286: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

FOXG_11122: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: ligase

FOXG_11115: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.58	NRPS	peramine	Epichloe festucae
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000307.4	0.56	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.55	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000667.3	0.43	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001168.5	0.42	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0001873.3	0.41	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002164.2	0.58	NRPS	peramine	Epichloe festucae
BGC0002276.2	0.57	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000307.4	0.56	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.55	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.55	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.55	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.55	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000667.3	0.43	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001168.5	0.42	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0001873.3	0.41	NRPS	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

FOXG_11115: Aad

Search NORINE for peptide: strict or relaxed

AMP-binding (21..472): Aad

nrpys: Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YWMSHDPIQRDSHLLYVGDCAAYGTTETSRSVSY
Nearest Stachelhaus code(s):: Aad DPRHFVMRSK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

NC_030986.1 - Region 3 - terpene

Download region SVG

Location: 3,489,675 - 3,520,451 nt. (total: 30,777 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: sulfhydrylase

FOXG_00600: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: deacetylase

FOXG_00602: polysaccharide deacetylase

smcogs: SMCOG1235: polysaccharide deacetylase

Lyases: cyclase

FOXG_17905: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000783.3	0.29	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0002713.2	0.27	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0001207.5	0.24	NRPS	teixobactin	Eleftheria terrae
BGC0000886.4	0.20	other (other)	allylmalonyl-CoA	Streptomyces tsukubensis
BGC0000814.3	0.19	other (other)	K-252a	Nonomuraea longicatena
BGC0000774.4	0.19	saccharide	lipopolysaccharide	Xanthomonas campestris pv. campestris

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000783.3	0.29	saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0002713.2	0.27	NRPS	mevalagmapeptide A, mevalagmapeptide B, mevalagmapeptide C, mevalagmapeptide D	Photorhabdus laumondii subsp. laumondii
BGC0001207.5	0.24	NRPS	teixobactin	Eleftheria terrae
BGC0000886.4	0.20	other (other)	allylmalonyl-CoA	Streptomyces tsukubensis
BGC0000814.3	0.19	other (other)	K-252a	Nonomuraea longicatena
BGC0000774.4	0.19	saccharide	lipopolysaccharide	Xanthomonas campestris pv. campestris

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Terpene

Glossary

No acronyms to display

NC_030986.1 - Region 4 - NRPS-like,cytokinin

Download region SVG

Location: 5,475,599 - 5,564,654 nt. (total: 89,056 nt) Show pHMM detection rules used

cytokinin: (IPPT and Lysine_decarbox)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FOXG_01238: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_01241: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_01243: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_01247: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: dehydratase

FOXG_18054: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

FOXG_01259: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.28	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002163.3	0.27	other (other)	fusatin, fusatinic acid, 8-oxo-fusatin, 8-oxo-isopentenyladenine	Fusarium pseudograminearum CS3096
BGC0001255.4	0.23	NRPS, PKS	equisetin	Fusarium heterosporum
BGC0002213.3	0.23	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0002191.2	0.20	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0000292.4	0.19	NRPS	acetylaranotin	Aspergillus terreus NIH2624
BGC0001616.3	0.19	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0000983.5	0.18	NRPS, PKS	cytochalasin E, cytochalasin K	Aspergillus clavatus NRRL 1
BGC0000977.4	0.18	NRPS, PKS	cyclopiazonic acid, 2-oxocyclopiazonic acid	Aspergillus oryzae
BGC0002736.2	0.18	terpene	preaspterpenacid I	Aspergillus terreus NIH2624

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.61	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002163.3	0.61	other (other)	fusatin, fusatinic acid, 8-oxo-fusatin, 8-oxo-isopentenyladenine	Fusarium pseudograminearum CS3096
BGC0002191.2	0.57	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001616.3	0.51	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0002609.2	0.51	NRPS, PKS	ochratoxin A	Aspergillus welwitschiae
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0001969.3	0.48	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002167.2	0.48	NRPS	actinopolymorphol C, morpholine containing hemiacetal piperazine compound, piperazine compound 2, piperazine compound 1, 3-(p-hydroxyphenyl)-1,2-propanediol, N,N-dioxide containing derivate, O-sulfonated actinopolymorphol C, C-3 sulfonylated derivative	Aspergillus flavus NRRL3357
BGC0002260.3	0.47	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0002246.3	0.46	terpene	naematolin	Hypholoma sublateritium FD-334 SS-4

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 4, location 5475598 - 5564654:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 6, location 5501253 - 5564654:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_01259: X

AMP-binding (47..366): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -EWMHAAGTYLSLLITGGGRNV-------ISSTE
Nearest Stachelhaus code(s):: Leu DAWLIGAIYK (26% 8Å match)
Stachelhaus code match:: 60% (weak)

NC_030987.1 - Region 1 - T1PKS

Download region SVG

Location: 679,845 - 746,914 nt. (total: 67,070 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_05819: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_05820: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

FOXG_05817: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Ligases: synthase

FOXG_05816: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Translocases: permease

FOXG_05812: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001242.3	0.76	PKS	oxyjavanicin	Fusarium fujikuroi
BGC0001284.4	0.67	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002175.3	0.65	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.65	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.65	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002154.2	0.65	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.65	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002236.2	0.61	PKS	8-methyldiaporthin	Aspergillus oryzae RIB40
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001242.3	0.76	PKS	oxyjavanicin	Fusarium fujikuroi
BGC0001284.4	0.67	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002175.3	0.65	PKS	YWA1	Aspergillus oryzae RIB40
BGC0000107.3	0.65	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.65	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002154.2	0.65	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.65	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0002236.2	0.61	PKS	8-methyldiaporthin	Aspergillus oryzae RIB40
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 679844 - 746914:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_05816: mal

PKS_AT (907..1204): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 54.2%; inactive: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 90.4
Methoxymalonyl-CoA: 62.7
Methylmalonyl-CoA: 59.7
inactive: 47.9
Propionyl-CoA: 29.1
2-Methylbutyryl-CoA: 23.4
fatty_acid: 22.6
Isobutyryl-CoA: 22.5
Ethylmalonyl-CoA: 17.3
3-Methylbutyryl-CoA: 16.3
CHC-CoA: 15.0
Acetyl-CoA: 13.8
Benzoyl-CoA: 12.4
trans-1,2-CPDA: 0.0

NC_030987.1 - Region 2 - terpene

Download region SVG

Location: 902,090 - 933,350 nt. (total: 31,261 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_05899: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: amidase

FOXG_05895: amidase

smcogs: SMCOG1105: amidase

Lyases: cyclase

FOXG_19140: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Translocases: permease

FOXG_05903: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.77	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0002610.3	0.54	terpene	stellatic acid	Aspergillus stellatus
BGC0002320.3	0.54	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0001475.4	0.49	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0000631.5	0.48	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002557.2	0.45	terpene	penifulvin A	Penicillium griseofulvum
BGC0001811.3	0.45	terpene	trichodiene-11-one	Fusarium asiaticum
BGC0001659.3	0.42	terpene	mangicol A	Fusarium equiseti
BGC0001995.3	0.42	terpene	heptelidic acid	Aspergillus oryzae RIB40
BGC0001277.4	0.42	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.77	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0002610.3	0.54	terpene	stellatic acid	Aspergillus stellatus
BGC0002320.3	0.54	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0001475.4	0.49	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0000631.5	0.48	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0002557.2	0.45	terpene	penifulvin A	Penicillium griseofulvum
BGC0001811.3	0.45	terpene	trichodiene-11-one	Fusarium asiaticum
BGC0001659.3	0.42	terpene	mangicol A	Fusarium equiseti
BGC0001995.3	0.42	terpene	heptelidic acid	Aspergillus oryzae RIB40
BGC0001277.4	0.42	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

FOXG_19140: T1TS

Domain 1 (12 - 324): Type 1 terpene synthase

Subtype: unknown

Terpene

Glossary

No acronyms to display

NC_030987.1 - Region 3 - terpene

Download region SVG

Location: 1,378,524 - 1,410,073 nt. (total: 31,550 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: protease

FOXG_06062: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001839.3	0.62	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000504.5	0.39	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000595.3	0.33	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000473.4	0.33	ribosomal	aerucyclamide A, aerucyclamide B, aerucyclamide C, aerucyclamide D	Microcystis aeruginosa NIES-298
BGC0000597.4	0.32	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0001339.5	0.27	PKS	squalestatin S1	Phoma sp. MF5453
BGC0002122.2	0.25	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0002338.3	0.22	PKS	Sorangipyranone	Myxococcales bacterium
BGC0001194.5	0.22	PKS	hitachimycin	Streptomyces scabrisporus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001839.3	0.62	terpene	squalestatin S1	Aspergillus sp. Z5
BGC0000504.5	0.39	ribosomal	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000595.3	0.33	ribosomal	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000473.4	0.33	ribosomal	aerucyclamide A, aerucyclamide B, aerucyclamide C, aerucyclamide D	Microcystis aeruginosa NIES-298
BGC0000597.4	0.32	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0000842.5	0.28	other (non-nrp beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0001339.5	0.27	PKS	squalestatin S1	Phoma sp. MF5453
BGC0002122.2	0.25	NRPS	gramicidin S	Aneurinibacillus migulanus
BGC0002338.3	0.22	PKS	Sorangipyranone	Myxococcales bacterium
BGC0001194.5	0.22	PKS	hitachimycin	Streptomyces scabrisporus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene		squalene	C30	acyclic	none

Genes with terpene domains:

FOXG_06061_db62023a: PT_phytoene_like

Domain 1 (44 - 425): Prenyltransferase; Phytoene synthase like

Subtype: Squalene synthase

Reactions:: FPP → squalene

FOXG_06061: PT_phytoene_like

Domain 1 (44 - 435): Prenyltransferase; Phytoene synthase like

Subtype: Squalene synthase

Reactions:: FPP → squalene

Terpene

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate

NC_030987.1 - Region 4 - NRP-metallophore,NRPS

Download region SVG

Location: 2,594,679 - 2,675,694 nt. (total: 81,016 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_06447: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

FOXG_06447_4b833dbd: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Ligases: ligase

FOXG_06448: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_06448_35493d72: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_06448_733573ac: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_06449: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.58	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.58	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.57	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.57	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.57	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.57	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001629.3	0.56	NRPS	jessenipeptin	Pseudomonas sp. QS1027
BGC0001128.4	0.54	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.54	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.54	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.62	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001261.3	0.62	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.62	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.62	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001249.5	0.62	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001629.3	0.62	NRPS	jessenipeptin	Pseudomonas sp. QS1027
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.61	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 4, location 2594678 - 2675694:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X) + (X - X - X) + (X - X - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_06448: X - X - X

AMP-binding (46..450): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAHAFDVSVFEFELLTIGEWAMYGPTEATIHCTL
Nearest Stachelhaus code(s):: Orn DVSELGTINK (59% 8Å match); Dab DVGELSSIDK (41% 8Å match); Ser DLFNLGLIHK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1092..1485): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NHLCFDVSVFEYSMVTAGEWQGYGPSETTNICTV
Nearest Stachelhaus code(s):: Ala DVFSVALVYK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2716..3112): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAFAFDVSVLEWDLITGGEYNAYGPTEATIGVTM
Nearest Stachelhaus code(s):: Val DVLSFGAIIK (68% 8Å match); Phe or Trp DVLSIGAVVK (62% 8Å match); Arg DVESIGAIAK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

FOXG_06448_35493d72: X - X - X

AMP-binding (46..450): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAHAFDVSVFEFELLTIGEWAMYGPTEATIHCTL
Nearest Stachelhaus code(s):: Orn DVSELGTINK (59% 8Å match); Dab DVGELSSIDK (41% 8Å match); Ser DLFNLGLIHK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1092..1485): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NHLCFDVSVFEYSMVTAGEWQGYGPSETTNICTV
Nearest Stachelhaus code(s):: Ala DVFSVALVYK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2716..3112): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAFAFDVSVLEWDLITGGEYNAYGPTEATIGVTM
Nearest Stachelhaus code(s):: Val DVLSFGAIIK (68% 8Å match); Phe or Trp DVLSIGAVVK (62% 8Å match); Arg DVESIGAIAK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

FOXG_06448_733573ac: X - X - X

AMP-binding (25..429): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAHAFDVSVFEFELLTIGEWAMYGPTEATIHCTL
Nearest Stachelhaus code(s):: Orn DVSELGTINK (59% 8Å match); Dab DVGELSSIDK (41% 8Å match); Ser DLFNLGLIHK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (1071..1464): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NHLCFDVSVFEYSMVTAGEWQGYGPSETTNICTV
Nearest Stachelhaus code(s):: Ala DVFSVALVYK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2695..3091): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAFAFDVSVLEWDLITGGEYNAYGPTEATIGVTM
Nearest Stachelhaus code(s):: Val DVLSFGAIIK (68% 8Å match); Phe or Trp DVLSIGAVVK (62% 8Å match); Arg DVESIGAIAK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

NC_030987.1 - Region 5 - T1PKS

Download region SVG

Location: 5,044,271 - 5,112,128 nt. (total: 67,858 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

