GCF_000018345.1 - 34 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NC_010612.1 (Mycobacterium marinum M)

Region	Type	From	To	Similarity Confidence	Most similar known cluster
Region 1.1	T1PKS,t3nrps-iterative,NRPS,NRPS-like	79,926	149,469	Low	neomediomycin B	PKS+other:other
Region 1.2	terpene	309,581	333,019	Low	xiamycin A	terpene:Sesquiterpene
Region 1.3	NRPS	400,690	450,259
Region 1.4	amglyccycl	671,544	692,746
Region 1.5	T1PKS	824,705	871,949	Low	olimycin A/olimycin B	PKS
Region 1.6	NRPS	992,526	1,058,805
Region 1.7	lanthipeptide-class-ii	1,102,418	1,125,708
Region 1.8	redox-cofactor	1,236,234	1,258,910	Low	berninamycin K/berninamycin J/berninamycin A/berninamycin B	ribosomal:RiPP
Region 1.9	NRPS-like,T1PKS	1,385,360	1,451,313
Region 1.10	NRPS	1,501,763	1,551,236
Region 1.11	cytokinin	1,869,353	1,891,056
Region 1.12	thioamide-NRP,betalactone,t3nrps-iterative,NRPS-like,T1PKS	2,081,794	2,189,891
Region 1.13	NRPS-like	2,263,096	2,306,119
Region 1.14	NRPS-like	2,529,712	2,573,236
Region 1.15	T3PKS	2,616,509	2,657,690	Low	BE-7585A	PKS
Region 1.16	2dos,T1PKS	2,778,950	2,851,823	Low	glycopeptidolipid	NRPS:Type I
Region 1.17	T3PKS,T1PKS,thioamitides,NRPS	2,972,146	3,093,692	High	methylated alkyl-resorcinol/methylated acyl-phloroglucinol	PKS
Region 1.18	terpene-precursor	3,103,519	3,124,505
Region 1.19	NRPS	3,349,477	3,393,943
Region 1.20	NRPS-like,azole-containing-RiPP	3,520,918	3,564,445
Region 1.21	T1PKS	3,629,476	3,682,039
Region 1.22	NRPS,T1PKS,NRPS-like	3,727,926	3,801,318
Region 1.23	NRPS,T3PKS,terpene	3,839,153	3,938,728
Region 1.24	NRPS	3,964,467	4,057,001
Region 1.25	NRPS	4,443,193	4,492,699
Region 1.26	NRP-metallophore,NRPS	4,514,449	4,585,890	High	nocobactin NA/nocobactin NA 10152B	NRPS:Type I+PKS
Region 1.27	NRPS,T1PKS,PKS-like	4,639,984	4,740,494	Low	coelimycin P1	PKS:Type I
Region 1.28	NRPS-like	4,879,821	4,922,922
Region 1.29	T3PKS	5,284,592	5,325,632	High	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone/2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	PKS:Type III
Region 1.30	terpene	5,847,600	5,871,955
Region 1.31	RiPP-like	5,944,063	5,954,869
Region 1.32	terpene-precursor	6,164,030	6,184,962	Low	loseolamycin A1/loseolamycin A2	PKS
Region 1.33	NAPAA	6,361,415	6,395,341	High	ε-Poly-L-lysine	NRPS:Type I
Region 1.34	T1PKS	6,469,976	6,515,333

No secondary metabolite regions were found in these records:: NC_010604.1 (Mycobacterium marinum M)

Compact view

NC_010612.1 - Region 1 - NRPS,NRPS-like,T1PKS,t3nrps-iterative

Download region GenBank file

Download region SVG

Location: 79,926 - 149,469 nt. (total: 69,544 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

MMAR_RS00555: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acylase acyltransferase

MMAR_RS00450: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

MMAR_RS00515: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: dehalogenase hydrolase

MMAR_RS00445: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

MMAR_RS00565: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Ligases: ligase synthase

MMAR_RS00495: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MMAR_RS00500: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MMAR_RS00510: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

MMAR_RS00480: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	1.72	PKS	asperlactone	Aspergillus ochraceus
BGC0002075.3	1.71	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001244.3	1.70	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	1.59	PKS	oronofacic acid	Pseudomonas syringae
BGC0001132.4	1.50	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	1.48	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	1.45	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	1.43	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	1.42	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	1.41	NRPS	enniatin	Fusarium equiseti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.74	PKS	asperlactone	Aspergillus ochraceus
BGC0002075.3	0.74	NRPS	pyreudione A, pyreudione B, pyreudione C, pyreudione D, pyreudione E	Pseudomonas fluorescens
BGC0001244.3	0.74	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0000041.3	0.72	PKS	oronofacic acid	Pseudomonas syringae
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.69	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 17.75 out of 18.57

Confidence: strong

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 23.03 out of 26.33

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.58 out of 20.97

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.32 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.26 out of 26.85

Confidence: medium

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 22.78 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

Additional weak hits (9):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.12 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.25 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.17 out of 29.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.99 out of 27.55

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.45 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.60 out of 28.19

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 35.63

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.73 out of 25.88

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.03 out of 29.65

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 1, location 79925 - 149469:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (Thr - D-Thr - X) + (X - ccmal) + (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS00495: mal

PKS_AT (571..847): mal

ATSignature: (unknown)

No matches above 50%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 56.3
Methoxymalonyl-CoA: 21.6
Methylmalonyl-CoA: 11.9
inactive: 11.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

MMAR_RS00500: Thr - Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (481..886): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSVHFDYSVWEGSQVFGGEINMYGITETTVHASF
Nearest Stachelhaus code(s):: Thr DYWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1548..1953): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LSVHFDYSVWEGSQVFGGEINMYGITETTVHASF
Nearest Stachelhaus code(s):: Thr DYWSVGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3067..3457): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSVHFDLSVFEGAQVVGGEVNQYGPSETTMYVSM
Nearest Stachelhaus code(s):: Trp DALAVGQVVK (47% 8Å match)
Stachelhaus code match:: 60% (weak)

MMAR_RS00510: X - mal

AMP-binding (23..392): X

nrpys: Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAMAFAYGLGSFYGVSAGELDGIGSTEVGQTFIS
Nearest Stachelhaus code(s):: pNH2-Bz AYNFIAGSTK (59% 8Å match)
Stachelhaus code match:: 60% (weak)

PKS_AT (1164..1452): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 190.2
inactive: 108.4
Methoxymalonyl-CoA: 62.2
Methylmalonyl-CoA: 50.6
Propionyl-CoA: 34.0
fatty_acid: 30.0
Isobutyryl-CoA: 28.0
Acetyl-CoA: 25.9
Benzoyl-CoA: 22.9
2-Methylbutyryl-CoA: 20.3
Ethylmalonyl-CoA: 16.0
CHC-CoA: 14.3
trans-1,2-CPDA: 13.6
3-Methylbutyryl-CoA: 0.0

MMAR_RS00515: pk

PKS_AT (563..848): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 210.5
Methylmalonyl-CoA: 209.5
Methoxymalonyl-CoA: 175.1
2-Methylbutyryl-CoA: 142.3
trans-1,2-CPDA: 129.2
Propionyl-CoA: 124.4
Malonyl-CoA: 113.8
CHC-CoA: 98.0
Isobutyryl-CoA: 80.0
Benzoyl-CoA: 66.5
3-Methylbutyryl-CoA: 56.1
Acetyl-CoA: 49.6
inactive: 42.2
fatty_acid: 31.3

MMAR_RS00525: X

AMP-binding (111..279): X

nrpys: Asp, Asn, Glu, Gln, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Aliphatic chain with H-bond donor (Asp, Asn, Glu, Gln, Aad)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LADA--ARRRSLEGITAGEQNRYASAE------F
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
ToxT	Regulator of MSHA biosynthesis

NC_010612.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 309,581 - 333,019 nt. (total: 23,439 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

MMAR_RS01340: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MMAR_RS01375: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

MMAR_RS01390: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Hydrolases: hydrolase

MMAR_RS01405: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Lyases: cyclase

MMAR_RS01370: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: synthase synthetase

MMAR_RS01350: 1-deoxy-D-xylulose-5-phosphate synthase

smcogs: SMCOG1110: 1-deoxy-D-xylulose-5-phosphate synthase

MMAR_RS01380: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002391.2	0.57	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002162.3	0.56	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.54	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002283.2	0.53	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.53	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000677.5	0.53	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002644.2	0.50	other (other), terpene	domoic acid, isodomoic acid A, isodomoic acid B, prekainic acid, 7'-carboxyN-geranyl-L-glutamic acid, isodomoic acid C	Chondria armata

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000660.5	0.58	terpene	albaflavenone	Streptomyces coelicolor A3(2)
BGC0002391.2	0.57	terpene	zealexin B3, zealexin C2	Zea mays
BGC0002162.3	0.56	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002043.3	0.54	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000675.5	0.54	terpene	(+)-T-muurolol	Streptomyces clavuligerus ATCC 27064
BGC0002283.2	0.53	terpene	sodorifen	Serratia plymuthica
BGC0001361.3	0.53	terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0002631.2	0.53	ribosomal	Myxarylin	Pyxidicoccus fallax
BGC0000677.5	0.53	terpene	cyclooctatin	Streptomyces melanosporofaciens
BGC0002644.2	0.50	other (other), terpene	domoic acid, isodomoic acid A, isodomoic acid B, prekainic acid, 7'-carboxyN-geranyl-L-glutamic acid, isodomoic acid C	Chondria armata

Similar known clusters from MIBiG 4.0

Similar subclusters

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

MMAR_RS01370: T1TS

Domain 1 (9 - 323): Type 1 terpene synthase

Subtype: unknown

MMAR_RS01380: PT_FPPS_like

Domain 1 (57 - 326): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 25.57 out of 29.38

Confidence: medium

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 23.70 out of 29.38

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.88 out of 20.97

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 24.93 out of 28.19

Confidence: strong

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 27.11 out of 28.19

Confidence: strong

Additional weak hits (5):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.89 out of 28.14

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.52 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.47 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.57 out of 29.38

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.81 out of 28.19

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
CcpA	Catabolite control protein A
FuR variant 1	Ferric Uptake Regulator
ZuR variant 1	Zinc-responsive repressor

NC_010612.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 400,690 - 450,259 nt. (total: 49,570 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MMAR_RS01770: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

MMAR_RS01775: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MMAR_RS01780: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