FOXG_22249: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthase

FOXG_15886: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.75	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.65	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.75	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.65	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001275.3	0.63	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 5, location 5044270 - 5112128:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_15886: pk

PKS_AT (540..845): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; 2-Methylbutyryl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 76.3
Methoxymalonyl-CoA: 63.6
Malonyl-CoA: 48.8
Propionyl-CoA: 43.6
Isobutyryl-CoA: 39.7
Ethylmalonyl-CoA: 39.6
trans-1,2-CPDA: 36.1
2-Methylbutyryl-CoA: 30.5
Benzoyl-CoA: 28.1
fatty_acid: 19.9
inactive: 12.9
CHC-CoA: 12.9
Acetyl-CoA: 9.7
3-Methylbutyryl-CoA: 9.1

NC_030988.1 - Region 1 - T1PKS

Download region SVG

Location: 4,920,221 - 4,988,188 nt. (total: 67,968 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_14853: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_14853_ab512f70: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: synthase

FOXG_14850: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.75	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.66	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002155.3	0.54	PKS	nectriapyrone C, nectriapyrone D, nectriapyrone	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.75	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.66	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.63	PKS	FR901512	fungal sp. No.14919
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002155.3	0.54	PKS	nectriapyrone C, nectriapyrone D, nectriapyrone	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 4920220 - 4988188:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_14850: pk

PKS_AT (577..882): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; 2-Methylbutyryl-CoA: 62.5%; Methylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 73.7
Methoxymalonyl-CoA: 62.1
Malonyl-CoA: 43.2
Propionyl-CoA: 42.2
Ethylmalonyl-CoA: 35.4
trans-1,2-CPDA: 30.6
2-Methylbutyryl-CoA: 29.6
Benzoyl-CoA: 27.3
fatty_acid: 17.4
Isobutyryl-CoA: 15.6
CHC-CoA: 12.3
inactive: 11.3
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

NC_030989.1 - Region 1 - terpene

Download region SVG

Location: 738,898 - 771,392 nt. (total: 32,495 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: carboxylase

FOXG_07646: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001248.3	0.79	terpene	clavaric acid	Hypholoma sublateritium
BGC0000669.3	0.46	terpene	marneral	Arabidopsis thaliana
BGC0001317.3	0.43	terpene	lupeol	Lotus japonicus
BGC0002402.2	0.42	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0002449.2	0.38	other (other)	sarasinoside	uncultured bacterium
BGC0002284.3	0.37	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000670.4	0.35	terpene	thalianol, thaliandiol, thalianin	Arabidopsis thaliana
BGC0000234.5	0.35	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001314.3	0.34	terpene	tirucalla	Arabidopsis thaliana
BGC0000261.5	0.31	PKS	R1128	Streptomyces sp. R1128

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001248.3	0.79	terpene	clavaric acid	Hypholoma sublateritium
BGC0000669.3	0.46	terpene	marneral	Arabidopsis thaliana
BGC0001317.3	0.43	terpene	lupeol	Lotus japonicus
BGC0002402.2	0.42	terpene	Yossoside I, Yossoside II, Yossoside III, Yossoside IV, Yossoside V	Spinacia oleracea
BGC0002449.2	0.38	other (other)	sarasinoside	uncultured bacterium
BGC0002284.3	0.37	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000670.4	0.35	terpene	thalianol, thaliandiol, thalianin	Arabidopsis thaliana
BGC0000234.5	0.35	PKS	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0001314.3	0.34	terpene	tirucalla	Arabidopsis thaliana
BGC0000261.5	0.31	PKS	R1128	Streptomyces sp. R1128

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	steroid		C30	steroid skeleton	OH

Genes with terpene domains:

FOXG_07651: T2TS

Domain 1 (31 - 752): Type 2 terpene synthase

Subtype: Oxidosqualene substrate

Reactions:: 2,3-oxidosqualene → steroid

Terpene

Glossary

No acronyms to display

NC_030989.1 - Region 2 - NRPS-like

Download region SVG

Location: 2,713,935 - 2,777,304 nt. (total: 63,370 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

FOXG_03842: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

FOXG_03839: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

FOXG_03839_41a26926: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000841.5	0.41	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001913.3	0.37	PKS	phomoidride	fungal sp. ATCC 74256
BGC0002812.2	0.36	PKS, terpene	Colletochlorin A, Colletorin A, Colletochlorin B, Colletochlorin D, Colletorin D, Colletorin D acid, Orsellinic acid, Colletorin B	Colletotrichum higginsianum IMI 349063
BGC0001390.3	0.36	NRPS, PKS	LL-Z1272beta	Stachybotrys bisbyi
BGC0001242.3	0.36	PKS	oxyjavanicin	Fusarium fujikuroi
BGC0001827.3	0.35	PKS	xenovulene A	Sarocladium sp. 'schorii'
BGC0000292.4	0.35	NRPS	acetylaranotin	Aspergillus terreus NIH2624
BGC0002594.2	0.35	PKS	orcinol, orsellinic acid	Fusarium graminearum PH-1
BGC0001600.3	0.35	PKS	fusarielin H	Fusarium graminearum
BGC0002212.3	0.34	PKS	Orsellinic acid	Moniliophthora roreri MCA 2997

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000841.5	0.41	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0001913.3	0.37	PKS	phomoidride	fungal sp. ATCC 74256
BGC0002812.2	0.36	PKS, terpene	Colletochlorin A, Colletorin A, Colletochlorin B, Colletochlorin D, Colletorin D, Colletorin D acid, Orsellinic acid, Colletorin B	Colletotrichum higginsianum IMI 349063
BGC0001390.3	0.36	NRPS, PKS	LL-Z1272beta	Stachybotrys bisbyi
BGC0001242.3	0.36	PKS	oxyjavanicin	Fusarium fujikuroi
BGC0001827.3	0.35	PKS	xenovulene A	Sarocladium sp. 'schorii'
BGC0000292.4	0.35	NRPS	acetylaranotin	Aspergillus terreus NIH2624
BGC0002594.2	0.35	PKS	orcinol, orsellinic acid	Fusarium graminearum PH-1
BGC0001600.3	0.35	PKS	fusarielin H	Fusarium graminearum
BGC0002212.3	0.34	PKS	Orsellinic acid	Moniliophthora roreri MCA 2997

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

FOXG_03842: X

AMP-binding (65..358): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AVHSHSHGFYERHCLYAGSCGNYGATETGRLATS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

NC_030989.1 - Region 3 - NRPS,T1PKS,indole

Download region SVG

Location: 2,955,791 - 3,041,733 nt. (total: 85,943 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

FOXG_03929: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

FOXG_03941: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

FOXG_03941_2dffda8e: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

FOXG_03941_b86b4015: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

FOXG_03949: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_03951: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: aminotransferase sulfhydrylase

FOXG_03940: aminotransferase

smcogs: SMCOG1019: aminotransferase

FOXG_18693: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

FOXG_18695: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Lyases: hydratase

FOXG_03931: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: synthase

FOXG_03945: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001268.4	1.06	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002192.3	1.03	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.95	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.68	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.61	PKS	asperlactone	Aspergillus ochraceus
BGC0000037.4	0.59	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0002230.2	0.49	NRPS, PKS	tolypyridone C	Tolypocladium sp. 49Y
BGC0002505.3	0.48	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0001741.3	0.47	NRPS, PKS	phyllostictine A, phyllostictine B	Phyllosticta cirsii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001268.4	0.80	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002192.3	0.79	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.77	PKS	ACT-Toxin II	Alternaria alternata
BGC0001284.4	0.67	PKS	alternariol	Parastagonospora nodorum SN15
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0000037.4	0.63	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0002230.2	0.58	NRPS, PKS	tolypyridone C	Tolypocladium sp. 49Y
BGC0002505.3	0.57	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0001741.3	0.57	NRPS, PKS	phyllostictine A, phyllostictine B	Phyllosticta cirsii

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 3, location 2955790 - 3041733:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 2970005 - 3041733:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_03945: pk - X

PKS_AT (330..648): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 87.3
Methoxymalonyl-CoA: 77.6
Ethylmalonyl-CoA: 66.1
trans-1,2-CPDA: 45.1
Malonyl-CoA: 41.5
Benzoyl-CoA: 41.3
Isobutyryl-CoA: 37.1
Propionyl-CoA: 33.9
CHC-CoA: 27.4
2-Methylbutyryl-CoA: 20.7
fatty_acid: 14.8
3-Methylbutyryl-CoA: 9.4
inactive: 0.0
Acetyl-CoA: 0.0

AMP-binding (2901..3307): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LPHSFDLSIDQLMCVWSGGFNHCGPTETTVTNRI
Nearest Stachelhaus code(s):: Asp DLTKVGHVGK (44% 8Å match)
Stachelhaus code match:: 60% (weak)

NC_030989.1 - Region 4 - isocyanide

Download region SVG

Location: 4,656,601 - 4,718,683 nt. (total: 62,083 nt) Show pHMM detection rules used

isocyanide: cds(TauD and DIT1_PvcA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FOXG_04516: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_04519: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_04525: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Lyases: dehydratase

FOXG_04509: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000923.3	0.51	other (other)	paerucumarin	Pseudomonas aeruginosa PAO1
BGC0001924.3	0.45	terpene	ascofuranone	Acremonium egyptiacum
BGC0000667.3	0.42	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0002404.2	0.41	other (other)	falcarindiol	Solanum lycopersicum
BGC0001219.3	0.39	PKS	shanorellin	Chaetomium globosum CBS 148.51
BGC0002216.3	0.39	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000231.5	0.38	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001126.4	0.37	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001612.3	0.37	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000923.3	0.51	other (other)	paerucumarin	Pseudomonas aeruginosa PAO1
BGC0001924.3	0.45	terpene	ascofuranone	Acremonium egyptiacum
BGC0000667.3	0.42	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0002404.2	0.41	other (other)	falcarindiol	Solanum lycopersicum
BGC0001219.3	0.39	PKS	shanorellin	Chaetomium globosum CBS 148.51
BGC0002216.3	0.39	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001594.3	0.38	other (other)	fischerindole L	Fischerella muscicola UTEX 1829
BGC0000231.5	0.38	PKS	griseusin A, griseusin B	Streptomyces griseus
BGC0001126.4	0.37	other (other), terpene	12-epi-hapalindole J isonitrile, ambiguine A isonitrile, ambiguine B isonitrile, ambiguine C isonitrile, ambiguine D isonitrile, ambiguine E isonitrile, ambiguine K isonitrile, ambiguine L isonitrile, ambiguine I isonitrile, ambiguine J isonitrile	Fischerella ambigua UTEX 1903
BGC0001612.3	0.37	other (other)	ambiguine H isonitrile	Fischerella ambigua UTEX 1903

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

NC_030990.1 - Region 1 - NRPS-like,T1PKS

Download region SVG

Location: 143,160 - 235,036 nt. (total: 91,877 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_15241: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_15242: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: sulfhydrylase

FOXG_15240: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Lyases: dehydratase

FOXG_15249: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

FOXG_15239: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_15248: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.67	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.61	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000107.3	0.59	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.58	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.58	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002240.3	0.52	PKS	BAB, BAA	Metarhizium anisopliae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.67	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.65	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.64	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.62	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002240.3	0.60	PKS	BAB, BAA	Metarhizium anisopliae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 143159 - 235036:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 143159 - 206526:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 167609 - 235036:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk) + (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_15239: X

AMP-binding (19..343): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: -WTA---ICLGSFITSAGGMQTMGMTEGQWLASV
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

FOXG_15248: pk

PKS_AT (609..925): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Ethylmalonyl-CoA: 58.3%; Methoxymalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 81.7
Methoxymalonyl-CoA: 72.0
Malonyl-CoA: 66.9
Isobutyryl-CoA: 58.9
Propionyl-CoA: 39.4
inactive: 29.4
fatty_acid: 27.3
Benzoyl-CoA: 26.3
2-Methylbutyryl-CoA: 26.3
trans-1,2-CPDA: 24.1
CHC-CoA: 20.8
Acetyl-CoA: 17.5
3-Methylbutyryl-CoA: 9.1
Ethylmalonyl-CoA: -1.1

NC_030990.1 - Region 2 - NRPS,T1PKS

Download region SVG

Location: 313,148 - 385,409 nt. (total: 72,262 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_15298: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_15302: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Ligases: synthase

FOXG_15296: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002192.3	0.95	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.94	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001254.3	0.91	PKS	ACT-Toxin II	Alternaria alternata
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.58	PKS	asperlactone	Aspergillus ochraceus
BGC0001255.4	0.57	NRPS, PKS	equisetin	Fusarium heterosporum
BGC0002304.3	0.52	NRPS, PKS	varicidin A	Talaromyces variabilis
BGC0002230.2	0.52	NRPS, PKS	tolypyridone C	Tolypocladium sp. 49Y
BGC0001305.4	0.48	PKS	fujikurin A, fujikurin B, fujikurin C, fujikurin D	Fusarium fujikuroi IMI 58289
BGC0002139.3	0.47	PKS	burnettiene A, preburnettiene B, preburnettiene A	Aspergillus burnettii FRR 5400