MMAR_RS01815: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MMAR_RS01845: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: esterase

MMAR_RS01810: thioesterase

smcogs: SMCOG1004: thioesterase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001132.4	0.69	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.68	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.68	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001758.4	0.66	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

Additional weak hits (4):

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.11 out of 27.55

Confidence: weak

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.96 out of 23.43

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.81 out of 32.74

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.65 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 3, location 400689 - 450259:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS01815: X - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (514..906): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWRAFDIFLWEGQIFCGGEVNLYGPTETAIDALY
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (68% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2012..2415): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGSQIFGGEINMYGITETTVHVTF
Nearest Stachelhaus code(s):: Thr DFWSIGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NC_010612.1 - Region 4 - amglyccycl

Download region GenBank file

Download region SVG

Location: 671,544 - 692,746 nt. (total: 21,203 nt) Show pHMM detection rules used

amglyccycl: (DOIS or ValA or salQ or strH or strK1 or strK2 or NeoL or SpcFG or SpcDK_glyc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MMAR_RS02850: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MMAR_RS02865: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

MMAR_RS02895: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

MMAR_RS02875: methyltransferase

smcogs: SMCOG1089: methyltransferase

Hydrolases: hydrolase

MMAR_RS02855: HAD-superfamily hydrolase, subfamily IA, variant

smcogs: SMCOG1115: HAD-superfamily hydrolase, subfamily IA, variant

Ligases: synthase

MMAR_RS02845: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.51	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000723.5	0.43	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0001868.4	0.42	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002496.3	0.42	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0000219.4	0.41	PKS, saccharide	elloramycin	Streptomyces olivaceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000701.5	0.51	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0000888.5	0.49	other (other)	bacilysin	Bacillus sp. CS93
BGC0001928.2	0.46	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001184.4	0.44	other (other)	bacilysin	Bacillus velezensis FZB42
BGC0000723.5	0.43	other (cyclitol), saccharide	validamycin A	Streptomyces hygroscopicus subsp. limoneus
BGC0001868.4	0.42	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001197.5	0.42	PKS	frankiamicin	Frankia sp. EAN1pec
BGC0002496.3	0.42	NRPS	serratiochelin A, serratiochelin C, serratiochelin B	Serratia plymuthica
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0000219.4	0.41	PKS, saccharide	elloramycin	Streptomyces olivaceus

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.98 out of 26.85

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.18 out of 20.47

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.63 out of 27.55

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.47 out of 24.78

Confidence: medium

Additional weak hits (4):

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.91 out of 25.88

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.45 out of 32.74

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.26 out of 28.19

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
LexA variant 2	Repressor of DNA damage response
MexT	Global virulence regulator
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 5 - T1PKS

Download region GenBank file

Download region SVG

Location: 824,705 - 871,949 nt. (total: 47,245 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MMAR_RS03435: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MMAR_RS03440: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MMAR_RS03465: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MMAR_RS03495: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MMAR_RS03540: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

Transferases: methyltransferase phosphorylase

MMAR_RS03420: methyltransferase

smcogs: SMCOG1248: methyltransferase

MMAR_RS03535: thiamine-phosphate pyrophosphorylase

smcogs: SMCOG1280: thiamine-phosphate pyrophosphorylase

Hydrolases: hydrolase

MMAR_RS03430: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

MMAR_RS03490: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: ligase synthase

MMAR_RS03480: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS03485: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Translocases: transport

MMAR_RS03470: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.64	PKS	asperlactone	Aspergillus ochraceus
BGC0001276.3	0.64	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.64	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.64	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15
BGC0001257.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001258.3	0.63	PKS	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0001284.4	0.62	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001254.3	0.62	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.07 out of 20.47

Confidence: medium

Additional weak hits (6):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.27 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.20 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.93 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 22.23 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 21.10 out of 30.25

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 5, location 824704 - 871949:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal - mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS03480: NH2

CAL_domain (217..489): NH2

minowa: NH2

Prediction, score:

NH2: 44.2
fatty_acid: 29.4
Acetyl-CoA: 28.4
shikimic_acid: 0.0
AHBA: 0.0

MMAR_RS03485: mal - mal

PKS_AT (631..921): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.3
inactive: 94.5
Methoxymalonyl-CoA: 59.5
Methylmalonyl-CoA: 48.7
Propionyl-CoA: 44.0
Ethylmalonyl-CoA: 26.5
2-Methylbutyryl-CoA: 21.1
CHC-CoA: 19.9
Isobutyryl-CoA: 15.2
Acetyl-CoA: 11.5
trans-1,2-CPDA: 9.5
fatty_acid: 7.6
Benzoyl-CoA: 5.6
3-Methylbutyryl-CoA: 0.0

PKS_AT (1643..1933): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 182.3
inactive: 94.5
Methoxymalonyl-CoA: 59.5
Methylmalonyl-CoA: 48.7
Propionyl-CoA: 44.0
Ethylmalonyl-CoA: 26.5
2-Methylbutyryl-CoA: 21.1
CHC-CoA: 19.9
Isobutyryl-CoA: 15.2
Acetyl-CoA: 11.5
trans-1,2-CPDA: 9.5
fatty_acid: 7.6
Benzoyl-CoA: 5.6
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 6 - NRPS

Download region GenBank file

Download region SVG

Location: 992,526 - 1,058,805 nt. (total: 66,280 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

MMAR_RS04130: aldehyde oxidase and xanthine dehydrogenase

smcogs: SMCOG1293: aldehyde oxidase and xanthine dehydrogenase

MMAR_RS04195: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

Transferases: acyltransferase methyltransferase

MMAR_RS04205: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

MMAR_RS04215: acyltransferase 3

smcogs: SMCOG1088: acyltransferase 3

MMAR_RS30130: methyltransferase

smcogs: SMCOG1248: methyltransferase

MMAR_RS30135: methyltransferase

smcogs: SMCOG1089: methyltransferase

Isomerases: racemase

MMAR_RS04250: mandelate racemase/muconate lactonizing enzyme

smcogs: SMCOG1268: mandelate racemase/muconate lactonizing enzyme

Ligases: ligase

MMAR_RS04190: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Translocases: permease transport

MMAR_RS04150: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

MMAR_RS04240: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.70	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.72	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001135.5	0.72	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.70	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.81 out of 18.57

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (14):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 18.73 out of 23.43

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.23 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.23 out of 28.14

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.60 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.54 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.70 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.43 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 17.98 out of 31.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.68 out of 26.06

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.71 out of 29.38

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.62 out of 27.78

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.75 out of 30.22

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.37 out of 26.06

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.41 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 6, location 992525 - 1058805:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Leu - Ala - Ser - Phe - X - X - Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS04190: X - Leu - Ala - Ser - Phe - X - X - Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (468..855): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDLHFDVAVLEGNHILIGEINAYGPTEATIYLTA
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1534..1926): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: WSLHFDYSVWEGSQLTGGELNAYGPTETTVAATI
Nearest Stachelhaus code(s):: Leu DAWILGAVAK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (2605..2992): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: ala (Ala)

Stachelhaus prediction details:

Stachelhaus sequence:: LDLHFDVSVWEGSHIVAGEINAYGPTETTIYATT
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (82% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3671..4072): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTLHFDVSVCEGSHILAGEINMYGTTETTVHATL
Nearest Stachelhaus code(s):: Ser DVWSIAMVHK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4748..5135): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LQLHFDVSVWEGTHITVGEINAYGPSETTMCTTI
Nearest Stachelhaus code(s):: Phe DVWTAVAMCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (5814..6202): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDLHFDVAVLEGNHILIGEINAYGPTEATIYLTA
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (6880..7271): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FSLHFDVSVWEAYLLVGAELNSYGPTETTITATV
Nearest Stachelhaus code(s):: Gln DVALLGSITK (50% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (7950..8336): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LQLHFDVSVWEGTHITVGEINAYGPSETTMCTTI
Nearest Stachelhaus code(s):: Phe DVWTAVAMCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 7 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1,102,418 - 1,125,708 nt. (total: 23,291 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Lanthipeptides

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MMAR_RS04545: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acetyltransferase

MMAR_RS04515: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

Lyases: cyclase

MMAR_RS04510: lanthionine synthetase C family protein

smcogs: SMCOG1070: lanthionine synthetase C family protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002699.2	0.41	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002128.3	0.41	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000548.4	0.41	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000517.4	0.41	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.40	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002561.3	0.40	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0002110.3	0.39	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0002330.2	0.38	ribosomal	landornamide A	Kamptonema sp. PCC 6506

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.4	0.48	ribosomal	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0002698.2	0.43	ribosomal	phaeornamide	Pseudophaeobacter arcticus DSM 23566
BGC0002699.2	0.41	ribosomal	nostolysamide A, nostolysamide B	Nostoc punctiforme PCC 73102
BGC0002128.3	0.41	other (other)	5-dimethylallylindole-3-acetonitrile	Streptomyces coelicolor A3(2)
BGC0000548.4	0.41	ribosomal	salivaricin A	Streptococcus salivarius
BGC0000517.4	0.41	ribosomal	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.5	0.40	ribosomal	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0002561.3	0.40	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0002110.3	0.39	ribosomal	birimositide	Streptomyces rimosus subsp. rimosus WC-3908
BGC0002330.2	0.38	ribosomal	landornamide A	Kamptonema sp. PCC 6506

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Lanthipeptide predictions

Lanthipeptide(s) for MMAR_RS04510

MMAR_RS29665

Leader:

MMTTLAMELPAVDSILDCRLTDDMIEAA

Core:

AGMNGLGPCVDQALTAPCLGFARLS

Core with dehydrations:

AGMNGLGPCysVDQALDhbAPCysLGFARLDha

antiSMASH-DB 4.0 matches for MMAR_RS29665

100.0%

NC_010612.1and 4 others:

NC_020133.1 Lanthipeptides: MULP_RS31530_lanthipeptideNZ_AP017635.1 Lanthipeptides: CPZ18_RS26105_lanthipeptideNZ_AP018410.1 Lanthipeptides: MPSD_RS28020_lanthipeptideNZ_CP058277.1 Lanthipeptides: HXW97_RS10835_lanthipeptide

Lanthipeptides: MMAR_RS29665_lanthipeptide

1

AGMNGLGPCVDQALTAPCLGFARLS

25

AGMNGLGPCVDQALTAPCLGFARLS

1

AGMNGLGPCVDQALTAPCLGFARLS

25

96.0%

NZ_CP024190.1:

Lanthipeptides: CCUG20998_RS27770_lanthipeptide

1

AGMNGLGPCVDQALTAPCLGFARLS

25

AGMNGLGPCVDQALTAPCLGF RLS

1

AGMNGLGPCVDQALTAPCLGFERLS

25

96.0%

NZ_CP118910.1:

Lanthipeptides: PQR73_RS04430_lanthipeptide

1

AGMNGLGPCVDQALTAPCLGFARLS

25

AGM+GLGPCVDQALTAPCLGFARLS

1

AGMSGLGPCVDQALTAPCLGFARLS

25

with 2 more sequence matches

28.0%

NZ_AP018365.1:

Lanthipeptides: RVR_RS00130_lanthipeptide

3

MNGLGPCVDQALTAPCLGF

21

G C D + A C GF

6

WEGTFSCCDTTICAGCTGF

24

24.0%

NZ_AP018268.1:

Lanthipeptides: CDC39_RS06785_lanthipeptide

14

LTAPCLGFARL

24

T PCLG++ L

8

FTKPCLGWSFL

18

allorf_1107619_1107744

Leader:

MGFLHSWQAG

Core:

APGDLCLVCAPHVRLTPVWPLAYCRYDSSAN

Core with dehydrations:

APGDLCysLVCysAPHVRLDhbPVWPLAYCysRYDDhaDhaAN

antiSMASH-DB 4.0 matches for allorf_1107619_1107744

100.0%

NC_010612.1:

Lanthipeptides: allorf_1107619_1107744_lanthipeptide

1

APGDLCLVCAPHVRLTPVWPLAYCRYDSSAN

31

APGDLCLVCAPHVRLTPVWPLAYCRYDSSAN

1

APGDLCLVCAPHVRLTPVWPLAYCRYDSSAN

31

96.8%

NZ_AP017635.1and 1 other:

NZ_CP118910.1 Lanthipeptides: allorf_1068650_1068814_lanthipeptide

Lanthipeptides: allorf_1001780_1001905_lanthipeptide

1

APGDLCLVCAPHVRLTPVWPLAYCRYDSSAN

31

APGDL LVCAPHVRLTPVWPLAYCRYDSSAN

1

APGDLRLVCAPHVRLTPVWPLAYCRYDSSAN

31

93.5%

NC_020133.1and 1 other:

NZ_AP018410.1 Lanthipeptides: allorf_1141919_1142044_lanthipeptide

Lanthipeptides: allorf_1033871_1033996_lanthipeptide

1

APGDLCLVCAPHVRLTPVWPLAYCRYDSSAN

31

APGDL LVCAPHVRLTPVWPL YCRYDSSAN

1

APGDLRLVCAPHVRLTPVWPLVYCRYDSSAN

31

with 6 more sequence matches

93.5%

NZ_CP058277.1:

Lanthipeptides: allorf_2524636_2524761_lanthipeptide

1

APGDLCLVCAPHVRLTPVWPLAYCRYDSSAN

31

A GDL LVCAPHVRLTPVWPLAYCRYDSSAN

1

ALGDLRLVCAPHVRLTPVWPLAYCRYDSSAN

31

25.8%

NZ_CP046058.1:

Lanthipeptides: allorf_1372448_1372534_lanthipeptide

4

DLCLVCAPHVRLTP

17

DLC++C VR TP

2

DLCVLCVFVVRSTP

15

20.5%

NC_017765.1and 1 other:

NZ_KQ948355.1 Lanthipeptides: allorf_092288_092467_lanthipeptide

Lanthipeptides: allorf_01998108_01998287_lanthipeptide

10

APHVRLTPVWP--LAYCRY

26

PH L+P++P LA CR

1

GPHGELSPIFPDALARCRR

19

16.1%

NZ_CP020040.1:

Lanthipeptides: allorf_278451_278618_lanthipeptide

7

LVCAPHVRLTPVW

19

+VC+ +RL +W

4

VVCSRLIRLGGIW

16

15.9%

NZ_JAMTCO010000021.1:

Lanthipeptides: allorf_065918_066073_lanthipeptide

9

CAPHVRLTPVWPLAYCRYDSSA

30

C HVR P W + A

4

CGGHVRRGPKWNMTAIHQRRGA

25

13.6%

NZ_CP053189.1:

Lanthipeptides: allorf_0142305_0142484_lanthipeptide

10

APHVRLTPVWPLAYC

24

PH L+P++P C

1

GPHGELSPIFPGGPC

15

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.11 out of 29.72

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.86 out of 26.85

Confidence: medium

Additional weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.61 out of 30.22

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.64 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.27 out of 30.25

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.47 out of 30.97

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.26 out of 18.57

Confidence: weak

Lanthipeptides

TFBS Finder

Core peptide predictions

MMAR_RS29665 - Class II: Cleavage pHMM score: -2.50; RODEO score: 0; Monoisotopic mass: 2425.2 Da; Molecular weight: 2426.8 Da; Number of bridges: 2
allorf_1107619_1107744 - Class II: Cleavage pHMM score: -4.70; RODEO score: 0; Monoisotopic mass: 3332.6 Da; Molecular weight: 3334.8 Da; Number of bridges: 3

TFBS definitions

Regulator	Description
NtrC	Nitrogen regulatory protein C
RutR	Regulator of the pyrimidine and purine metabolism

NC_010612.1 - Region 8 - redox-cofactor

Download region GenBank file

Download region SVG

Location: 1,236,234 - 1,258,910 nt. (total: 22,677 nt) Show pHMM detection rules used

redox-cofactor: (cds(PF04055 and (TIGR04085 or SPASM)) and (TIGR02111 or TIGR03966) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MMAR_RS05010: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MMAR_RS05015: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Hydrolases: back translocase

MMAR_RS04995: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

MMAR_RS05000: GTP-binding protein LepA

smcogs: SMCOG1190: GTP-binding protein LepA

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002363.3	0.47	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0000894.4	0.46	other (other)	citrinin	Monascus aurantiacus
BGC0000615.4	0.45	ribosomal	TP-1161	Nocardiopsis sp. TFS65-07
BGC0000906.3	0.43	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.43	other (other)	heme D1	Heliobacillus mobilis
BGC0000610.5	0.43	ribosomal	nosiheptide	Streptomyces actuosus
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001775.3	0.39	terpene	sespendole	Cordana terrestris
BGC0000706.3	0.39	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000880.4	0.38	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002363.3	0.47	ribosomal	berninamycin K, berninamycin J, berninamycin A, berninamycin B	Streptomyces sp.
BGC0000894.4	0.46	other (other)	citrinin	Monascus aurantiacus
BGC0000615.4	0.45	ribosomal	TP-1161	Nocardiopsis sp. TFS65-07
BGC0000906.3	0.43	other (other)	heme D1	Heliophilum fasciatum
BGC0000905.5	0.43	other (other)	heme D1	Heliobacillus mobilis
BGC0000610.5	0.43	ribosomal	nosiheptide	Streptomyces actuosus
BGC0001928.2	0.40	other (other)	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001775.3	0.39	terpene	sespendole	Cordana terrestris
BGC0000706.3	0.39	saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000880.4	0.38	other (nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 17.89 out of 18.16

Confidence: strong

Additional weak hits (8):

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.37 out of 18.57

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.65 out of 21.55

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.81 out of 31.73

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.27 out of 29.65

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 23.44 out of 30.12

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.91 out of 33.14

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.41 out of 27.04

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.27 out of 28.19

Confidence: weak

RREFinder

TFBS Finder

RRE predictions

: RRE type: Mycofactocin_RRE; Location: 22 - 102; Score: 102.0

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator

NC_010612.1 - Region 9 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1,385,360 - 1,451,313 nt. (total: 65,954 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase oxidoreductase

MMAR_RS05800: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

MMAR_RS05815: NADH:flavin oxidoreductase/NADH oxidase

smcogs: SMCOG1217: NADH:flavin oxidoreductase/NADH oxidase

MMAR_RS05835: FAD linked oxidase domain protein

smcogs: SMCOG1138: FAD linked oxidase domain protein

Transferases: acylase methyltransferase sulfhydrylase

MMAR_RS05760: methyltransferase

smcogs: SMCOG1248: methyltransferase

MMAR_RS05840: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MMAR_RS05855: methyltransferase

smcogs: SMCOG1089: methyltransferase

MMAR_RS05865: O-succinylhomoserine sulfhydrylase

smcogs: SMCOG1168: O-succinylhomoserine sulfhydrylase

Hydrolases: hydrolase

MMAR_RS05875: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: mutase

MMAR_RS05710: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

MMAR_RS05790: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS05795: 8-amino-7-oxononanoate synthase

smcogs: SMCOG1109: 8-amino-7-oxononanoate synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	1.04	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.03	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001135.5	0.90	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002274.2	0.85	NRPS	aspulvinone H, aspulvinone B1	Aspergillus terreus NIH2624
BGC0001641.4	0.84	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.83	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001254.3	0.60	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.59	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.59	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002191.2	0.58	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.71	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.71	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.63	PKS	ACT-Toxin II	Alternaria alternata
BGC0001276.3	0.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001244.3	0.63	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001641.4	0.63	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.63	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.29 out of 24.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (20):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.55 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.41 out of 21.55

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.41 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.63 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.61 out of 21.55

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.21 out of 32.93

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.63 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.54 out of 21.55

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.43 out of 39.62

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.09 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.93 out of 27.78

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.27 out of 25.75

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.55 out of 30.25

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.63 out of 29.65

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.92 out of 20.01

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 21.77 out of 32.38

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.23 out of 30.98

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.31 out of 33.14

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 9, location 1385359 - 1451313:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (NH2 - Me-redmal) + (NH2)
Non-colinear ordering:: MMAR_RS05840 + MMAR_RS05790

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 10, location 1385359 - 1427351:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (NH2 - Me-redmal) + (NH2)
Non-colinear ordering:: MMAR_RS05840 + MMAR_RS05790

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 11, location 1401533 - 1451313:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (NH2 - Me-redmal) + (NH2)
Non-colinear ordering:: MMAR_RS05840 + MMAR_RS05790

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS05790: NH2

CAL_domain (41..484): NH2

minowa: NH2

Prediction, score:

NH2: 140.3
Acetyl-CoA: 70.5
AHBA: 9.5
shikimic_acid: 5.0
fatty_acid: 3.8

MMAR_RS05840: NH2 - mmal

CAL_domain (39..481): NH2

minowa: NH2

Prediction, score:

NH2: 105.4
Acetyl-CoA: 31.9
AHBA: 12.7
shikimic_acid: 8.2
fatty_acid: 1.5

PKS_AT (1251..1554): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 95.8%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 182.0
Ethylmalonyl-CoA: 163.5
Methoxymalonyl-CoA: 151.2
2-Methylbutyryl-CoA: 124.0
Malonyl-CoA: 102.1
trans-1,2-CPDA: 96.1
CHC-CoA: 83.9
Propionyl-CoA: 83.3
Isobutyryl-CoA: 51.2
inactive: 37.4
Benzoyl-CoA: 31.4
3-Methylbutyryl-CoA: 24.0
fatty_acid: 20.9
Acetyl-CoA: 16.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
LexA variant 2	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 10 - NRPS

Download region GenBank file

Download region SVG

Location: 1,501,763 - 1,551,236 nt. (total: 49,474 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MMAR_RS06145: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

MMAR_RS06190: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MMAR_RS06250: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: aminotransferase carboxylase transferase

MMAR_RS06160: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

MMAR_RS06195: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

MMAR_RS06220: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

Lyases: dehydratase

MMAR_RS06275: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.66	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.06 out of 20.01

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.72 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 19.26

Confidence: medium

Additional weak hits (12):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.47 out of 29.25

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.25 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.79 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.80 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.13 out of 21.55

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 19.73 out of 27.04

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.89 out of 32.93

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.33 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.78 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.86 out of 26.06

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 12, location 1501762 - 1551236:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS06190: X - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (509..902): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWRAFDIFMWEGQIFCGGEVNLYGPTETTIDATF
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (71% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2016..2417): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEINMYGITETTVHVTF
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CRP	Cyclic AMP receptor protein
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 11 - cytokinin

Download region GenBank file

Download region SVG

Location: 1,869,353 - 1,891,056 nt. (total: 21,704 nt) Show pHMM detection rules used

cytokinin: (IPPT and Lysine_decarbox)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

MMAR_RS07685: acyl-CoA dehydrogenase type 2

smcogs: SMCOG1191: acyl-CoA dehydrogenase type 2

MMAR_RS07690: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MMAR_RS07695: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

MMAR_RS07725: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MMAR_RS07745: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

MMAR_RS07730: methyltransferase

smcogs: SMCOG1089: methyltransferase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002163.3	0.58	other (other)	fusatin, fusatinic acid, 8-oxo-fusatin, 8-oxo-isopentenyladenine	Fusarium pseudograminearum CS3096
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.46	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.46	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000844.5	0.45	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0002482.2	0.42	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0002347.3	0.42	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0002103.2	0.42	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001302.5	0.42	other (other)	lomofungin	Streptomyces lomondensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002163.3	0.58	other (other)	fusatin, fusatinic acid, 8-oxo-fusatin, 8-oxo-isopentenyladenine	Fusarium pseudograminearum CS3096
BGC0000902.4	0.46	PKS	flaviolin	Saccharopolyspora erythraea NRRL 2338
BGC0000658.3	0.46	terpene	2-methylisoborneol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000659.3	0.46	terpene	2-methylisoborneol	Saccharopolyspora erythraea NRRL 2338
BGC0000844.5	0.45	other (other)	clavulanic acid	Streptomyces clavuligerus
BGC0001223.5	0.43	other (other)	hydroxysporine	uncultured bacterium
BGC0002482.2	0.42	other (other)	tjipanazole D, tjipanazole I, tjipanazole L, tjipanazole K, tjipanazole M	Symphyonema bifilamentata 97.28
BGC0002347.3	0.42	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0002103.2	0.42	other (other)	pulcherriminic acid	Bacillus subtilis subsp. subtilis str. 168
BGC0001302.5	0.42	other (other)	lomofungin	Streptomyces lomondensis

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 21.70 out of 27.55

Confidence: medium

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

Additional weak hits (13):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.90 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 22.14 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.55 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.38 out of 26.85

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.53 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.71 out of 33.73

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 23.88 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 24.65 out of 39.62

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.55 out of 26.85

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes
HypR	L-hydroxyproline utilization repressor
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 12 - NRPS-like,T1PKS,betalactone,t3nrps-iterative,thioamide-NRP

Download region GenBank file

Download region SVG

Location: 2,081,794 - 2,189,891 nt. (total: 108,098 nt) Show pHMM detection rules used

thioamide-NRP: (ATP-grasp and AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC))
betalactone: (HMGL-like and AMP-binding)
t3nrps-iterative: (AMP-binding and PP-binding and (DUF98 or Orn_Arg_deC_N or Orn_DAP_Arg_deC) and not ATP-grasp)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MMAR_RS08610: crotonyl-CoA reductase / alcohol dehydrogenase

smcogs: SMCOG1028: crotonyl-CoA reductase / alcohol dehydrogenase

MMAR_RS08615: dihydropteridine reductase

smcogs: SMCOG1159: dihydropteridine reductase

MMAR_RS08640: aldo/keto reductase family oxidoreductase

smcogs: SMCOG1039: aldo/keto reductase family oxidoreductase

MMAR_RS08710: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MMAR_RS31125: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acylase carboxylase formyltransferase glycosyltransferase methyltransferase

MMAR_RS08665: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

MMAR_RS08685: methionyl-tRNA formyltransferase

smcogs: SMCOG1228: methionyl-tRNA formyltransferase

MMAR_RS08695: glycosyltransferase, MGT family

smcogs: SMCOG1062: glycosyltransferase, MGT family

MMAR_RS08750: methyltransferase

smcogs: SMCOG1089: methyltransferase

MMAR_RS08755: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MMAR_RS08785: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: esterase hydrolase

MMAR_RS08650: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

MMAR_RS08810: thioesterase

smcogs: SMCOG1004: thioesterase

Ligases: ligase synthase

MMAR_RS08715: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS08725: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS08730: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MMAR_RS08745: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS08780: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MMAR_RS08790: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MMAR_RS08795: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MMAR_RS08805: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

MMAR_RS08740: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	2.03	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	2.03	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	1.64	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	1.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	1.63	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001254.3	1.52	PKS	ACT-Toxin II	Alternaria alternata
BGC0002277.2	1.50	NRPS	atromentin	Suillus grevillei
BGC0002191.2	1.48	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0002192.3	1.47	PKS	FR901512	fungal sp. No.14919
BGC0001284.4	1.43	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001275.3	0.78	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.77	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.77	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001164.3	0.68	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.68	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001276.3	0.68	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002277.2	0.65	NRPS	atromentin	Suillus grevillei
BGC0002192.3	0.65	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.63	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.09 out of 20.47

Confidence: medium

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 31.23 out of 32.93

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.71 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.55 out of 19.26

Confidence: medium

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 27.59 out of 32.38

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 21.14 out of 25.88

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.82 out of 21.84

Confidence: medium

AfsR

Description: Pleiotropic regulatory for antibiotic production
Species: Streptomyces coelicolor
Score: 18.46 out of 23.05

Confidence: medium

Additional weak hits (11):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 24.51 out of 32.74

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.36 out of 39.62

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.15 out of 26.06

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.61 out of 21.55

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.07 out of 39.62

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.13 out of 30.97

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.78 out of 30.98

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.00 out of 32.38

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.05 out of 35.63

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.47 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 14, location 2081793 - 2189891:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal) + (Me-ohmal) + (Me-redmal) + (Me-ccmal) + (D-mal) + (Me-redmal) + (redmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS08715: fatty_acid

CAL_domain (39..498): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 43.2
Acetyl-CoA: 23.1
NH2: 20.0
AHBA: 8.2
shikimic_acid: 0.0

MMAR_RS08725: X

AMP-binding (17..391): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAMAFAYGLGSFYGVSAGELDGVGSTEVGQTFVS
Nearest Stachelhaus code(s):: pNH2-Bz AYNFIAGSTK (53% 8Å match)
Stachelhaus code match:: 60% (weak)

MMAR_RS08730: mal

PKS_AT (573..863): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 100.0%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 194.2
inactive: 98.0
Methoxymalonyl-CoA: 64.6
Methylmalonyl-CoA: 51.7
Propionyl-CoA: 31.8
Benzoyl-CoA: 23.1
fatty_acid: 22.2
Acetyl-CoA: 18.8
2-Methylbutyryl-CoA: 17.8
Isobutyryl-CoA: 14.1
CHC-CoA: 10.5
Ethylmalonyl-CoA: 8.3
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

MMAR_RS08745: Acetyl-CoA

CAL_domain (39..482): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 30.5
NH2: 12.5
AHBA: 12.0
fatty_acid: 10.2
shikimic_acid: 7.4

MMAR_RS08755: mmal

PKS_AT (538..832): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Isobutyryl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 137.1
Ethylmalonyl-CoA: 132.6
Methoxymalonyl-CoA: 116.5
2-Methylbutyryl-CoA: 93.1
Propionyl-CoA: 87.9
Malonyl-CoA: 87.9
trans-1,2-CPDA: 67.9
Acetyl-CoA: 66.2
Isobutyryl-CoA: 53.4
CHC-CoA: 52.4
Benzoyl-CoA: 46.2
fatty_acid: 38.8
inactive: 31.8
3-Methylbutyryl-CoA: 22.0

MMAR_RS08780: mal

PKS_AT (545..823): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; 2-Rhyd-Malonyl-CoA: 58.3%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 116.5
Methoxymalonyl-CoA: 72.6
inactive: 66.7
Methylmalonyl-CoA: 56.8
Propionyl-CoA: 38.6
Ethylmalonyl-CoA: 34.4
2-Methylbutyryl-CoA: 18.7
CHC-CoA: 15.9
Benzoyl-CoA: 15.9
trans-1,2-CPDA: 15.5
fatty_acid: 13.4
Isobutyryl-CoA: 9.5
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

MMAR_RS08785: mmal

PKS_AT (564..854): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 75.0%; Malonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 141.5
Ethylmalonyl-CoA: 120.2
Methoxymalonyl-CoA: 117.5
Malonyl-CoA: 102.0
Propionyl-CoA: 77.0
trans-1,2-CPDA: 76.0
Isobutyryl-CoA: 75.3
2-Methylbutyryl-CoA: 73.5
Acetyl-CoA: 61.5
Benzoyl-CoA: 52.3
CHC-CoA: 50.8
fatty_acid: 50.3
3-Methylbutyryl-CoA: 36.4
inactive: 35.3