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002192.3	0.77	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.77	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001254.3	0.76	PKS	ACT-Toxin II	Alternaria alternata
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001273.3	0.63	PKS	asperlactone	Aspergillus ochraceus
BGC0001255.4	0.62	NRPS, PKS	equisetin	Fusarium heterosporum
BGC0002304.3	0.60	NRPS, PKS	varicidin A	Talaromyces variabilis
BGC0002230.2	0.60	NRPS, PKS	tolypyridone C	Tolypocladium sp. 49Y
BGC0001305.4	0.57	PKS	fujikurin A, fujikurin B, fujikurin C, fujikurin D	Fusarium fujikuroi IMI 58289
BGC0002139.3	0.57	PKS	burnettiene A, preburnettiene B, preburnettiene A	Aspergillus burnettii FRR 5400

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 4, location 313147 - 385409:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk - Ser)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_15296: pk - Ser

Search NORINE for peptide: strict or relaxed

PKS_AT (539..841): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 70.8%; Ethylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 92.7
Methoxymalonyl-CoA: 74.1
Ethylmalonyl-CoA: 68.4
Isobutyryl-CoA: 54.4
Malonyl-CoA: 48.6
Benzoyl-CoA: 37.7
Propionyl-CoA: 31.7
trans-1,2-CPDA: 30.7
Acetyl-CoA: 25.9
2-Methylbutyryl-CoA: 20.4
fatty_acid: 15.6
3-Methylbutyryl-CoA: 14.3
inactive: 12.3
CHC-CoA: 10.6

AMP-binding (3015..3415): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YVSSFDFSLDQATAFSGGEFNGYGPAETTILSHR
Nearest Stachelhaus code(s):: Ser DFDTFGGILK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

NC_030990.1 - Region 3 - NRPS-like

Download region SVG

Location: 2,385,663 - 2,449,433 nt. (total: 63,771 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

FOXG_01867: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002555.3	0.34	NRPS, PKS	emerimicin V, emerimicin VI, emerimicin VII, emerimicin VIII, emerimicin IX, emerimicin X	Acremonium sp.
BGC0002505.3	0.31	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0002239.2	0.27	NRPS, PKS	GKK1032 A2, pyrrocidine A, pyrrocidine B	Acremonium sp.
BGC0001363.5	0.24	NRPS, PKS	ralsolamycin	Ralstonia solanacearum GMI1000
BGC0002188.3	0.23	NRPS, PKS	W493 B, W493 A	Fusarium pseudograminearum CS3096
BGC0002180.2	0.22	PKS	(+)-asperlin, (2Z,4Z,6E)-octa-2,4,6-trienoic acid	Aspergillus nidulans FGSC A4
BGC0001423.4	0.22	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0002472.2	0.21	NRPS	ulbactin F, ulbactin G	Brevibacillus brevis
BGC0001277.4	0.21	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0001278.4	0.20	terpene	T-2 toxin	Fusarium sporotrichioides

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002555.3	0.34	NRPS, PKS	emerimicin V, emerimicin VI, emerimicin VII, emerimicin VIII, emerimicin IX, emerimicin X	Acremonium sp.
BGC0002505.3	0.31	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0002239.2	0.27	NRPS, PKS	GKK1032 A2, pyrrocidine A, pyrrocidine B	Acremonium sp.
BGC0001363.5	0.24	NRPS, PKS	ralsolamycin	Ralstonia solanacearum GMI1000
BGC0002188.3	0.23	NRPS, PKS	W493 B, W493 A	Fusarium pseudograminearum CS3096
BGC0002180.2	0.22	PKS	(+)-asperlin, (2Z,4Z,6E)-octa-2,4,6-trienoic acid	Aspergillus nidulans FGSC A4
BGC0001423.4	0.22	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0002472.2	0.21	NRPS	ulbactin F, ulbactin G	Brevibacillus brevis
BGC0001277.4	0.21	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0001278.4	0.20	terpene	T-2 toxin	Fusarium sporotrichioides

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NC_030990.1 - Region 4 - terpene-precursor

Download region SVG

Location: 2,979,910 - 3,011,024 nt. (total: 31,115 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: dehydratase

FOXG_02037: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

FOXG_02037_1c94b090: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthetase

FOXG_02039: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000690.5	0.28	saccharide	hydroxystreptomycin	Streptomyces glaucescens
BGC0000724.5	0.28	saccharide	streptomycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000168.5	0.27	PKS	viridicatumtoxin	Penicillium aethiopicum
BGC0001373.3	0.23	PKS	sordarin	Sordaria araneosa
BGC0001675.5	0.23	PKS	murayaquinone	Streptomyces griseoruber
BGC0000033.5	0.20	PKS	calicheamicin	Micromonospora echinospora

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000690.5	0.28	saccharide	hydroxystreptomycin	Streptomyces glaucescens
BGC0000724.5	0.28	saccharide	streptomycin	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000168.5	0.27	PKS	viridicatumtoxin	Penicillium aethiopicum
BGC0001373.3	0.23	PKS	sordarin	Sordaria araneosa
BGC0001675.5	0.23	PKS	murayaquinone	Streptomyces griseoruber
BGC0000033.5	0.20	PKS	calicheamicin	Micromonospora echinospora

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor		FPP	C15	acyclic	PP

Genes with terpene domains:

FOXG_02039: PT_FPPS_like

Domain 1 (44 - 347): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Farnesyl diphosphate synthase, fungal

Reactions:: DMAPP, IPP → FPP

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

NC_030990.1 - Region 5 - betalactone

Download region SVG

Location: 3,875,096 - 3,917,690 nt. (total: 42,595 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase synthase

FOXG_02313: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_02315: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001441.5	0.31	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0001440.5	0.30	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0001422.4	0.29	NRPS, PKS	myxochromide A	Myxococcus fulvus HW-1
BGC0001423.4	0.27	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001562.5	0.27	NRPS	curacomycin	Streptomyces curacoi
BGC0001424.4	0.27	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001426.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001427.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001428.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001425.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001441.5	0.31	other (other)	belactosin A, belactosin C	Streptomyces sp.
BGC0001440.5	0.30	other (other)	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0001422.4	0.29	NRPS, PKS	myxochromide A	Myxococcus fulvus HW-1
BGC0001423.4	0.27	NRPS, PKS	myxochromide C	Myxococcus hansupus
BGC0001562.5	0.27	NRPS	curacomycin	Streptomyces curacoi
BGC0001424.4	0.27	NRPS, PKS	myxochromide C	Myxococcus virescens
BGC0001426.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001427.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001428.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus
BGC0001425.4	0.27	NRPS, PKS	myxochromide A	Myxococcus xanthus DK 1622

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

NC_030990.1 - Region 6 - NRPS-like

Download region SVG

Location: 4,265,679 - 4,329,533 nt. (total: 63,855 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase reductase

FOXG_02447: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_02467: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

Ligases: ligase

FOXG_02458: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

FOXG_02459: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.80	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001928.2	0.47	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000308.5	0.46	NRPS	aureusimine A, aureusimine B, aureusimine C	Staphylococcus aureus subsp. aureus str. JKD6008
BGC0002518.3	0.45	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0002171.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.80	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001928.2	0.47	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000308.5	0.46	NRPS	aureusimine A, aureusimine B, aureusimine C	Staphylococcus aureus subsp. aureus str. JKD6008
BGC0002518.3	0.45	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0002171.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 8, location 4265678 - 4329533:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_02458: X

AMP-binding (13..380): X

nrpys: Phe, Trp

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SDLV---FIWERLM--LGD-------ETAVGDIR
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

NC_030990.1 - Region 7 - NRPS-like

Download region SVG

Location: 4,540,445 - 4,605,454 nt. (total: 65,010 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_02532: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

Hydrolases: protease

FOXG_18343: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase

FOXG_02540: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000306.5	0.36	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0001190.3	0.32	PKS	fusaric acid	Fusarium verticillioides 7600
BGC0001205.3	0.31	PKS	communesin A, communesin B, communesin C, communesin D, communesin E, communesin G, communesin H	Penicillium expansum
BGC0000326.5	0.30	NRPS	isocomplestatin	Streptomyces lavendulae
BGC0000395.5	0.30	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis
BGC0002448.2	0.29	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000721.4	0.29	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001620.5	0.29	NRPS, PKS	ilamycin B1, ilamycin B2, ilamycin C1, ilamycin C2, ilamycin D, ilamycin E1	Streptomyces atratus
BGC0002198.3	0.28	NRPS	nanangelenin B, terreazepine	Aspergillus terreus var. terreus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001206.5	0.42	other (other)	indolmycin	Streptomyces griseus subsp. griseus
BGC0000306.5	0.36	NRPS	arylomycin	Streptomyces filamentosus NRRL 11379
BGC0001190.3	0.32	PKS	fusaric acid	Fusarium verticillioides 7600
BGC0001205.3	0.31	PKS	communesin A, communesin B, communesin C, communesin D, communesin E, communesin G, communesin H	Penicillium expansum
BGC0000326.5	0.30	NRPS	isocomplestatin	Streptomyces lavendulae
BGC0000395.5	0.30	NRPS	nocardicin A	Nocardia uniformis subsp. tsuyamanensis
BGC0002448.2	0.29	NRPS	Q6402A	Streptomyces violaceusniger
BGC0000721.4	0.29	saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0001620.5	0.29	NRPS, PKS	ilamycin B1, ilamycin B2, ilamycin C1, ilamycin C2, ilamycin D, ilamycin E1	Streptomyces atratus
BGC0002198.3	0.28	NRPS	nanangelenin B, terreazepine	Aspergillus terreus var. terreus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 9, location 4540444 - 4605454:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_02540: X

AMP-binding (104..501): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GFVMVGGLVRNAYACNAAGLPSYGMTECMPISTP
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

NC_030992.1 - Region 1 - NRPS-like

Download region SVG

Location: 32,651 - 95,698 nt. (total: 63,048 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FOXG_04702: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

FOXG_04715: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: sulfhydrylase

FOXG_04711: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: protease

FOXG_04700: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Lyases: dehydratase

FOXG_04704: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

FOXG_04709: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_04710: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001168.5	0.52	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0002146.2	0.49	NRPS	FR901483	Cladobotryum sp.
BGC0002602.2	0.48	other (other)	aspergillic acid	Aspergillus flavus
BGC0000889.5	0.48	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000992.4	0.48	NRPS, PKS	fusaridione A, (3R,5S)-5-(4-hydroxybenzyl)-3-methyl-3-((2E,4E,6E,8E,10E)-4,8,10-trimethyldodeca-2,4,6,8,10-pentaenoyl)pyrrolidine-2,4-dione	Fusarium heterosporum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.59	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0000307.4	0.59	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0001240.4	0.59	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001168.5	0.52	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0002146.2	0.49	NRPS	FR901483	Cladobotryum sp.
BGC0002602.2	0.48	other (other)	aspergillic acid	Aspergillus flavus
BGC0000889.5	0.48	other (other)	bagremycin A, bagremycin B	Streptomyces sp. WK-5344
BGC0000992.4	0.48	NRPS, PKS	fusaridione A, (3R,5S)-5-(4-hydroxybenzyl)-3-methyl-3-((2E,4E,6E,8E,10E)-4,8,10-trimethyldodeca-2,4,6,8,10-pentaenoyl)pyrrolidine-2,4-dione	Fusarium heterosporum

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 32650 - 95698:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_04709: X

AMP-binding (9..415): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSTNFDLSLFEVIMLTAGDWNTYGPTECTTLVTM
Nearest Stachelhaus code(s):: Ala DVFIYAAILK (56% 8Å match); Pro DLFYLALVCK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

NC_030992.1 - Region 2 - T1PKS

Download region SVG

Location: 170,576 - 235,331 nt. (total: 64,756 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_04761: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

FOXG_04755: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Hydrolases: hydrolase protease

FOXG_04749: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

FOXG_04759: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: synthase

FOXG_04757: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

FOXG_04757_cb1531b1: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000030.3	0.74	PKS	bikaverin	Fusarium fujikuroi IMI 58289
BGC0000107.3	0.66	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.66	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001258.3	0.65	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002154.2	0.65	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.65	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.64	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002286.3	0.56	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000030.3	0.74	PKS	bikaverin	Fusarium fujikuroi IMI 58289
BGC0000107.3	0.66	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.66	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001258.3	0.65	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0002154.2	0.65	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.65	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001284.4	0.64	PKS	alternariol	Parastagonospora nodorum SN15
BGC0000037.4	0.61	PKS	cichorine	Aspergillus nidulans FGSC A4
BGC0001276.3	0.56	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002286.3	0.56	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

FOXG_04757: mal

PKS_AT (884..1182): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 58.3%; Isobutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.5
Methoxymalonyl-CoA: 59.9
Methylmalonyl-CoA: 57.6
inactive: 39.5
Propionyl-CoA: 25.0
Ethylmalonyl-CoA: 20.4
Benzoyl-CoA: 19.6
fatty_acid: 18.8
2-Methylbutyryl-CoA: 15.6
Isobutyryl-CoA: 15.2
3-Methylbutyryl-CoA: 13.2
Acetyl-CoA: 12.8
CHC-CoA: 12.3
trans-1,2-CPDA: 9.0