MMAR_RS08790: mmal

PKS_AT (567..865): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 75.0%; Malonyl-CoA: 70.8%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 116.6
Methoxymalonyl-CoA: 99.6
Ethylmalonyl-CoA: 91.4
Malonyl-CoA: 74.6
Propionyl-CoA: 73.3
Isobutyryl-CoA: 68.6
trans-1,2-CPDA: 64.5
Benzoyl-CoA: 56.0
2-Methylbutyryl-CoA: 48.3
fatty_acid: 47.8
Acetyl-CoA: 45.6
CHC-CoA: 45.1
inactive: 23.5
3-Methylbutyryl-CoA: 17.8

MMAR_RS08795: mmal

PKS_AT (565..863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 70.8%; Malonyl-CoA: 66.7%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 111.8
Ethylmalonyl-CoA: 91.6
Methoxymalonyl-CoA: 85.0
Propionyl-CoA: 68.9
Malonyl-CoA: 63.4
trans-1,2-CPDA: 58.1
Isobutyryl-CoA: 55.2
Benzoyl-CoA: 45.3
fatty_acid: 42.7
2-Methylbutyryl-CoA: 42.1
CHC-CoA: 36.8
Acetyl-CoA: 35.4
inactive: 20.6
3-Methylbutyryl-CoA: 9.1

MMAR_RS31130: mmal

PKS_AT (633..930): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 70.8%; Malonyl-CoA: 66.7%; Ethylmalonyl-CoA: 62.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 114.7
Ethylmalonyl-CoA: 93.9
Methoxymalonyl-CoA: 86.5
Propionyl-CoA: 72.3
Malonyl-CoA: 64.6
trans-1,2-CPDA: 57.2
Isobutyryl-CoA: 56.7
2-Methylbutyryl-CoA: 46.2
Benzoyl-CoA: 45.0
fatty_acid: 42.5
CHC-CoA: 40.5
Acetyl-CoA: 35.6
inactive: 20.6
3-Methylbutyryl-CoA: 8.1

MMAR_RS08805: Acetyl-CoA

CAL_domain (41..487): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 34.1
fatty_acid: 24.7
shikimic_acid: 12.1
AHBA: 10.5
NH2: 7.7

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsR	Pleiotropic regulatory for antibiotic production
CRP	Cyclic AMP receptor protein
CsoR	Copper-responsive repressor
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
PsrA	Oleic acid responsive regulator
RicR	Copper-responsive regulator
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 13 - NRPS-like

Download region GenBank file

Download region SVG

Location: 2,263,096 - 2,306,119 nt. (total: 43,024 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

MMAR_RS09285: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Ligases: ligase

MMAR_RS09290: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

MMAR_RS09295: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001831.3	0.47	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000913.3	0.47	other (other)	MK-8	Enterobacter cloacae
BGC0000393.5	0.44	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0001336.5	0.43	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001895.4	0.43	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0001948.3	0.43	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001343.3	0.42	PKS	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0002591.2	0.41	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001831.3	0.47	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000913.3	0.47	other (other)	MK-8	Enterobacter cloacae
BGC0000393.5	0.44	NRPS, PKS	myxoprincomide-c506	Myxococcus xanthus DK 1622
BGC0001336.5	0.43	other (other)	erdasporine A, erdasporine B, erdasporine C	uncultured bacterium
BGC0001895.4	0.43	PKS	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0001948.3	0.43	other (other)	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001343.3	0.42	PKS	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0002591.2	0.41	PKS, terpene	aurachin C, aurachin D, aurachin SS	Streptomyces sp.

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.57 out of 20.97

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.52 out of 29.72

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.90 out of 28.19

Confidence: medium

Additional weak hits (6):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.52 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.79 out of 29.38

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.78 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.19 out of 27.78

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.37 out of 30.98

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 23.28 out of 30.98

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 15, location 2263095 - 2306119:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NH2)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS09290: NH2

CAL_domain (174..494): NH2

minowa: NH2

Prediction, score:

NH2: 74.1
Acetyl-CoA: 51.2
fatty_acid: 9.7
AHBA: 8.8
shikimic_acid: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
NtrC	Nitrogen regulatory protein C
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NC_010612.1 - Region 14 - NRPS-like

Download region GenBank file

Download region SVG

Location: 2,529,712 - 2,573,236 nt. (total: 43,525 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: aminotransferase

MMAR_RS10540: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

Hydrolases: hydrolase

MMAR_RS10580: metallo-beta-lactamase family protein

smcogs: SMCOG1170: metallo-beta-lactamase family protein

Ligases: ligase

MMAR_RS10535: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0000919.5	0.44	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0002382.3	0.39	ribosomal	grimoviridin	Grimontia marina
BGC0000313.4	0.39	NRPS	beauvericin	Beauveria bassiana
BGC0002535.2	0.38	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001627.4	0.38	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0000841.5	0.37	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000384.6	0.36	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0002706.2	0.36	NRPS	saframycin Mx1	Myxococcus xanthus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000856.3	0.47	other (other)	ectoine	Methylophaga thalassica
BGC0000853.3	0.45	other (other)	ectoine	Streptomyces anulatus
BGC0000919.5	0.44	other (other)	phaseolotoxin	Pseudomonas syringae
BGC0002382.3	0.39	ribosomal	grimoviridin	Grimontia marina
BGC0000313.4	0.39	NRPS	beauvericin	Beauveria bassiana
BGC0002535.2	0.38	NRPS	γ-poly-L-2,4-diaminobutyric acid	Streptomyces celluloflavus
BGC0001627.4	0.38	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0000841.5	0.37	other (non-nrp beta-lactam)	alanylclavam, 2-hydroxymethylclavam, 2-formyloxymethylclavam, clavam-2-carboxylate, clavulanic acid	Streptomyces clavuligerus ATCC 27064
BGC0000384.6	0.36	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0002706.2	0.36	NRPS	saframycin Mx1	Myxococcus xanthus

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 26.42 out of 29.72

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.06 out of 19.26

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 22.78 out of 24.78

Confidence: strong

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.05 out of 24.78

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 28.63 out of 29.65

Confidence: strong

Additional weak hits (17):

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.32 out of 26.12

Confidence: weak

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.14 out of 19.26

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.17 out of 25.88

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 14.89 out of 28.14

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.37 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.50 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.69 out of 26.06

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.20 out of 26.06

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.93 out of 31.73

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.17 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.34 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 19.59 out of 33.73

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.88 out of 32.74

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.14 out of 29.38

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.88 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.59 out of 22.40

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 17.77 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 16, location 2529711 - 2573236:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS10535: X

AMP-binding (83..514): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FKRMHVMGRQIGTFLVDGAVLGGRYTSALTGSAP
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
LexA variant 1	Repressor of DNA damage response
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C

NC_010612.1 - Region 15 - T3PKS

Download region GenBank file

Download region SVG

Location: 2,616,509 - 2,657,690 nt. (total: 41,182 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Transferases: acetyltransferase carbamoyltransferase carboxylase methyltransferase sulfotransferase

MMAR_RS10885: GCN5-related N-acetyltransferase

smcogs: SMCOG1111: GCN5-related N-acetyltransferase

MMAR_RS10910: Sulfotransferase domain

extras: Sulfotransfer_1: Sulfotransferase domain

MMAR_RS10915: Sulfotransferase domain

extras: Sulfotransfer_1: Sulfotransferase domain

MMAR_RS10920: methyltransferase

smcogs: SMCOG1089: methyltransferase

MMAR_RS10930: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

MMAR_RS10950: acetyl-CoA carboxylase biotin carboxylase

smcogs: SMCOG1090: acetyl-CoA carboxylase biotin carboxylase

Hydrolases: hydrolase peptidase

MMAR_RS10855: methionine aminopeptidase

smcogs: SMCOG1172: methionine aminopeptidase

MMAR_RS10890: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: synthase

MMAR_RS10840: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

MMAR_RS10905: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

MMAR_RS10945: carbamoyl phosphate synthase small subunit

smcogs: SMCOG1249: carbamoyl phosphate synthase small subunit

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002439.3	0.49	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000895.5	0.49	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0000701.5	0.45	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0002043.3	0.43	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000203.3	0.43	PKS	BE-7585A	Amycolatopsis orientalis subsp. vinearia
BGC0002561.3	0.43	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0002557.2	0.42	terpene	penifulvin A	Penicillium griseofulvum
BGC0001868.4	0.42	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001077.4	0.42	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002439.3	0.49	other (other)	diastaphenazine, izumiphenazine C	Streptomyces diastaticus
BGC0000895.5	0.49	other (other)	citrulline	Lactobacillus plantarum subsp. plantarum
BGC0000701.5	0.45	saccharide	jinggangmycin	Streptomyces hygroscopicus subsp. yingchengensis
BGC0002403.2	0.45	PKS	β-Diketones	Hordeum vulgare subsp. vulgare
BGC0002043.3	0.43	ribosomal	cittilin A, cittilin B	Myxococcus xanthus DK 1622
BGC0000203.3	0.43	PKS	BE-7585A	Amycolatopsis orientalis subsp. vinearia
BGC0002561.3	0.43	other (other)	phenazine SA, phenazine SB, phenazine SC	Streptomyces sp.
BGC0002557.2	0.42	terpene	penifulvin A	Penicillium griseofulvum
BGC0001868.4	0.42	other (phenazine)	iodinin	Xenorhabdus szentirmaii DSM 16338
BGC0001077.4	0.42	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.26 out of 19.26

Confidence: medium

Additional weak hits (5):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.26 out of 29.25

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.43 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.16 out of 27.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.55 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.96 out of 35.63

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein

NC_010612.1 - Region 16 - 2dos,T1PKS

Download region GenBank file

Download region SVG

Location: 2,778,950 - 2,851,823 nt. (total: 72,874 nt) Show pHMM detection rules used

2dos: ((DOIS or DHQ_synthase or ValA or salQ) and DegT_DnrJ_EryC1 and (LipV or ADSI-DH or cds(ADH_N and ADH_zinc_N)))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidase

MMAR_RS11610: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MMAR_RS11620: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: acylase acyltransferase aminotransferase glycosyltransferase kinase methyltransferase transferase