FOXG_04757_cb1531b1: mal

PKS_AT (758..1056): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 87.5%; Methoxymalonyl-CoA: 58.3%; Isobutyryl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 100.5
Methoxymalonyl-CoA: 59.9
Methylmalonyl-CoA: 57.6
inactive: 39.5
Propionyl-CoA: 25.0
Ethylmalonyl-CoA: 20.4
Benzoyl-CoA: 19.6
fatty_acid: 18.8
2-Methylbutyryl-CoA: 15.6
Isobutyryl-CoA: 15.2
3-Methylbutyryl-CoA: 13.2
Acetyl-CoA: 12.8
CHC-CoA: 12.3
trans-1,2-CPDA: 9.0

NC_030992.1 - Region 3 - NRPS

Download region SVG

Location: 578,121 - 645,277 nt. (total: 67,157 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_04900: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: protease

FOXG_04896: alkaline serine protease, subtilase family

smcogs: SMCOG1075: alkaline serine protease, subtilase family

Ligases: ligase

FOXG_04898: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001679.3	0.41	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4
BGC0000901.5	0.40	other (other)	ferrichrome	Aspergillus niger
BGC0001517.3	0.40	NRPS	asperphenamate	Aspergillus terreus NIH2624
BGC0002208.3	0.39	NRPS	oxepinamide F	Aspergillus ustus
BGC0002259.2	0.37	NRPS, PKS	beauveriolide I, beauveriolide III	Cordyceps militaris CM01
BGC0000597.4	0.36	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001573.3	0.35	other (other)	dihydrolysergic acid	Claviceps africana
BGC0000355.5	0.35	NRPS	fumiquinazoline A, fumiquinazoline C, fumiquinazoline D	Aspergillus fumigatus Af293

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001240.4	0.61	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0000357.5	0.59	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001679.3	0.41	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4
BGC0000901.5	0.40	other (other)	ferrichrome	Aspergillus niger
BGC0001517.3	0.40	NRPS	asperphenamate	Aspergillus terreus NIH2624
BGC0002208.3	0.39	NRPS	oxepinamide F	Aspergillus ustus
BGC0002259.2	0.37	NRPS, PKS	beauveriolide I, beauveriolide III	Cordyceps militaris CM01
BGC0000597.4	0.36	ribosomal	SWA-2138	Streptomyces sp. e14
BGC0001573.3	0.35	other (other)	dihydrolysergic acid	Claviceps africana
BGC0000355.5	0.35	NRPS	fumiquinazoline A, fumiquinazoline C, fumiquinazoline D	Aspergillus fumigatus Af293

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 3, location 578120 - 645277:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_04898: X

AMP-binding (1151..1520): X

nrpys: Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Cyclic aliphatic chain (polar NH2 group) (Pro, Hpr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: AAQSVDISLVEGYMCFRTR--------ILLAYGA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

NC_030992.1 - Region 4 - terpene-precursor

Download region SVG

Location: 1,821,921 - 1,853,177 nt. (total: 31,257 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: synthetase

FOXG_05311: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000673.3	0.56	terpene	pimara-8(14),15-diene	Aspergillus nidulans FGSC A4
BGC0002610.3	0.52	terpene	stellatic acid	Aspergillus stellatus
BGC0002320.3	0.52	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0002736.2	0.52	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0002162.3	0.51	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0001969.3	0.43	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0000676.5	0.39	terpene	aphidicolin, aphidicolan-16β-ol, 3-deoxyaphidicolin, 17-deoxyaphidicolin	Phoma betae
BGC0000688.4	0.39	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0002245.2	0.38	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0001528.4	0.37	terpene	betaestacin I, betaestacin II	Phoma betae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000673.3	0.56	terpene	pimara-8(14),15-diene	Aspergillus nidulans FGSC A4
BGC0002610.3	0.52	terpene	stellatic acid	Aspergillus stellatus
BGC0002320.3	0.52	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0002736.2	0.52	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0002162.3	0.51	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0001969.3	0.43	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0000676.5	0.39	terpene	aphidicolin, aphidicolan-16β-ol, 3-deoxyaphidicolin, 17-deoxyaphidicolin	Phoma betae
BGC0000688.4	0.39	terpene	copalyl diphosphate	Diaporthe amygdali
BGC0002245.2	0.38	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0001528.4	0.37	terpene	betaestacin I, betaestacin II	Phoma betae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
diterpene precursor		GGPP	C20	acyclic	PP

Genes with terpene domains:

FOXG_05311: PT_FPPS_like

Domain 1 (129 - 417): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: Geranylgeranyl diphosphate synthase

Reactions:: DMAPP, IPP → GGPP

Terpene

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
GGPP	Geranylgeranyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

NC_030992.1 - Region 5 - cytokinin

Download region SVG

Location: 4,057,070 - 4,088,589 nt. (total: 31,520 nt) Show pHMM detection rules used

cytokinin: (IPPT and Lysine_decarbox)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FOXG_10721: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_10725: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_10729: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002163.3	0.60	other (other)	fusatin, fusatinic acid, 8-oxo-fusatin, 8-oxo-isopentenyladenine	Fusarium pseudograminearum CS3096
BGC0001262.3	0.42	PKS	AK-toxin I	Alternaria alternata
BGC0001315.3	0.36	terpene	cucurbitacin C	Cucumis sativus
BGC0001277.4	0.36	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0002213.3	0.36	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001305.4	0.36	PKS	fujikurin A, fujikurin B, fujikurin C, fujikurin D	Fusarium fujikuroi IMI 58289
BGC0002035.3	0.35	NRPS, PKS	ilicicolin H, ilicicolin J, 8-epi-ilicicolin H	Neonectria sp. DH2
BGC0002197.2	0.35	NRPS, PKS	terrestric acid	Penicillium crustosum
BGC0001899.3	0.35	PKS	abscisic acid	Leptosphaeria maculans JN3
BGC0002165.3	0.34	PKS	betaenone C, probetaenone I, stemphyloxin II, compound 4, compound 6, compound 7, compound 9, compound 3, dehydroprobetaenone I, compound 5	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002163.3	0.60	other (other)	fusatin, fusatinic acid, 8-oxo-fusatin, 8-oxo-isopentenyladenine	Fusarium pseudograminearum CS3096
BGC0001262.3	0.42	PKS	AK-toxin I	Alternaria alternata
BGC0001315.3	0.36	terpene	cucurbitacin C	Cucumis sativus
BGC0001277.4	0.36	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0002213.3	0.36	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5
BGC0001305.4	0.36	PKS	fujikurin A, fujikurin B, fujikurin C, fujikurin D	Fusarium fujikuroi IMI 58289
BGC0002035.3	0.35	NRPS, PKS	ilicicolin H, ilicicolin J, 8-epi-ilicicolin H	Neonectria sp. DH2
BGC0002197.2	0.35	NRPS, PKS	terrestric acid	Penicillium crustosum
BGC0001899.3	0.35	PKS	abscisic acid	Leptosphaeria maculans JN3
BGC0002165.3	0.34	PKS	betaenone C, probetaenone I, stemphyloxin II, compound 4, compound 6, compound 7, compound 9, compound 3, dehydroprobetaenone I, compound 5	Parastagonospora nodorum SN15

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

NC_030992.1 - Region 6 - NRPS-like,T1PKS

Download region SVG

Location: 4,201,851 - 4,321,685 nt. (total: 119,835 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

FOXG_10782: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

FOXG_10783: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_10788: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

FOXG_10793: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_10802: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_10811: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: hydrolase

FOXG_10817: isochorismatase

smcogs: SMCOG1027: isochorismatase

Lyases: dehydratase

FOXG_10789: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase synthase

FOXG_10785: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_10805: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.41	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.33	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.32	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.32	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.32	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000088.4	0.29	PKS	lovastatin	Aspergillus terreus
BGC0002222.2	0.29	PKS	zopfiellin	Diffractella curvata
BGC0000631.5	0.28	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0001284.4	0.28	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.27	PKS	ACT-Toxin II	Alternaria alternata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.73	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001268.4	0.63	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001284.4	0.61	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001160.5	0.60	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 6, location 4201850 - 4321685:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 8, location 4253249 - 4321685:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_10785: X

AMP-binding (14..312): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: RANHFGMSSF-RSATTGGS---------------
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

FOXG_10805: pk

PKS_AT (575..889): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 70.8%; 2-Methylbutyryl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 90.1
Methoxymalonyl-CoA: 89.9
Malonyl-CoA: 67.3
Ethylmalonyl-CoA: 61.0
Isobutyryl-CoA: 56.4
Propionyl-CoA: 49.2
2-Methylbutyryl-CoA: 37.5
trans-1,2-CPDA: 31.0
Benzoyl-CoA: 22.9
inactive: 20.3
fatty_acid: 19.8
Acetyl-CoA: 16.9
3-Methylbutyryl-CoA: 13.1
CHC-CoA: 8.9

NC_030993.1 - Region 1 - phosphonate

Download region SVG

Location: 29,040 - 56,058 nt. (total: 27,019 nt) Show pHMM detection rules used

phosphonate: (phosphonates and minimum(1, [2-Hacid_dh_C, Aldedh, Aminotran_1_2, Aminotran_5, AurF, CTP_transf_like, DUF4992, Fe-ADH, HMGL-like, Metallophos_2, NTP_transf_3, NTP_transf_5, PALP, PEP_mutase, TPP_enzyme_C, TPP_enzyme_N, phosphonates]) and not (phosphonatesHydrolase or phosphonatesMeIsocitrateLyase))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase oxidoreductase

FOXG_02661: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

FOXG_02662: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002670.2	0.95	other (other)	fosfonochlorin	Fusarium oxysporum f. sp. lycopersici 4287
BGC0000938.5	0.40	other (aminocoumarin)	fosfomycin	Streptomyces fradiae
BGC0000937.5	0.37	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0002036.4	0.36	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0002216.3	0.36	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001739.3	0.35	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000807.3	0.35	saccharide	phosphonoglycans	Stackebrandtia nassauensis DSM 44728
BGC0000894.4	0.34	other (other)	citrinin	Monascus aurantiacus
BGC0002229.2	0.34	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002670.2	0.95	other (other)	fosfonochlorin	Fusarium oxysporum f. sp. lycopersici 4287
BGC0000938.5	0.40	other (aminocoumarin)	fosfomycin	Streptomyces fradiae
BGC0000937.5	0.37	other (other)	fosfazinomycin A, fosfazinomycin B	Streptomyces sp. WM6372
BGC0002036.4	0.36	other (other)	dehydrofosmidomycin	Streptomyces lavendulae
BGC0002216.3	0.36	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0001739.3	0.35	other (other)	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0000807.3	0.35	saccharide	phosphonoglycans	Stackebrandtia nassauensis DSM 44728
BGC0000894.4	0.34	other (other)	citrinin	Monascus aurantiacus
BGC0002229.2	0.34	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0002213.3	0.34	PKS	HEx-pks16 polyketide	Punctularia strigosozonata HHB-11173 SS5

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

NC_030993.1 - Region 2 - T1PKS

Download region SVG

Location: 269,792 - 337,760 nt. (total: 67,969 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FOXG_02729: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

FOXG_02730: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

FOXG_02730_b9840e93: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

FOXG_02731: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_02736: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_02736_384a9f7f: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_02736_a3fcac70: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_02743: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

FOXG_02745: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: glycosyltransferase

FOXG_02740: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

Ligases: synthase

FOXG_02741: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.76	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.76	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000107.3	0.63	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0002175.3	0.63	PKS	YWA1	Aspergillus oryzae RIB40
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 2, location 269791 - 337760:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_02741: pk

PKS_AT (559..883): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; Methylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 67.1
Malonyl-CoA: 60.5
Methoxymalonyl-CoA: 58.8
Isobutyryl-CoA: 55.5
Ethylmalonyl-CoA: 41.3
Propionyl-CoA: 29.0
Benzoyl-CoA: 18.2
2-Methylbutyryl-CoA: 15.1
fatty_acid: 14.0
CHC-CoA: 13.8
trans-1,2-CPDA: 13.5
inactive: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

NC_030993.1 - Region 3 - T1PKS

Download region SVG

Location: 636,911 - 704,221 nt. (total: 67,311 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

FOXG_02879: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_18423: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

Hydrolases: hydrolase

FOXG_02890: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: hydratase

FOXG_02875: Nitrilase/cyanide hydratase and apolipoprotein

smcogs: SMCOG1294: Nitrilase/cyanide hydratase and apolipoprotein

Ligases: synthase

FOXG_02884: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: permease

FOXG_02876: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000046.4	0.76	PKS	depudecin	Alternaria brassicicola
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002227.3	0.50	NRPS	AKML B, AKML D, AKML A, AKML C	Aspergillus luchuensis IFO 4308
BGC0002228.3	0.49	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum
BGC0002180.2	0.48	PKS	(+)-asperlin, (2Z,4Z,6E)-octa-2,4,6-trienoic acid	Aspergillus nidulans FGSC A4
BGC0002240.3	0.48	PKS	BAB, BAA	Metarhizium anisopliae
BGC0002211.3	0.47	PKS	HEx-pks1 polyketide	Paraphaeosphaeria sporulosa
BGC0001264.3	0.46	PKS	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0001124.4	0.46	PKS	pyranonigrin E	Aspergillus niger ATCC 1015