MMAR_RS11560: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

MMAR_RS11600: glycerol kinase

smcogs: SMCOG1210: glycerol kinase

MMAR_RS11630: glucose-1-phosphate adenylyl/thymidylyltransferase

smcogs: SMCOG1064: glucose-1-phosphate adenylyl/thymidylyltransferase

MMAR_RS11635: DegT/DnrJ/EryC1/StrS aminotransferase

smcogs: SMCOG1056: DegT/DnrJ/EryC1/StrS aminotransferase

MMAR_RS11655: methyltransferase

smcogs: SMCOG1089: methyltransferase

MMAR_RS11660: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MMAR_RS11675: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

MMAR_RS11720: glycosyltransferase

smcogs: SMCOG1102: glycosyltransferase

MMAR_RS11730: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

MMAR_RS11750: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: decarboxylase dehydratase

MMAR_RS11640: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MMAR_RS11685: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: ligase synthase

MMAR_RS11525: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

MMAR_RS11605: 3-dehydroquinate synthase

smcogs: SMCOG1183: 3-dehydroquinate synthase

MMAR_RS11625: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

MMAR_RS11665: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS11680: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MMAR_RS11710: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Translocases: transport

MMAR_RS11670: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.69	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.65	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.61	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.61	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.59	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.59	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.58	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.67	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.67	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001273.3	0.66	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002192.3	0.64	PKS	FR901512	fungal sp. No.14919
BGC0001254.3	0.64	PKS	ACT-Toxin II	Alternaria alternata
BGC0001164.3	0.63	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002191.2	0.63	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001160.5	0.63	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001268.4	0.63	NRPS, PKS	fusarin C	Fusarium fujikuroi

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.33 out of 23.79

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.34 out of 26.85

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.55 out of 27.78

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 17.14 out of 20.97

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.80 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.67 out of 19.26

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 28.19

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.11 out of 19.52

Confidence: medium

Additional weak hits (11):

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.99 out of 27.78

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.50 out of 29.25

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.86 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.11 out of 33.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.53 out of 30.25

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.67 out of 31.73

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.27 out of 30.25

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.26 out of 24.78

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.88 out of 24.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.71 out of 26.06

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.88 out of 20.01

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 18, location 2778949 - 2851823:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (Me-redmal) + (Me-redmal)
Non-colinear ordering:: MMAR_RS11660 + MMAR_RS11680

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS11660: mmal

PKS_AT (530..817): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Isobutyryl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 134.7
Ethylmalonyl-CoA: 130.0
Methoxymalonyl-CoA: 120.4
Malonyl-CoA: 94.6
2-Methylbutyryl-CoA: 85.5
Propionyl-CoA: 85.4
trans-1,2-CPDA: 64.4
Acetyl-CoA: 62.2
Isobutyryl-CoA: 58.4
fatty_acid: 50.5
CHC-CoA: 47.5
Benzoyl-CoA: 46.2
3-Methylbutyryl-CoA: 31.3
inactive: 26.1

MMAR_RS11665: Acetyl-CoA

CAL_domain (39..485): Acetyl-CoA

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 26.6
fatty_acid: 12.7
NH2: 8.2
AHBA: 7.1
shikimic_acid: 0.0

MMAR_RS11680: mmal

PKS_AT (533..827): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 79.2%; Ethylmalonyl-CoA: 75.0%; Isobutyryl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 148.6
Ethylmalonyl-CoA: 140.1
Methoxymalonyl-CoA: 128.4
Malonyl-CoA: 108.6
2-Methylbutyryl-CoA: 99.6
Propionyl-CoA: 91.5
trans-1,2-CPDA: 74.4
Acetyl-CoA: 71.0
Isobutyryl-CoA: 65.9
CHC-CoA: 60.2
fatty_acid: 48.7
Benzoyl-CoA: 47.8
inactive: 37.0
3-Methylbutyryl-CoA: 30.8

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
CcpA	Catabolite control protein A
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
IolR	Regulator of the inositol catabolism
RutR	Regulator of the pyrimidine and purine metabolism
VqsM	Regulator of quorum-sensing signalling systems
ZuR variant 1	Zinc-responsive repressor

NC_010612.1 - Region 17 - NRPS,T1PKS,T3PKS,thioamitides

Download region GenBank file

Download region SVG

Location: 2,972,146 - 3,093,692 nt. (total: 121,547 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
thioamitides: ((YcaO or TIGR03604) and TfuA)
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase phosphate reductase

MMAR_RS12285: N-acetyl-gamma-glutamyl-phosphate reductase

smcogs: SMCOG1219: N-acetyl-gamma-glutamyl-phosphate reductase

MMAR_RS12350: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

MMAR_RS12365: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

MMAR_RS12575: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acylase aminotransferase carbamoyltransferase kinase

MMAR_RS12295: acetylglutamate kinase

smcogs: SMCOG1174: acetylglutamate kinase

MMAR_RS12300: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

MMAR_RS12305: ornithine carbamoyltransferase

smcogs: SMCOG1114: ornithine carbamoyltransferase

MMAR_RS12330: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

MMAR_RS12340: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Lyases: lyase

MMAR_RS12320: argininosuccinate lyase/adenylosuccinate lyase

smcogs: SMCOG1063: argininosuccinate lyase/adenylosuccinate lyase

Ligases: ligase synthase

MMAR_RS12315: argininosuccinate synthase

smcogs: SMCOG1291: argininosuccinate synthase

MMAR_RS12325: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

MMAR_RS12335: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MMAR_RS12345: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

MMAR_RS12370: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS12565: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS12605: Pseudouridine synthase

smcogs: SMCOG1154: Pseudouridine synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001665.3	2.00	PKS	methylated alkyl-resorcinol, methylated acyl-phloroglucinol	Mycobacterium marinum M
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000041.3	0.61	PKS	oronofacic acid	Pseudomonas syringae
BGC0001164.3	0.61	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001665.3	1.00	PKS	methylated alkyl-resorcinol, methylated acyl-phloroglucinol	Mycobacterium marinum M
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001273.3	0.67	PKS	asperlactone	Aspergillus ochraceus
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.66	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001244.3	0.66	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.66	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001275.3	0.66	PKS	6-methylsalicyclic acid	Glarea lozoyensis

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 21.84 out of 27.78

Confidence: medium

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.02 out of 21.55

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 19.49 out of 20.01

Confidence: strong

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.16 out of 18.16

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (33):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.36 out of 29.25

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 21.11 out of 26.12

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.36 out of 32.93

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.75 out of 30.97

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.45 out of 32.74

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.20 out of 32.93

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.72 out of 32.93

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.68 out of 27.78

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 17.03 out of 26.06

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.00 out of 18.57

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 18.21 out of 30.97

Confidence: weak

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.06 out of 26.33

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.42 out of 27.78

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.96 out of 25.88

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.70 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.82 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.94 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.93 out of 29.38

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 15.49 out of 26.06

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.44 out of 20.97

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.00 out of 27.78

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.16 out of 27.04

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 22.87 out of 32.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 22.12 out of 30.98

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.81 out of 24.78

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 25.23 out of 32.38

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.04 out of 18.57

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.79 out of 32.93

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.44 out of 28.19

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.44 out of 28.19

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 19, location 2972145 - 3049128:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (redmal) + (Me-redmal)
Non-colinear ordering:: MMAR_RS12340 + MMAR_RS12335 + MMAR_RS12330

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 20, location 2972145 - 3030380:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal) + (redmal) + (Me-redmal)
Non-colinear ordering:: MMAR_RS12340 + MMAR_RS12335 + MMAR_RS12330

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 22, location 3045268 - 3093692:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-Ser - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS12330: mmal

PKS_AT (565..863): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 208.0
Ethylmalonyl-CoA: 200.0
Methoxymalonyl-CoA: 173.7
2-Methylbutyryl-CoA: 146.4
trans-1,2-CPDA: 125.2
Propionyl-CoA: 121.4
Malonyl-CoA: 110.7
CHC-CoA: 95.1
Isobutyryl-CoA: 92.6
Benzoyl-CoA: 78.5
Acetyl-CoA: 56.3
inactive: 47.5
3-Methylbutyryl-CoA: 46.4
fatty_acid: 40.7

MMAR_RS12335: mal

PKS_AT (560..846): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 83.3%; 2-Rhyd-Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.0
inactive: 96.8
Methoxymalonyl-CoA: 84.2
Methylmalonyl-CoA: 70.8
Propionyl-CoA: 45.7
Ethylmalonyl-CoA: 38.5
Isobutyryl-CoA: 36.3
trans-1,2-CPDA: 33.2
fatty_acid: 32.5
Benzoyl-CoA: 28.8
2-Methylbutyryl-CoA: 27.9
Acetyl-CoA: 25.7
CHC-CoA: 25.4
3-Methylbutyryl-CoA: 0.0

MMAR_RS12340: mal

PKS_AT (520..796): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 166.9
inactive: 81.4
Methoxymalonyl-CoA: 78.0
Methylmalonyl-CoA: 63.0
Propionyl-CoA: 39.7
Ethylmalonyl-CoA: 30.2
trans-1,2-CPDA: 28.0
Isobutyryl-CoA: 27.9
Benzoyl-CoA: 26.2
CHC-CoA: 24.6
fatty_acid: 21.1
2-Methylbutyryl-CoA: 19.2
Acetyl-CoA: 15.8
3-Methylbutyryl-CoA: 0.0

MMAR_RS12370: X

AMP-binding (454..863): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: YAVTHESALLSGSYLFIGSVEFFATTDGQAVLAN
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

MMAR_RS12565: Ser - X

Search NORINE for peptide: strict or relaxed

AMP-binding (476..883): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSFHFDVSVWEGSQLFAGEFNLYGTTETTVHASW
Nearest Stachelhaus code(s):: Ser DVYSLALVHK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1987..2379): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSFHFDVSVWEGTQVVGGEINAYGPTEATIYAAM
Nearest Stachelhaus code(s):: Aol DVWYVAAIYK (79% 8Å match)
Stachelhaus code match:: 80% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AbrC3	Antibiotic production activator
ArcA	Repressor of carbon oxidation
ArgR	Regulator of arginine biosynthesis genes
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 18 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 3,103,519 - 3,124,505 nt. (total: 20,987 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MMAR_RS12775: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MMAR_RS12835: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: hydrolase

MMAR_RS12810: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Ligases: synthetase