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000046.4	0.76	PKS	depudecin	Alternaria brassicicola
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001268.4	0.60	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0002227.3	0.50	NRPS	AKML B, AKML D, AKML A, AKML C	Aspergillus luchuensis IFO 4308
BGC0002228.3	0.49	NRPS	CIML B, CIML A, CIML D, CIML C	Colletotrichum incanum
BGC0002180.2	0.48	PKS	(+)-asperlin, (2Z,4Z,6E)-octa-2,4,6-trienoic acid	Aspergillus nidulans FGSC A4
BGC0002240.3	0.48	PKS	BAB, BAA	Metarhizium anisopliae
BGC0002211.3	0.47	PKS	HEx-pks1 polyketide	Paraphaeosphaeria sporulosa
BGC0001264.3	0.46	PKS	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0001124.4	0.46	PKS	pyranonigrin E	Aspergillus niger ATCC 1015

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 3, location 636910 - 704221:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_02884: pk

PKS_AT (423..661): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 58.3%; Isobutyryl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 57.2
Methoxymalonyl-CoA: 50.7
Malonyl-CoA: 49.1
fatty_acid: 22.4
Propionyl-CoA: 22.1
CHC-CoA: 17.1
Ethylmalonyl-CoA: 16.1
Benzoyl-CoA: 11.7
trans-1,2-CPDA: 11.3
2-Methylbutyryl-CoA: 9.7
Isobutyryl-CoA: 6.3
inactive: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

NC_030993.1 - Region 4 - T1PKS

Download region SVG

Location: 1,145,868 - 1,213,350 nt. (total: 67,483 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: methyltransferase

FOXG_03052: O-methyltransferase

smcogs: SMCOG1042: O-methyltransferase

Ligases: synthase

FOXG_03051: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

FOXG_03059: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

FOXG_03059_8893cc47: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001268.4	0.59	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.64	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	0.62	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001273.3	0.60	PKS	asperlactone	Aspergillus ochraceus
BGC0000107.3	0.60	PKS	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001275.3	0.60	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001276.3	0.60	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001268.4	0.59	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001160.5	0.58	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 4, location 1145867 - 1213350:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_03051: pk

PKS_AT (550..844): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; Methylmalonyl-CoA: 62.5%; Isobutyryl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 50.0
Methoxymalonyl-CoA: 43.5
Isobutyryl-CoA: 35.5
Propionyl-CoA: 28.3
Benzoyl-CoA: 24.2
Malonyl-CoA: 23.3
fatty_acid: 18.2
trans-1,2-CPDA: 16.4
Ethylmalonyl-CoA: 14.2
CHC-CoA: 10.4
2-Methylbutyryl-CoA: 3.9
inactive: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

NC_030993.1 - Region 5 - T3PKS

Download region SVG

Location: 2,473,962 - 2,535,418 nt. (total: 61,457 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_03445: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: dehydratase

FOXG_03451: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

FOXG_03444: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

FOXG_03444_faeb549b: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Similar gene clusters

Analysis type:

Reference	T3PKS	Similarity score	Type	Compound(s)	Organism
BGC0000161.4		0.30	PKS	isoterrein	Aspergillus terreus NIH2624

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000161.4		0.30	PKS	isoterrein	Aspergillus terreus NIH2624

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NC_030993.1 - Region 6 - NRPS

Download region SVG

Location: 2,656,167 - 2,719,857 nt. (total: 63,691 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_03506: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_03513: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: back translocase

FOXG_03515: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Ligases: ligase

FOXG_03507: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001924.3	0.54	terpene	ascofuranone	Acremonium egyptiacum
BGC0000798.3	0.51	saccharide	dhurrin	Sorghum bicolor
BGC0002320.3	0.51	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0001969.3	0.50	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0001475.4	0.49	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002245.2	0.48	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0000930.4	0.45	terpene	nivalenol, 4-acetylnivalenol	Fusarium graminearum
BGC0001811.3	0.45	terpene	trichodiene-11-one	Fusarium asiaticum
BGC0001679.3	0.44	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001924.3	0.54	terpene	ascofuranone	Acremonium egyptiacum
BGC0000798.3	0.51	saccharide	dhurrin	Sorghum bicolor
BGC0002320.3	0.51	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0001969.3	0.50	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0001475.4	0.49	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002245.2	0.48	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0000930.4	0.45	terpene	nivalenol, 4-acetylnivalenol	Fusarium graminearum
BGC0001811.3	0.45	terpene	trichodiene-11-one	Fusarium asiaticum
BGC0001679.3	0.44	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS substrates

NRPS/PKS substrate predictions

FOXG_03507: X

AMP-binding (75..476): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QDFTHVFAINNRSATIGGTIQVFGMSEGAPIITW
Nearest Stachelhaus code(s):: Ile DFWSTGVILK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

NC_030994.1 - Region 1 - NRPS

Download region SVG

Location: 3,144,521 - 3,227,389 nt. (total: 82,869 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

FOXG_13020: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: glycosyltransferase

FOXG_13017: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Ligases: ligase

FOXG_13024: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

FOXG_13028: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.73	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.68	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000357.5	0.73	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.68	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001166.5	0.66	NRPS	HC-toxin	Alternaria jesenskae
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001758.4	0.62	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 3144520 - 3227389:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - X - D-Leu - Leu - D-X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_13024: X - X - Leu - Leu - X

Search NORINE for peptide: strict or relaxed

AMP-binding (242..634): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SAHAFDVSITETLLVTGGEINCYGPAETSVVSHV
Nearest Stachelhaus code(s):: Pro DVMLVGAVNK (62% 8Å match); Trp DVALVGVVQK (50% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1762..2160): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NYSAFDNSLAESDIALGGERCCYGPSECSVNSTY
Nearest Stachelhaus code(s):: Lys DAQDAGCVEK (41% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2848..3245): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GAHAFDASIMETLLVLGGEMNAYGPSETAVVAAV
Nearest Stachelhaus code(s):: Leu DAMLVGAVCK (53% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4378..4783): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: GAHAFDASVMESLLVTGGEINAYGPSETSVIAAT
Nearest Stachelhaus code(s):: Leu DAMLVGAVCK (56% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5474..5872): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SAFAFDIAIGEAFLICGGEMNGYGPAECTMFAVA
Nearest Stachelhaus code(s):: Leu or Ile DALFIGGTFK (56% 8Å match)
Stachelhaus code match:: 70% (weak)

NC_030995.1 - Region 1 - terpene

Download region SVG

Location: 466,517 - 497,641 nt. (total: 31,125 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

No tailoring functions detected.

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002603.2	0.24	PKS	chevalone E	Aspergillus versicolor
BGC0002615.2	0.22	terpene	4-oxomacrophorin A, macrophorin A, 5'-epimacrophorin B	Penicillium terrestre
BGC0002614.2	0.21	NRPS, PKS	subglutinol A, sesquicillin A, colletotrichin, metarhizin A	Penicillium shearii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002603.2	0.24	PKS	chevalone E	Aspergillus versicolor
BGC0002615.2	0.22	terpene	4-oxomacrophorin A, macrophorin A, 5'-epimacrophorin B	Penicillium terrestre
BGC0002614.2	0.21	NRPS, PKS	subglutinol A, sesquicillin A, colletotrichin, metarhizin A	Penicillium shearii

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

FOXG_13749: TS_Pyr4

Domain 1 (11 - 255): Pyr4 type terpene synthase

Subtype: unknown

Terpene

Glossary

No acronyms to display

NC_030995.1 - Region 2 - terpene

Download region SVG

Location: 2,067,218 - 2,098,199 nt. (total: 30,982 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_11646: 3-hydroxybutyryl-CoA dehydrogenase

smcogs: SMCOG1095: 3-hydroxybutyryl-CoA dehydrogenase

FOXG_11647: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002176.3	0.78	terpene	culmorin, (+)-juniperol(longiborneol), 15-acetyldeoxynivalenol	Fusarium graminearum PH-1
BGC0001616.3	0.52	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0000057.5	0.38	PKS	F9775A, F9775B, orsellinic acid	Aspergillus nidulans FGSC A4
BGC0001858.2	0.38	PKS	alternapyrone B, alternapyrone C, alternapyrone D, alternapyrone E, alternapyrone F	Parastagonospora nodorum SN15
BGC0002155.3	0.37	PKS	nectriapyrone C, nectriapyrone D, nectriapyrone	Pyricularia oryzae 70-15
BGC0002505.3	0.36	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0001606.3	0.36	PKS	gibepyrone-A	Fusarium fujikuroi IMI 58289
BGC0001277.4	0.34	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0001738.3	0.34	NRPS, PKS	phomasetin, wakodecalines A, wakodecalines B	Pyrenochaetopsis sp.
BGC0000194.5	0.34	PKS	actinorhodin	Streptomyces coelicolor A3(2)

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002176.3	0.78	terpene	culmorin, (+)-juniperol(longiborneol), 15-acetyldeoxynivalenol	Fusarium graminearum PH-1
BGC0001616.3	0.52	NRPS, PKS	himeic acid A	Aspergillus japonicus
BGC0000057.5	0.38	PKS	F9775A, F9775B, orsellinic acid	Aspergillus nidulans FGSC A4
BGC0001858.2	0.38	PKS	alternapyrone B, alternapyrone C, alternapyrone D, alternapyrone E, alternapyrone F	Parastagonospora nodorum SN15
BGC0002155.3	0.37	PKS	nectriapyrone C, nectriapyrone D, nectriapyrone	Pyricularia oryzae 70-15
BGC0002505.3	0.36	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0001606.3	0.36	PKS	gibepyrone-A	Fusarium fujikuroi IMI 58289
BGC0001277.4	0.34	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0001738.3	0.34	NRPS, PKS	phomasetin, wakodecalines A, wakodecalines B	Pyrenochaetopsis sp.
BGC0000194.5	0.34	PKS	actinorhodin	Streptomyces coelicolor A3(2)

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Terpene

Glossary

No acronyms to display

NC_030995.1 - Region 3 - NRPS

Download region SVG

Location: 2,551,135 - 2,620,801 nt. (total: 69,667 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FOXG_11840: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_11855: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Ligases: ligase

FOXG_11847: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.80	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.80	NRPS	enniatin	Fusarium equiseti
BGC0000307.4	0.69	NRPS	AbT1	Aureobasidium pullulans
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.66	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001758.4	0.63	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 3, location 2551134 - 2620801:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Hiv - NMe-Phe)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_11847: D-Hiv - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (499..898): D-Hiv

nrpys: D-Hiv

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: CKFGFGACLLETMAVLVGELDGYGQSESSSICFV
Nearest Stachelhaus code(s):: D-Hiv GALMVVGSIK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1573..1977): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSNFFDGATYEFCMMAAGDYNGYGPTENGIMSTR
Nearest Stachelhaus code(s):: Phe DGYCMAGIMK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

NC_030995.1 - Region 4 - indole

Download region SVG

Location: 2,644,063 - 2,675,346 nt. (total: 31,284 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_11876: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: methyltransferase

FOXG_11874: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.39	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002229.2	0.36	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0001659.3	0.36	terpene	mangicol A	Fusarium equiseti
BGC0001277.4	0.35	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0000293.3	0.35	NRPS	acetylaszonalenin	Aspergillus fischeri NRRL 181
BGC0002594.2	0.35	PKS	orcinol, orsellinic acid	Fusarium graminearum PH-1
BGC0002181.3	0.34	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0002180.2	0.33	PKS	(+)-asperlin, (2Z,4Z,6E)-octa-2,4,6-trienoic acid	Aspergillus nidulans FGSC A4
BGC0001278.4	0.33	terpene	T-2 toxin	Fusarium sporotrichioides
BGC0002272.2	0.33	NRPS	asterrelenin, epi-aszonalenin A	Aspergillus terreus NIH2624

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002128.3	0.39	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0002229.2	0.36	PKS	6-MSA, aculin A	Aspergillus aculeatus ATCC 16872
BGC0001659.3	0.36	terpene	mangicol A	Fusarium equiseti
BGC0001277.4	0.35	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0000293.3	0.35	NRPS	acetylaszonalenin	Aspergillus fischeri NRRL 181
BGC0002594.2	0.35	PKS	orcinol, orsellinic acid	Fusarium graminearum PH-1
BGC0002181.3	0.34	terpene	pleuromutilin	Rhodocybe pseudopiperita
BGC0002180.2	0.33	PKS	(+)-asperlin, (2Z,4Z,6E)-octa-2,4,6-trienoic acid	Aspergillus nidulans FGSC A4
BGC0001278.4	0.33	terpene	T-2 toxin	Fusarium sporotrichioides
BGC0002272.2	0.33	NRPS	asterrelenin, epi-aszonalenin A	Aspergillus terreus NIH2624

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

NC_030996.1 - Region 1 - terpene

Download region SVG

Location: 122,388 - 153,652 nt. (total: 31,265 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_16528: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase

FOXG_16522: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Translocases: permease

FOXG_16518: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

FOXG_16518_24e19acb: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

FOXG_16518_341746cf: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

FOXG_16518_50480c52: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

FOXG_16518_7b7d3f47: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

FOXG_16518_c1b63af7: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

FOXG_16518_c340a760: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

FOXG_16518_e9497838: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001481.3	0.89	terpene	α-acorenol	Fusarium fujikuroi IMI 58289
BGC0001181.4	0.75	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001995.3	0.40	terpene	heptelidic acid	Aspergillus oryzae RIB40
BGC0001706.3	0.36	terpene	nodulisporic acid F	Hypoxylon pulicicidum
BGC0000312.4	0.35	NRPS	bassianolide	Beauveria bassiana
BGC0002226.3	0.32	NRPS	acu-dioxomorpholine B, acu-dioxomorpholine A	Aspergillus aculeatus ATCC 16872
BGC0001729.3	0.32	PKS, terpene	paraherquonin	Penicillium brasilianum
BGC0002759.2	0.31	PKS, terpene	brevione E, isobrevione E	Penicillium bialowiezense CBS 227.28
BGC0002603.2	0.31	PKS	chevalone E	Aspergillus versicolor
BGC0002755.2	0.28	NRPS	clovibactin	Eleftheria terrae P9846

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001481.3	0.89	terpene	α-acorenol	Fusarium fujikuroi IMI 58289
BGC0001181.4	0.75	terpene	geosmin	Streptomyces coelicolor A3(2)
BGC0001995.3	0.40	terpene	heptelidic acid	Aspergillus oryzae RIB40
BGC0001706.3	0.36	terpene	nodulisporic acid F	Hypoxylon pulicicidum
BGC0000312.4	0.35	NRPS	bassianolide	Beauveria bassiana
BGC0002226.3	0.32	NRPS	acu-dioxomorpholine B, acu-dioxomorpholine A	Aspergillus aculeatus ATCC 16872
BGC0001729.3	0.32	PKS, terpene	paraherquonin	Penicillium brasilianum
BGC0002759.2	0.31	PKS, terpene	brevione E, isobrevione E	Penicillium bialowiezense CBS 227.28
BGC0002603.2	0.31	PKS	chevalone E	Aspergillus versicolor
BGC0002755.2	0.28	NRPS	clovibactin	Eleftheria terrae P9846

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
monoterpene			C10	C1-C6	none
sesquiterpene			C15	C1-C6	none

Genes with terpene domains:

FOXG_16522: T1TS

Domain 1 (1 - 359): Type 1 terpene synthase

Subtype: Hypoxylon sp. 1,8-cineole synthase type

Reactions:: GPP → monoterpene_C1-C6; FPP → sesquiterpene_C1-C6

Terpene

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GPP	Geranyl diphoshate

NC_030996.1 - Region 2 - terpene

Download region SVG

Location: 938,959 - 972,192 nt. (total: 33,234 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_09726: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: glucosidase

FOXG_09723: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.45	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002216.3	0.43	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001668.4	0.41	NRPS	microperfuranone	Aspergillus nidulans FGSC A4
BGC0002207.2	0.41	other (other)	psilocybin	Psilocybe cyanescens
BGC0002219.2	0.40	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002445.3	0.38	terpene	armillyl orsellinate, 8α-hydroxy-6-protoilludene	Armillaria gallica
BGC0001375.4	0.38	terpene	penitrem A, penitrem B, penitrem C, penitrem D, penitrem E, penitrem F	Penicillium simplicissimum
BGC0001995.3	0.38	terpene	heptelidic acid	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002285.2	0.45	ribosomal	aborycin	Streptomyces sp. ZS0098
BGC0002216.3	0.43	terpene	HEx-tc1 terpene	Trichoderma virens Gv29-8
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0001668.4	0.41	NRPS	microperfuranone	Aspergillus nidulans FGSC A4
BGC0002207.2	0.41	other (other)	psilocybin	Psilocybe cyanescens
BGC0002219.2	0.40	terpene	(-)-(R)-nephthenol	Stereum hirsutum FP-91666 SS1
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0002445.3	0.38	terpene	armillyl orsellinate, 8α-hydroxy-6-protoilludene	Armillaria gallica
BGC0001375.4	0.38	terpene	penitrem A, penitrem B, penitrem C, penitrem D, penitrem E, penitrem F	Penicillium simplicissimum
BGC0001995.3	0.38	terpene	heptelidic acid	Aspergillus oryzae RIB40

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Chain length	Initial cyclisations	Functional groups
sesquiterpene	C15	C1-C6	none
diterpene	C20	C1-C6	none
diterpene	C20	C1-C7 + C6-C10	none
sesterterpene	C25	C1-C7 + C6-C10	none

Genes with terpene domains:

FOXG_20138: TS_UbiA

Domain 1 (40 - 335): UbiA type terpene synthase

Reactions:: FPP → sesquiterpene_C1-C6; GGPP → diterpene_C1-C6; GGPP → diterpene_C1-C7/C6-C10; GFPP → sesterterpene_C1-C7/C6-C10

Terpene

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate

NC_030996.1 - Region 3 - NRPS,isocyanide-nrp

Download region SVG

Location: 1,031,408 - 1,143,780 nt. (total: 112,373 nt) Show pHMM detection rules used

isocyanide-nrp: (DIT1_PvcA and minimum(2, [AMP-binding, PP-binding, Transferase]))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

FOXG_09756: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_09779: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_09779_f07fd483: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_09788: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

FOXG_09788_e1412c2c: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

FOXG_09791: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acetyltransferase

FOXG_09776: Chloramphenicol acetyltransferase

smcogs: SMCOG1156: Chloramphenicol acetyltransferase

Hydrolases: hydrolase

FOXG_09772: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: ligase

FOXG_09770: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_09785: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.46	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001286.3	0.39	other (other)	itaconic acid	Ustilago maydis
BGC0002164.2	0.35	NRPS	peramine	Epichloe festucae
BGC0001969.3	0.35	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0001261.3	0.34	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.32	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.31	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002710.2	0.31	NRPS	metachelin C, metachelin A, metachelin A-CE, metachelin B, dimerumic acid 11-mannoside, dimerumic acid	Metarhizium robertsii ARSEF 23
BGC0000812.3	0.31	other (other)	huperzine A	Shiraia sp. slf14
BGC0000894.4	0.31	other (other)	citrinin	Monascus aurantiacus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001249.5	0.76	NRPS	dimethylcoprogen	Alternaria alternata
BGC0002164.2	0.68	NRPS	peramine	Epichloe festucae
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001240.4	0.65	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0000357.5	0.64	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001166.5	0.63	NRPS	HC-toxin	Alternaria jesenskae
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.63	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 3, location 1031407 - 1143780:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 1031407 - 1112741:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 1077952 - 1143780:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_09770: X

AMP-binding (93..358): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWTFHGAGVMDMSMCASGGLNLTGTTEGLF---I
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

FOXG_09785: X

AMP-binding (223..628): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SARTFDVSVDSCNIGIGGEVVGYGPAECTIGCTV
Nearest Stachelhaus code(s):: Z-ahmohOrn DVDGGGGIGK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

NC_030996.1 - Region 4 - NRPS-like

Download region SVG

Location: 1,552,165 - 1,615,500 nt. (total: 63,336 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

FOXG_09962: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

FOXG_09968: alkyl hydroperoxide reductase subunit

smcogs: SMCOG1176: alkyl hydroperoxide reductase subunit

FOXG_09974: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_09977: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

FOXG_20193: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: sulfotransferase

FOXG_09955: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

Ligases: ligase

FOXG_09966: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000894.4	0.47	other (other)	citrinin	Monascus aurantiacus
BGC0001168.5	0.45	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0001267.3	0.44	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001547.3	0.44	terpene	citreohybridonol	Aspergillus stellatus
BGC0001659.3	0.43	terpene	mangicol A	Fusarium equiseti
BGC0001679.3	0.43	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4
BGC0000811.3	0.42	other (other)	fumigaclavine C	Aspergillus fumigatus Af293
BGC0002734.2	0.42	PKS	2,4-dihydroxy-5,6-dimethyl benzaldehyde	Aspergillus terreus NIH2624
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002610.3	0.49	terpene	stellatic acid	Aspergillus stellatus
BGC0000894.4	0.47	other (other)	citrinin	Monascus aurantiacus
BGC0001168.5	0.45	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0001267.3	0.44	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001547.3	0.44	terpene	citreohybridonol	Aspergillus stellatus
BGC0001659.3	0.43	terpene	mangicol A	Fusarium equiseti
BGC0001679.3	0.43	NRPS	N-Acetyltryptophan	Aspergillus nidulans FGSC A4
BGC0000811.3	0.42	other (other)	fumigaclavine C	Aspergillus fumigatus Af293
BGC0002734.2	0.42	PKS	2,4-dihydroxy-5,6-dimethyl benzaldehyde	Aspergillus terreus NIH2624
BGC0000677.5	0.42	terpene	cyclooctatin	Streptomyces melanosporofaciens

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 6, location 1552164 - 1615500:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_09966: X

AMP-binding (34..345): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ASFTYHGGFPDRSSGVGGALSRMGSAECGFLMSS
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

NC_030997.1 - Region 1 - indole

Download region SVG

Location: 650,601 - 682,016 nt. (total: 31,416 nt) Show pHMM detection rules used

indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FOXG_13324: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_13329: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

FOXG_13323: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001260.3	0.45	terpene	terpendole E	Tolypocladium album
BGC0001267.3	0.44	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001775.3	0.42	terpene	sespendole	Cordana terrestris
BGC0001547.3	0.40	terpene	citreohybridonol	Aspergillus stellatus
BGC0001882.3	0.40	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0001604.3	0.38	terpene	gibberellin	Fusarium fujikuroi
BGC0001082.4	0.37	terpene	Paxilline, 21,22-diprenylated paxilline	Penicillium paxilli
BGC0001136.4	0.36	NRPS, PKS	desmethylbassianin	Beauveria bassiana
BGC0001718.4	0.35	NRPS	okaramine D	Aspergillus aculeatus ATCC 16872
BGC0002062.2	0.35	PKS	agnestin A, agnestin B	Paecilomyces divaricatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001260.3	0.45	terpene	terpendole E	Tolypocladium album
BGC0001267.3	0.44	terpene	elymoclavine, Agroclavine I	Claviceps fusiformis
BGC0001775.3	0.42	terpene	sespendole	Cordana terrestris
BGC0001547.3	0.40	terpene	citreohybridonol	Aspergillus stellatus
BGC0001882.3	0.40	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0001604.3	0.38	terpene	gibberellin	Fusarium fujikuroi
BGC0001082.4	0.37	terpene	Paxilline, 21,22-diprenylated paxilline	Penicillium paxilli
BGC0001136.4	0.36	NRPS, PKS	desmethylbassianin	Beauveria bassiana
BGC0001718.4	0.35	NRPS	okaramine D	Aspergillus aculeatus ATCC 16872
BGC0002062.2	0.35	PKS	agnestin A, agnestin B	Paecilomyces divaricatus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

NC_030997.1 - Region 2 - terpene

Download region SVG

Location: 772,570 - 803,790 nt. (total: 31,221 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: cyclase

FOXG_13372: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

FOXG_13372_35d96487: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.74	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0001277.4	0.33	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0001278.4	0.31	terpene	T-2 toxin	Fusarium sporotrichioides
BGC0001340.3	0.30	PKS	byssochlamic acid, agnestadride A, agnestadride B, Triketide maleidride monomer type A	Byssochlamys fulva
BGC0000168.5	0.23	PKS	viridicatumtoxin	Penicillium aethiopicum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.74	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0001277.4	0.33	terpene	15-acetyldeoxynivalenol, 3-decalonectrin	Fusarium graminearum
BGC0001278.4	0.31	terpene	T-2 toxin	Fusarium sporotrichioides
BGC0001340.3	0.30	PKS	byssochlamic acid, agnestadride A, agnestadride B, Triketide maleidride monomer type A	Byssochlamys fulva
BGC0000168.5	0.23	PKS	viridicatumtoxin	Penicillium aethiopicum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

FOXG_13372: T1TS

Domain 1 (23 - 348): Type 1 terpene synthase

Subtype: unknown

FOXG_13372_35d96487: T1TS

Domain 1 (23 - 341): Type 1 terpene synthase

Subtype: unknown

Terpene

Glossary

No acronyms to display

NC_030997.1 - Region 3 - terpene

Download region SVG

Location: 1,259,685 - 1,291,383 nt. (total: 31,699 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_13568: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