MMAR_RS12800: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002007.2	0.38	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001456.3	0.38	terpene	isorenieratene	Streptomyces argillaceus
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000633.3	0.37	terpene	carotenoid	Streptomyces avermitilis
BGC0001529.5	0.35	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002284.3	0.34	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000632.5	0.34	saccharide, terpene	brasilicardin A	Nocardia terpenica

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002397.2	0.46	terpene	astallatene	Arabidopsis thaliana
BGC0002400.2	0.43	terpene	boleracene	Brassica oleracea var. oleracea
BGC0002007.2	0.38	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0001456.3	0.38	terpene	isorenieratene	Streptomyces argillaceus
BGC0002398.2	0.38	terpene	(-)-ent-quiannulatene	Arabidopsis thaliana
BGC0000642.3	0.37	terpene	carotenoid	Enterobacteriaceae bacterium DC413
BGC0000633.3	0.37	terpene	carotenoid	Streptomyces avermitilis
BGC0001529.5	0.35	other (other)	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0002284.3	0.34	other (other)	corynecin III, corynecin I, corynecin II	Rhodococcus sp. H-CA8f
BGC0000632.5	0.34	saccharide, terpene	brasilicardin A	Nocardia terpenica

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

MMAR_RS12800: PT_FPPS_like

Domain 1 (61 - 238): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 22.05 out of 22.40

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.99 out of 20.47

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

Additional weak hits (4):

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.82 out of 28.14

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.35 out of 20.97

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 22.68 out of 30.22

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 22.43 out of 29.65

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
HypR	L-hydroxyproline utilization repressor
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 19 - NRPS

Download region GenBank file

Download region SVG

Location: 3,349,477 - 3,393,943 nt. (total: 44,467 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase reductase

MMAR_RS13735: alkyl hydroperoxide reductase/ Thiol specific

smcogs: SMCOG1196: alkyl hydroperoxide reductase/ Thiol specific

MMAR_RS13800: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MMAR_RS13810: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MMAR_RS13835: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MMAR_RS13865: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

MMAR_RS13870: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Hydrolases: amidase dehalogenase esterase glucosidase

MMAR_RS13725: Alpha-glucosidase

smcogs: SMCOG1257: Alpha-glucosidase

MMAR_RS13785: amidase

smcogs: SMCOG1105: amidase

MMAR_RS13830: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

MMAR_RS13845: putative esterase

smcogs: SMCOG1104: putative esterase

Lyases: hydratase

MMAR_RS13755: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: ligase

MMAR_RS13790: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001261.3	0.66	NRPS	AM-toxin	Alternaria alternata
BGC0001166.5	0.65	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.65	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001128.4	0.65	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.65	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0000307.4	0.64	NRPS	AbT1	Aureobasidium pullulans
BGC0001825.4	0.64	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.4	0.64	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.61 out of 36.53

Confidence: medium

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 29.61 out of 36.53

Confidence: medium

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 23.95 out of 29.65

Confidence: medium

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 20.46 out of 23.43

Confidence: medium

Additional weak hits (8):

CopR

Description: Copper-responsive regulator
Species: Lactococcus lactis subsp. lactis Il1403
Score: 19.67 out of 30.97

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.18 out of 32.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.50 out of 26.85

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.81 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.92 out of 24.78

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.39 out of 28.19

Confidence: weak

NrdR

Description: Represses ribonucleotide reductase encoding genes
Species: Streptomyces coelicolor
Score: 20.83 out of 27.18

Confidence: weak

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 23.44 out of 30.12

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 24, location 3349476 - 3393943:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS13790: X

AMP-binding (466..854): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSPHFDFSVWESTQVVGGEVNAYGPTESTVCVSI
Nearest Stachelhaus code(s):: Phe DFWTVAAVCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
BldD	Development and antibiotic global regulator
DmdR1	Iron(II)-dependent repressor
LexA variant 1	Repressor of DNA damage response
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 20 - NRPS-like,azole-containing-RiPP

Download region GenBank file

Download region SVG

Location: 3,520,918 - 3,564,445 nt. (total: 43,528 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)
azole-containing-RiPP: ((YcaO or TIGR03604) and (((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or (PF06968 or PF04055 or PF07366)) or (goadsporin_like or PF00881 or TIGR03605)) or TIGR03882 or TIGR03603 or thiostrepton or TIGR03602)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Azole RiPPs

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase oxygenase

MMAR_RS14590: FAD dependent oxidoreductase

smcogs: SMCOG1103: FAD dependent oxidoreductase

MMAR_RS14615: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MMAR_RS30875: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

Transferases: glycosyltransferase methyltransferase

MMAR_RS14560: methyltransferase

smcogs: SMCOG1089: methyltransferase

MMAR_RS14580: methyltransferase

smcogs: SMCOG1089: methyltransferase

MMAR_RS14585: glycosyl transferase group 1

smcogs: SMCOG1045: glycosyl transferase group 1

Ligases: ligase

MMAR_RS14640: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.77	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001310.5	0.37	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001986.3	0.35	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0000851.5	0.31	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0000384.6	0.29	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0001483.4	0.28	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0000483.5	0.27	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0002347.3	0.26	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0000477.3	0.25	ribosomal	patellin 2, patellin 3	uncultured Prochloron sp. 06037A
BGC0001627.4	0.24	NRPS	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002276.2	0.71	NRPS	choline	Aspergillus nidulans FGSC A4
BGC0001310.5	0.50	PKS	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001986.3	0.49	other (other)	purincyclamide	Streptomyces chrestomyceticus
BGC0000851.5	0.46	other (other)	albonoursin	Streptomyces noursei ATCC 11455
BGC0000384.6	0.45	NRPS	lyngbyatoxin	Lyngbya majuscula
BGC0000870.5	0.44	other (other)	mycolic acid	Mycobacterium tuberculosis H37Rv
BGC0001483.4	0.44	other (other)	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002347.3	0.44	other (other)	cyanogramide, cyanogramide B, cyanogramide C, cyanogramide D	Actinoalloteichus caeruleus WH1-2216-6
BGC0000249.5	0.43	PKS	nogalamycin	Streptomyces nogalater
BGC0000483.5	0.42	ribosomal	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

OsdR

Description: Development and stress management regulator
Species: Streptomyces coelicolor
Score: 26.50 out of 30.12

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.45 out of 25.88

Confidence: medium

Additional weak hits (9):

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 20.95 out of 32.74

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.73 out of 30.25

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 20.42 out of 33.73

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.62 out of 32.93

Confidence: weak

LexA variant 3

Description: Repressor of DNA damage response
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.20 out of 32.93

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.38 out of 21.84

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.94 out of 39.62

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.40 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 24.12 out of 32.38

Confidence: weak

(Thi)azol(in)e containing peptide predictions

No core peptides found.

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Azole RiPPs

Predicted core structure(s)

For candidate cluster 25, location 3520917 - 3564445:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS14640: X

AMP-binding (80..518): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FTSMHANGRQVGGFTAEGA----------RYALA
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
OsdR	Development and stress management regulator
PsrA	Oleic acid responsive regulator

Core peptide predictions

No core peptides found.

NC_010612.1 - Region 21 - T1PKS

Download region GenBank file

Download region SVG

Location: 3,629,476 - 3,682,039 nt. (total: 52,564 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MMAR_RS15170: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Hydrolases: hydrolase

MMAR_RS15070: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

Ligases: ligase synthase

MMAR_RS15095: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MMAR_RS15115: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

MMAR_RS15155: cobaltochelatase subunit CobN

smcogs: SMCOG1263: cobaltochelatase subunit CobN

Translocases: transporter

MMAR_RS15040: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000867.3	0.47	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002234.3	0.47	PKS	flavoglaucin	Aspergillus ruber CBS 135680
BGC0002233.3	0.47	PKS	trichoxide	Trichoderma virens Gv29-8
BGC0002729.2	0.46	PKS	sordarial	Neurospora crassa OR74A
BGC0001504.4	0.46	PKS	amycomicin	Amycolatopsis sp. AA4
BGC0000041.3	0.45	PKS	oronofacic acid	Pseudomonas syringae
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000867.3	0.47	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0002234.3	0.47	PKS	flavoglaucin	Aspergillus ruber CBS 135680
BGC0002233.3	0.47	PKS	trichoxide	Trichoderma virens Gv29-8
BGC0002729.2	0.46	PKS	sordarial	Neurospora crassa OR74A
BGC0001504.4	0.46	PKS	amycomicin	Amycolatopsis sp. AA4
BGC0000041.3	0.45	PKS	oronofacic acid	Pseudomonas syringae
BGC0002150.2	0.43	ribosomal	triculamin	Streptomyces triculaminicus
BGC0002151.2	0.43	ribosomal	alboverticillin	Streptomyces griseocarneus
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 22.40 out of 27.55

Confidence: medium

Additional weak hits (5):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.18 out of 29.51

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 21.60 out of 30.98

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.10 out of 22.40

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.60 out of 35.63

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 26, location 3629475 - 3682039:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - redmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS15095: pk - mal

PKS_AT (568..867): pk

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Ethylmalonyl-CoA

Prediction, score:

Ethylmalonyl-CoA: 219.0
Methylmalonyl-CoA: 214.0
Methoxymalonyl-CoA: 174.9
2-Methylbutyryl-CoA: 148.3
trans-1,2-CPDA: 128.2
Malonyl-CoA: 114.5
Propionyl-CoA: 108.7
CHC-CoA: 93.2
Isobutyryl-CoA: 86.0
Benzoyl-CoA: 63.8
Acetyl-CoA: 49.6
inactive: 42.6
3-Methylbutyryl-CoA: 34.9
fatty_acid: 34.6

PKS_AT (2605..2898): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 79.2%; 2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 187.1
inactive: 95.7
Methoxymalonyl-CoA: 59.7
Methylmalonyl-CoA: 46.1
Propionyl-CoA: 38.2
Acetyl-CoA: 21.8
2-Methylbutyryl-CoA: 20.6
Benzoyl-CoA: 18.4
CHC-CoA: 17.2
Ethylmalonyl-CoA: 15.1
Isobutyryl-CoA: 13.2
fatty_acid: 9.6
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
GnfM	Regulator of nitrogen-fixation genes

NC_010612.1 - Region 22 - NRPS,NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 3,727,926 - 3,801,318 nt. (total: 73,393 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MMAR_RS15465: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

MMAR_RS15510: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MMAR_RS15520: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Hydrolases: phosphatase