FOXG_13570: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Lyases: cyclase

FOXG_13565: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

FOXG_13565_448a548c: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

FOXG_13565_60f72432: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

FOXG_13565_9683d660: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.94	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0000667.3	0.49	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0002557.2	0.40	terpene	penifulvin A	Penicillium griseofulvum
BGC0001184.4	0.37	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000631.5	0.37	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000818.5	0.33	NRPS	notoamide A	Aspergillus versicolor
BGC0000298.5	0.31	NRPS	aeruginosin 98-A, aeruginosin 98-B, aeruginosin 98-C	Microcystis aeruginosa NIES-98
BGC0001626.3	0.30	PKS	isoindolinone	Stachybotrys chlorohalonata IBT 40285
BGC0000297.5	0.30	NRPS, PKS, saccharide	aeruginoside 126B, aeruginoside 126A	Planktothrix agardhii NIVA-CYA 126

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.94	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0000667.3	0.49	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0000888.5	0.41	other (other)	bacilysin	Bacillus sp. CS93
BGC0002557.2	0.40	terpene	penifulvin A	Penicillium griseofulvum
BGC0001184.4	0.37	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000631.5	0.37	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0000818.5	0.33	NRPS	notoamide A	Aspergillus versicolor
BGC0000298.5	0.31	NRPS	aeruginosin 98-A, aeruginosin 98-B, aeruginosin 98-C	Microcystis aeruginosa NIES-98
BGC0001626.3	0.30	PKS	isoindolinone	Stachybotrys chlorohalonata IBT 40285
BGC0000297.5	0.30	NRPS, PKS, saccharide	aeruginoside 126B, aeruginoside 126A	Planktothrix agardhii NIVA-CYA 126

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

FOXG_13565_60f72432: T1TS

Domain 1 (38 - 258): Type 1 terpene synthase

Subtype: unknown

FOXG_13565_448a548c: T1TS

Domain 1 (38 - 348): Type 1 terpene synthase

Subtype: unknown

FOXG_13565: T1TS

Domain 1 (170 - 390): Type 1 terpene synthase

Subtype: unknown

Terpene

Glossary

No acronyms to display

NC_030997.1 - Region 4 - NRPS,T1PKS

Download region SVG

Location: 1,531,582 - 1,603,073 nt. (total: 71,492 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

FOXG_14588: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_14589: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_14590: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_14591: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_14594: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_14595: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

Transferases: methyltransferase

FOXG_14585: methyltransferase

smcogs: SMCOG1089: methyltransferase

FOXG_14585_8b1b2f7f: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: decarboxylase dehydratase

FOXG_14576: Decarboxylase, pyridoxal-dependent

smcogs: SMCOG1180: Decarboxylase, pyridoxal-dependent

FOXG_14581: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: synthase

FOXG_14587: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002192.3	0.69	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.68	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001254.3	0.67	PKS	ACT-Toxin II	Alternaria alternata
BGC0002191.2	0.65	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001135.5	0.58	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.58	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.55	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.54	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.54	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.54	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002192.3	0.67	PKS	FR901512	fungal sp. No.14919
BGC0001268.4	0.67	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001254.3	0.67	PKS	ACT-Toxin II	Alternaria alternata
BGC0002191.2	0.66	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001135.5	0.63	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002135.2	0.62	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.61	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.61	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.60	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 4, location 1531581 - 1603073:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_14587: pk - Phe

Search NORINE for peptide: strict or relaxed

PKS_AT (548..866): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 81.8
Methoxymalonyl-CoA: 74.5
Isobutyryl-CoA: 53.2
Ethylmalonyl-CoA: 48.3
Benzoyl-CoA: 46.6
Malonyl-CoA: 38.7
trans-1,2-CPDA: 33.1
Propionyl-CoA: 26.2
3-Methylbutyryl-CoA: 17.0
fatty_acid: 14.6
inactive: 13.1
Acetyl-CoA: 13.1
CHC-CoA: 10.3
2-Methylbutyryl-CoA: 7.4

AMP-binding (2820..3220): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: YTKSFDMSLAQMLGTSGGETDCYGPTEISCCATM
Nearest Stachelhaus code(s):: Phe DMALTGCCCK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

NC_030998.1 - Region 1 - T1PKS

Download region SVG

Location: 1 - 60,388 nt. (total: 60,388 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_11893: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Isomerases: isomerase

FOXG_11898: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: synthase

FOXG_11892: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.66	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.65	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.65	PKS	FR901512	fungal sp. No.14919
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001268.4	0.62	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0002191.2	0.66	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001254.3	0.65	PKS	ACT-Toxin II	Alternaria alternata
BGC0002192.3	0.65	PKS	FR901512	fungal sp. No.14919
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001268.4	0.62	NRPS, PKS	fusarin C	Fusarium fujikuroi
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 60388:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_11892: pk

PKS_AT (548..870): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; Methylmalonyl-CoA: 75.0%; Ethylmalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 98.6
Methoxymalonyl-CoA: 75.5
Ethylmalonyl-CoA: 75.2
Malonyl-CoA: 48.1
Isobutyryl-CoA: 47.3
Propionyl-CoA: 37.8
Benzoyl-CoA: 35.1
trans-1,2-CPDA: 30.6
2-Methylbutyryl-CoA: 28.0
3-Methylbutyryl-CoA: 21.4
Acetyl-CoA: 20.6
fatty_acid: 17.3
inactive: 16.0
CHC-CoA: 6.5

NC_030998.1 - Region 2 - NRPS,T1PKS,terpene

Download region SVG

Location: 168,625 - 285,984 nt. (total: 117,360 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxygenase

FOXG_11943: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_11954: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_11963: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

FOXG_11965: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_11969: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_11974: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

Transferases: aminotransferase

FOXG_11951: aminotransferase class V

smcogs: SMCOG1139: aminotransferase class V

Hydrolases: dehalogenase hydrolase

FOXG_11948: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

FOXG_11978: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

FOXG_20634: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: cyclase

FOXG_11949: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

FOXG_11967: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_11970: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001606.3	0.67	PKS	gibepyrone-A	Fusarium fujikuroi IMI 58289
BGC0002191.2	0.61	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002155.3	0.45	PKS	nectriapyrone C, nectriapyrone D, nectriapyrone	Pyricularia oryzae 70-15
BGC0001262.3	0.39	PKS	AK-toxin I	Alternaria alternata
BGC0002162.3	0.38	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0001261.3	0.38	NRPS	AM-toxin	Alternaria alternata
BGC0002172.3	0.37	NRPS	fusatrixin, fusapentaxin, fusaoctaxin A	Fusarium graminearum PH-1
BGC0001825.4	0.36	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.36	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.35	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002191.2	0.84	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001606.3	0.74	PKS	gibepyrone-A	Fusarium fujikuroi IMI 58289
BGC0001261.3	0.70	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.69	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001166.5	0.68	NRPS	HC-toxin	Alternaria jesenskae
BGC0000357.5	0.68	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001240.4	0.68	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001135.5	0.67	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002155.3	0.66	PKS	nectriapyrone C, nectriapyrone D, nectriapyrone	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

FOXG_11949: T1TS

Domain 1 (27 - 376): Type 1 terpene synthase

Subtype: unknown

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

Predicted core structure(s)

For candidate cluster 2, location 168624 - 285984:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk) + (D-X - D-X - X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 173141 - 241541:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk) + (D-X - D-X - X - X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 5, location 208582 - 285984:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-pk) + (D-X - D-X - X - X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_11954: pk

PKS_AT (571..738): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 23.6
Methoxymalonyl-CoA: 19.6
Isobutyryl-CoA: 13.8
Benzoyl-CoA: 12.7
fatty_acid: 9.4
Ethylmalonyl-CoA: 1.3
trans-1,2-CPDA: 0.0
inactive: 0.0
Propionyl-CoA: 0.0
Malonyl-CoA: 0.0
CHC-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

FOXG_11967: X - X - X - X

AMP-binding (577..974): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SSHAFDVTIQETSLILMGELESYAPSECSIYATV
Nearest Stachelhaus code(s):: Ser DVQTVMAIHK (68% 8Å match); bOH-Gln DAQNIASINK (56% 8Å match); Pro DVQSIAHVVK (44% 8Å match); Ala DVANIALIYK (41% 8Å match); Arg DVESIGAIAK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (2103..2504): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SSHAFDVTIQETSLILIGELDAYGPSECSIQSAI
Nearest Stachelhaus code(s):: Arg DVESIGAIAK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (3650..4046): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SSHAFDVTIQETSLILMGELESYAPSECSIYATV
Nearest Stachelhaus code(s):: Ser DVQTVMAIHK (68% 8Å match); bOH-Gln DAQNIASINK (56% 8Å match); Pro DVQSIAHVVK (44% 8Å match); Ala DVANIALIYK (41% 8Å match); Arg DVESIGAIAK (38% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (4743..5147): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: SSQAFDAAIQETSIVLLGELGGYGPTECSIYAIV
Nearest Stachelhaus code(s):: Tyr DAQTIVGIAK (62% 8Å match); Val DASQIGGIYK (56% 8Å match); Lys DAESVGTIIK (53% 8Å match); Aol DIWFVAGIYK (44% 8Å match); Hty DAQSMGAIIK (41% 8Å match)
Stachelhaus code match:: 60% (weak)

FOXG_11970: X

AMP-binding (102..516): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NQALHGYGLVTAYLVLGAALVGYGLTECVSIVTF
Nearest Stachelhaus code(s):: Lin AYVYIGGVFK (59% 8Å match); D-Hiv GALMVVGSIK (32% 8Å match)
Stachelhaus code match:: 60% (weak)

Glossary

No acronyms to display

NC_030998.1 - Region 3 - terpene

Download region SVG

Location: 697,407 - 729,397 nt. (total: 31,991 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

FOXG_12140: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

FOXG_12143: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

FOXG_12149: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000645.3	0.51	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000643.3	0.48	terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.3	0.47	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000648.3	0.45	terpene	carotenoid	Myxococcus xanthus
BGC0000664.5	0.45	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.44	terpene	carotenoid	Streptomyces avermitilis
BGC0000637.3	0.44	terpene	carotenoid	Corynebacterium glutamicum
BGC0000644.3	0.43	terpene	carotenoid	Dietzia sp. CQ4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0000645.3	0.51	terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000656.5	0.50	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000643.3	0.48	terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.3	0.47	terpene	carotenoid	Brevundimonas sp. SD212
BGC0000648.3	0.45	terpene	carotenoid	Myxococcus xanthus
BGC0000664.5	0.45	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000633.3	0.44	terpene	carotenoid	Streptomyces avermitilis
BGC0000637.3	0.44	terpene	carotenoid	Corynebacterium glutamicum
BGC0000644.3	0.43	terpene	carotenoid	Dietzia sp. CQ4

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

FOXG_12144_6734eea7: Lycopene_cycl + Lycopene_cycl + PT_phytoene_like

Domain 1 (16 - 62): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Domain 2 (108 - 198): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Domain 3 (253 - 546): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

FOXG_12144: Lycopene_cycl + Lycopene_cycl + PT_phytoene_like

Domain 1 (3 - 94): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Domain 2 (140 - 230): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Domain 3 (285 - 578): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

Terpene

Glossary

Acronym	Full name
FPP	Farnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
PSPP	Presqualene diphosphate

NC_030998.1 - Region 4 - terpene

Download region SVG

Location: 900,401 - 931,671 nt. (total: 31,271 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_12221: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_12223: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_12228: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Lyases: cyclase

FOXG_12225: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase

FOXG_12222: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.77	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002320.3	0.54	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0002610.3	0.53	terpene	stellatic acid	Aspergillus stellatus
BGC0001924.3	0.53	terpene	ascofuranone	Acremonium egyptiacum
BGC0000631.5	0.52	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0001475.4	0.52	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0001969.3	0.52	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002260.3	0.51	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0002245.2	0.50	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001642.3	0.77	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0001746.3	0.75	terpene	pristinol	Streptomyces pristinaespiralis ATCC 25486
BGC0002320.3	0.54	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0002610.3	0.53	terpene	stellatic acid	Aspergillus stellatus
BGC0001924.3	0.53	terpene	ascofuranone	Acremonium egyptiacum
BGC0000631.5	0.52	terpene	Botrydial, 8,9-epibotrydial, 1-epibotrydial, Dihydrobotrydial, 10-Oxo-dihydrobotrydial, 10-dehydroxy dihydrobotrydialone, 10-epi-dihydrobotrydial, Botryendial, Botryenalol, Botrydienal, Norbotrydialone acetate, 10-Oxodihydrobotry-1(9),4(5)-diendial, 10-Oxodehydrodihydrobotrydial, Dehydrobotrydienol, 11-Hydroxydehydrobotrydienol, 12-hydroxydehydrobotrydienol, Secobotrytriendiol, Secobotrytriene-10,12,15-triol, Secobotrydiene-3,10,15-triol, Secobotrydiene-3,4,10,15-tetraol, 4β-Acetoxytetrahydrobotryslactone	Botrytis cinerea B05.10
BGC0001475.4	0.52	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0001969.3	0.52	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0002260.3	0.51	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum
BGC0002245.2	0.50	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

FOXG_12225: T1TS

Domain 1 (3 - 376): Type 1 terpene synthase

Subtype: unknown

Terpene

Glossary

No acronyms to display

NC_030999.1 - Region 1 - NRPS

Download region SVG

Location: 1,130,200 - 1,194,552 nt. (total: 64,353 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Lyases: decarboxylase

FOXG_17267: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: ligase

FOXG_17272: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002171.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001168.5	0.43	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0002199.2	0.42	other (other)	nanangelenin A	Aspergillus nanangensis
BGC0002555.3	0.42	NRPS, PKS	emerimicin V, emerimicin VI, emerimicin VII, emerimicin VIII, emerimicin IX, emerimicin X	Acremonium sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001240.4	0.64	NRPS	serinocyclin A, serinocyclin B	Metarhizium robertsii
BGC0001833.4	0.63	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000357.5	0.62	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002171.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.45	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001168.5	0.43	NRPS	Livipeptin	Streptomyces lividans 1326
BGC0002199.2	0.42	other (other)	nanangelenin A	Aspergillus nanangensis
BGC0002555.3	0.42	NRPS, PKS	emerimicin V, emerimicin VI, emerimicin VII, emerimicin VIII, emerimicin IX, emerimicin X	Acremonium sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 1130199 - 1194552:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_17272: X

AMP-binding (486..875): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YAAAFDGSILEAHVSVGGEVNTYGPTETTVMVAG
Nearest Stachelhaus code(s):: Dhpg DGLSVGTVMK (62% 8Å match)
Stachelhaus code match:: 80% (moderate)

NC_030999.1 - Region 2 - terpene

Download region SVG

Location: 1,250,052 - 1,282,130 nt. (total: 32,079 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_17452: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_17455: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: methyltransferase sulfotransferase

FOXG_17451: Sulfotransferase domain

extras: Sulfotransfer_4: Sulfotransferase domain

FOXG_17454: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.53	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0002746.3	0.38	ribosomal	dendrothelin A	Dendrothele bispora CBS 962.96
BGC0001882.3	0.37	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000663.5	0.35	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002262.2	0.34	PKS	trienylfuranol A, sporothriolide, dihydrosporothriolide, deoxysporothric acid, dihydroisosporothric acid, sporothric acid, isosporothric acid, sporochartine B	Hypomontagnella monticulosa
BGC0002747.3	0.33	ribosomal	lentinulin A	Lentinula edodes
BGC0001571.3	0.31	terpene	demethoxyviridin	Nodulisporium sp.
BGC0001313.3	0.28	terpene	arabidiol-baruol	Arabidopsis thaliana
BGC0000023.5	0.26	PKS	aurafuron A	Stigmatella aurantiaca DW4/3-1
BGC0000466.5	0.25	NRPS	yatakemycin	Streptomyces sp. TP-A2060

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002173.2	0.53	saccharide, terpene	fumihopaside A, compound 3, 21-β-H-hopane-3beta, 22-diol	Aspergillus fumigatus A1163
BGC0002746.3	0.38	ribosomal	dendrothelin A	Dendrothele bispora CBS 962.96
BGC0001882.3	0.37	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255
BGC0000663.5	0.35	terpene	hopene	Streptomyces coelicolor A3(2)
BGC0002262.2	0.34	PKS	trienylfuranol A, sporothriolide, dihydrosporothriolide, deoxysporothric acid, dihydroisosporothric acid, sporothric acid, isosporothric acid, sporochartine B	Hypomontagnella monticulosa
BGC0002747.3	0.33	ribosomal	lentinulin A	Lentinula edodes
BGC0001571.3	0.31	terpene	demethoxyviridin	Nodulisporium sp.
BGC0001313.3	0.28	terpene	arabidiol-baruol	Arabidopsis thaliana
BGC0000023.5	0.26	PKS	aurafuron A	Stigmatella aurantiaca DW4/3-1
BGC0000466.5	0.25	NRPS	yatakemycin	Streptomyces sp. TP-A2060

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
triterpene	hopanoid		C30	hopanoid skeleton	unknown
triterpene	polypodane		C30	polypodane skeleton	unknown

Genes with terpene domains:

FOXG_17453: T2TS

Domain 1 (9 - 672): Type 2 terpene synthase

Subtype: Squalene substrate

Reactions:: squalene → hopanoid; squalene → polypodane

Terpene

Glossary

No acronyms to display

NW_017264883.1 - Region 1 - NRPS

Download region SVG

Location: 1 - 9,254 nt. (total: 9,254 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Ligases: ligase

FOXG_22940: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0000900.5	0.47	other (other)	ferrichrome	Aspergillus oryzae
BGC0002518.3	0.47	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0002071.2	0.36	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0000349.5	0.34	NRPS	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0001796.5	0.33	NRPS	tauramamide	Brevibacillus laterosporus DSM 25
BGC0002680.2	0.33	NRPS	viobactin	Chromobacterium violaceum ATCC 12472
BGC0001629.3	0.32	NRPS	jessenipeptin	Pseudomonas sp. QS1027
BGC0001631.4	0.32	NRPS, PKS	kasumigamide	Microcystis aeruginosa NIES-87

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.69	NRPS	epichloenin A	Epichloe festucae
BGC0000900.5	0.47	other (other)	ferrichrome	Aspergillus oryzae
BGC0002518.3	0.47	NRPS	syringafactin A, syringafactin C	Pseudomonas sp. SZ57
BGC0002071.2	0.36	NRPS	virginiafactin A, virginiafactin B, virginiafactin C, virginiafactin D	Pseudomonas sp. QS1027
BGC0000349.5	0.34	NRPS	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0001796.5	0.33	NRPS	tauramamide	Brevibacillus laterosporus DSM 25
BGC0002680.2	0.33	NRPS	viobactin	Chromobacterium violaceum ATCC 12472
BGC0001629.3	0.32	NRPS	jessenipeptin	Pseudomonas sp. QS1027
BGC0001631.4	0.32	NRPS, PKS	kasumigamide	Microcystis aeruginosa NIES-87

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 9254:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_22940: X

AMP-binding (424..789): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSLSFDPHIVEFSFLSVGGYALHGQT-GELCFTG
Nearest Stachelhaus code(s):: Hpg DAVHLGLLCK (38% 8Å match)
Stachelhaus code match:: 70% (weak)

NW_017264866.1 - Region 1 - NRPS-like

Download region SVG

Location: 1 - 23,611 nt. (total: 23,611 nt) Show pHMM detection rules used

Region on contig edge.

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_17663: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

FOXG_17664: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Ligases: ligase

FOXG_17660: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001545.3	0.39	NRPS	chrysogine	Fusarium graminearum PH-1
BGC0002505.3	0.38	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0001390.3	0.38	NRPS, PKS	LL-Z1272beta	Stachybotrys bisbyi
BGC0001190.3	0.38	PKS	fusaric acid	Fusarium verticillioides 7600
BGC0002812.2	0.38	PKS, terpene	Colletochlorin A, Colletorin A, Colletochlorin B, Colletochlorin D, Colletorin D, Colletorin D acid, Orsellinic acid, Colletorin B	Colletotrichum higginsianum IMI 349063
BGC0001600.3	0.37	PKS	fusarielin H	Fusarium graminearum
BGC0002734.2	0.34	PKS	2,4-dihydroxy-5,6-dimethyl benzaldehyde	Aspergillus terreus NIH2624
BGC0000022.3	0.34	PKS	asperfuranone	Aspergillus nidulans FGSC A4
BGC0001964.2	0.34	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0002483.2	0.33	PKS	usnic acid	Cladonia uncialis subsp. uncialis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001545.3	0.39	NRPS	chrysogine	Fusarium graminearum PH-1
BGC0002505.3	0.38	NRPS, PKS	xenoacremone A	Xenoacremonium sp. BF-2018a
BGC0001390.3	0.38	NRPS, PKS	LL-Z1272beta	Stachybotrys bisbyi
BGC0001190.3	0.38	PKS	fusaric acid	Fusarium verticillioides 7600
BGC0002812.2	0.38	PKS, terpene	Colletochlorin A, Colletorin A, Colletochlorin B, Colletochlorin D, Colletorin D, Colletorin D acid, Orsellinic acid, Colletorin B	Colletotrichum higginsianum IMI 349063
BGC0001600.3	0.37	PKS	fusarielin H	Fusarium graminearum
BGC0002734.2	0.34	PKS	2,4-dihydroxy-5,6-dimethyl benzaldehyde	Aspergillus terreus NIH2624
BGC0000022.3	0.34	PKS	asperfuranone	Aspergillus nidulans FGSC A4
BGC0001964.2	0.34	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0002483.2	0.33	PKS	usnic acid	Cladonia uncialis subsp. uncialis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Predicted core structure(s)

For candidate cluster 1, location 0 - 23611:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_17660: X

AMP-binding (87..397): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FWAMHAAGSYSALLAFAGGLN------NLIASTE
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

NW_017264851.1 - Region 1 - NRPS,terpene

Download region SVG

Location: 25,990 - 100,330 nt. (total: 74,341 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

FOXG_17420: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

FOXG_17420_d49b070f: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: glycosyltransferase

FOXG_17429: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

Isomerases: racemase

FOXG_17410: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

FOXG_17422: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: permease

FOXG_17413: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002320.3	0.41	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0001969.3	0.40	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0001475.4	0.38	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002245.2	0.36	terpene	terpestacin, preterpestacin 3, preterpestacin 2, preterpestacin 1	Bipolaris maydis C5
BGC0001250.4	0.35	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.35	NRPS	epichloenin A	Epichloe festucae
BGC0001811.3	0.34	terpene	trichodiene-11-one	Fusarium asiaticum
BGC0000930.4	0.33	terpene	nivalenol, 4-acetylnivalenol	Fusarium graminearum
BGC0000687.4	0.31	terpene	phyllocladan-16α-ol	Diaporthe amygdali
BGC0002651.2	0.30	terpene	sordaricin B	Rosellinia necatrix

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001250.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.68	NRPS	epichloenin A	Epichloe festucae
BGC0001641.4	0.61	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.60	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.60	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002320.3	0.53	terpene	conidiogenone	Penicillium rubens Wisconsin 54-1255
BGC0001969.3	0.52	terpene	asperterpenoid A	Talaromyces wortmannii
BGC0001475.4	0.51	terpene	aspterric acid	Aspergillus terreus NIH2624
BGC0002260.3	0.50	terpene	trichobrasilenol, xylarenic acid B, brasilane A, brasilane F, brasilane E, brasilane D	Annulohypoxylon truncatum

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

No product predictions

Genes with terpene domains:

No domains found

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

Predicted core structure(s)

For candidate cluster 1, location 25989 - 100330:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Cys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS substrate predictions

FOXG_17422: X - Cys - X

Search NORINE for peptide: strict or relaxed

AMP-binding (199..630): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: TALAFDISLFEWNIMVGGEYNGYGPTEAAIYCIA
Nearest Stachelhaus code(s):: Ala DIFNNALIYK (47% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1356..1773): Cys

nrpys: Cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: ADLSFDVFVQDYHLTFIGEYNTYGPAENAVVSTM
Nearest Stachelhaus code(s):: Cys DVQHTITVVK (74% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (2499..2929): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAFTFDPHLTQVGSTTGGEFNFYGPTEVTIGCLG
Nearest Stachelhaus code(s):: Val DPLSTGAIGK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

Glossary

No acronyms to display

NW_017264850.1 - Region 1 - betalactone

Download region SVG

Location: 19,048 - 58,628 nt. (total: 39,581 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

FOXG_17350: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

FOXG_17356: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

FOXG_17360: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Hydrolases: hydrolase

FOXG_17362: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Lyases: dehydratase

FOXG_17351: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase synthase

FOXG_17352: 2-isopropylmalate synthase

smcogs: SMCOG1271: 2-isopropylmalate synthase

FOXG_22792: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

FOXG_22793: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002557.2	0.43	terpene	penifulvin A	Penicillium griseofulvum
BGC0001868.4	0.42	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0002561.3	0.41	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0002711.2	0.41	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001262.3	0.41	PKS	AK-toxin I	Alternaria alternata
BGC0000925.5	0.40	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0000815.4	0.40	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001625.5	0.39	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.55	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0002557.2	0.43	terpene	penifulvin A	Penicillium griseofulvum
BGC0001868.4	0.42	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0002561.3	0.41	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0002711.2	0.41	PKS	nostovalerolactone, 9-dehydronostovalerolactone	Nostoc punctiforme PCC 73102
BGC0001262.3	0.41	PKS	AK-toxin I	Alternaria alternata
BGC0000925.5	0.40	other (other)	quinolobactin	Pseudomonas fluorescens
BGC0000815.4	0.40	other (other)	loline, N-acetylnorloline, N-formylloline	Epichloe uncinata
BGC0000678.5	0.40	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001625.5	0.39	PKS	Isofuranonaphthoquinone A, Isofuranonaphthoquinone B, Isofuranonaphthoquinone C, Isofuranonaphthoquinone D, Isofuranonaphthoquinone E, Isofuranonaphthoquinone F	Streptomyces sp. CB01883

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

NW_017264847.1 - Region 1 - terpene