MMAR_RS15525: inositol monophosphatase

smcogs: SMCOG1207: inositol monophosphatase

Isomerases: mutase

MMAR_RS15540: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: ligase synthase

MMAR_RS15445: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MMAR_RS15450: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MMAR_RS28515: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000041.3	1.05	PKS	oronofacic acid	Pseudomonas syringae
BGC0001833.4	0.93	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001273.3	0.92	PKS	asperlactone	Aspergillus ochraceus
BGC0002192.3	0.91	PKS	FR901512	fungal sp. No.14919
BGC0002135.2	0.91	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001254.3	0.90	PKS	ACT-Toxin II	Alternaria alternata
BGC0001275.3	0.90	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.90	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.90	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001160.5	0.89	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001833.4	0.76	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.76	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.74	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.5	0.74	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0002286.3	0.74	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.74	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.4	0.74	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001825.4	0.73	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001261.3	0.72	NRPS	AM-toxin	Alternaria alternata
BGC0000307.4	0.71	NRPS	AbT1	Aureobasidium pullulans

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 20.65 out of 24.78

Confidence: medium

Additional weak hits (12):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 22.27 out of 31.73

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.50 out of 30.22

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.79 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.24 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.50 out of 29.38

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.84 out of 26.85

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.56 out of 39.62

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 15.97 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.72 out of 20.01

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.32 out of 30.22

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.82 out of 36.53

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 26.03 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 27, location 3727925 - 3801318:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - redmal) + (Me-redmal) + (Ser - Ser - X - X - Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 28, location 3727925 - 3784707:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - redmal) + (Me-redmal) + (Ser - Ser - X - X - Ser)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 29, location 3744825 - 3801318:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (fatty_acid - redmal) + (Me-redmal) + (Ser - Ser - X - X - Ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS15445: Ser - Ser - X - X - Ser

Search NORINE for peptide: strict or relaxed

AMP-binding (503..904): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSLHFDVSVCEGSQLLAGEINLYGTTETTVHASV
Nearest Stachelhaus code(s):: Ser DVYSLALVHK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (1575..1976): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSLHFDVSVCEGSQLLAGEINLYGTTETTVHASV
Nearest Stachelhaus code(s):: Ser DVYSLALVHK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2647..3035): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSTHFDISGWEGSQLVGGEINEYGPTETTMWVAL
Nearest Stachelhaus code(s):: Gly DILQLGLIWK (65% 8Å match)
Stachelhaus code match:: 60% (weak)

AMP-binding (3706..4094): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSTVFDVSVWEGSQLMGSEINGYGPTETTIYTTL
Nearest Stachelhaus code(s):: Ala DVGMVGGIYK (44% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (4765..5166): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSLHFDVSVCEGSQLLAGEINLYGTTETTVHASV
Nearest Stachelhaus code(s):: Ser DVYSLALVHK (74% 8Å match)
Stachelhaus code match:: 90% (moderate)

MMAR_RS15450: mmal

PKS_AT (581..881): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 91.7%; Ethylmalonyl-CoA: 87.5%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 196.6
Ethylmalonyl-CoA: 192.9
Methoxymalonyl-CoA: 159.0
trans-1,2-CPDA: 118.6
2-Methylbutyryl-CoA: 108.4
Propionyl-CoA: 98.8
Malonyl-CoA: 90.1
CHC-CoA: 77.8
Isobutyryl-CoA: 67.4
Benzoyl-CoA: 59.7
Acetyl-CoA: 41.8
fatty_acid: 31.2
3-Methylbutyryl-CoA: 29.0
inactive: 25.4

MMAR_RS28515: fatty_acid - mal

CAL_domain (51..494): fatty_acid

minowa: fatty_acid

Prediction, score:

fatty_acid: 19.0
AHBA: 12.6
NH2: 8.4
shikimic_acid: 2.6
Acetyl-CoA: -2.8

PKS_AT (1243..1534): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 75.0%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 163.1
inactive: 90.2
Methoxymalonyl-CoA: 56.8
Methylmalonyl-CoA: 38.8
Propionyl-CoA: 32.5
Isobutyryl-CoA: 23.0
Acetyl-CoA: 19.3
Benzoyl-CoA: 15.9
fatty_acid: 15.4
2-Methylbutyryl-CoA: 10.2
CHC-CoA: 8.8
trans-1,2-CPDA: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -1.8

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
LexA variant 2	Repressor of DNA damage response

NC_010612.1 - Region 23 - NRPS,T3PKS,terpene

Download region GenBank file

Download region SVG

Location: 3,839,153 - 3,938,728 nt. (total: 99,576 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

MMAR_RS15745: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MMAR_RS15790: alcohol dehydrogenase

smcogs: SMCOG1040: alcohol dehydrogenase

Transferases: acyltransferase methyltransferase

MMAR_RS15820: methyltransferase

smcogs: SMCOG1089: methyltransferase

MMAR_RS16085: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: esterase hydrolase

MMAR_RS15770: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

MMAR_RS15775: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Lyases: cyclase decarboxylase

MMAR_RS15795: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

MMAR_RS16055: Terpene synthase/cyclase metal-binding domain protein

smcogs: SMCOG1052: Terpene synthase/cyclase metal-binding domain protein

Ligases: ligase synthase synthetase

MMAR_RS15845: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MMAR_RS15995: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

MMAR_RS16015: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

MMAR_RS16020: hydroxymethylglutaryl-CoA synthase

smcogs: SMCOG1043: hydroxymethylglutaryl-CoA synthase

MMAR_RS16050: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

MMAR_RS16060: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

MMAR_RS16110: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

MMAR_RS15835: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.88	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001642.3	0.88	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0000673.3	0.43	terpene	pimara-8(14),15-diene	Aspergillus nidulans FGSC A4
BGC0002162.3	0.42	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0000342.4	0.41	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.38	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.38	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001075.5	0.38	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001825.4	0.37	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0002309.2	0.37	terpene	cattleyene	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002708.2	0.75	terpene	(+)-δ-cadinol	Coniophora puteana RWD-64-598 SS2
BGC0001642.3	0.75	terpene	koraiol	Fusarium fujikuroi IMI 58289
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.71	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001132.4	0.70	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.4	0.70	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001128.4	0.69	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.68	NRPS	AbT1	Aureobasidium pullulans
BGC0001758.4	0.68	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

MMAR_RS15995: PT_FPPS_like

Domain 1 (32 - 350): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

MMAR_RS16015: PT_FPPS_like

Domain 1 (65 - 324): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

MMAR_RS16050: PT_FPPS_like

Domain 1 (63 - 329): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

MMAR_RS16055: T1TS

Domain 1 (15 - 319): Type 1 terpene synthase

Subtype: unknown

Transcription Factor Binding Sites

Binding sites found:

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 20.71 out of 23.79

Confidence: strong

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 18.15 out of 18.46

Confidence: strong

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.07 out of 25.31

Confidence: medium

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 18.34 out of 20.01

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.14 out of 29.72

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

Additional weak hits (16):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.27 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 21.25 out of 29.25

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.29 out of 39.62

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.90 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.92 out of 29.38

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.22 out of 29.38

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.21 out of 26.06

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 18.74 out of 27.78

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.88 out of 27.78

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 18.81 out of 30.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.35 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.23 out of 20.01

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.66 out of 29.38

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.19 out of 30.25

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.82 out of 26.85

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

Terpene

TFBS Finder

Predicted core structure(s)

For candidate cluster 30, location 3839152 - 3938728:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Ser - NMe-Leu - Ser - Thr - NMe-X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 31, location 3839152 - 3899816:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-Ser - NMe-Leu - Ser - Thr - NMe-X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS15845: Ser - Leu - Ser - Thr - X

Search NORINE for peptide: strict or relaxed

AMP-binding (464..880): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LGFHFDVSAWEGSQVFAGEINMYGITETTVHTTY
Nearest Stachelhaus code(s):: Ser DVWSVAMVHK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (1958..2365): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Aliphatic, branched hydrophobic (Val, Leu, Ile, Abu, Ival)
Single AA prediction:: leu (Leu)

Stachelhaus prediction details:

Stachelhaus sequence:: MLCAFDASVLEPFVVTGGDVNAYGPTEGTVAATM
Nearest Stachelhaus code(s):: Leu DALFVGAVAK (71% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (3441..3861): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LGFHFDVSAWEGSQVFAGEINMYGITETTVHTTY
Nearest Stachelhaus code(s):: Ser DVWSVAMVHK (82% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (4541..4961): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LGFHFDFSVWEGSQVFGGEINMYGITETTVHTTY
Nearest Stachelhaus code(s):: Thr DFWSVGMVHK (91% 8Å match)
Stachelhaus code match:: 100% (strong)

AMP-binding (5642..6041): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HWMTFDVSLWGVDFFVIGEHNAYGPTEAVTTTTW
Nearest Stachelhaus code(s):: Pro DVWVFSAIQK (56% 8Å match)
Stachelhaus code match:: 60% (weak)

MMAR_RS16110: X

AMP-binding (23..467): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: EGTLHVLARALSVS-----R--------AKHALF
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
ArgR	Regulator of arginine biosynthesis genes
CatR	H2O2-responsive repressor
IolR	Regulator of the inositol catabolism
NtrC	Nitrogen regulatory protein C
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 24 - NRPS

Download region GenBank file

Download region SVG

Location: 3,964,467 - 4,057,001 nt. (total: 92,535 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidase

MMAR_RS16360: pyruvate oxidase/decarboxylase

smcogs: SMCOG1055: pyruvate oxidase/decarboxylase

Transferases: acyltransferase

MMAR_RS30880: polyketide synthase associated protein papA3

smcogs: SMCOG1209: polyketide synthase associated protein papA3

Hydrolases: dehalogenase

MMAR_RS16255: haloalkane dehalogenase

smcogs: SMCOG1262: haloalkane dehalogenase

Lyases: decarboxylase dehydratase

MMAR_RS16265: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MMAR_RS16330: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Ligases: ligase

MMAR_RS16300: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MMAR_RS16315: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Translocases: transport

MMAR_RS16280: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

MMAR_RS16290: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.72	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001758.4	0.75	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001833.4	0.75	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002135.2	0.74	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001135.5	0.73	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001128.4	0.73	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001825.4	0.72	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001641.4	0.72	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.72	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.4	0.72	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001166.5	0.70	NRPS	HC-toxin	Alternaria jesenskae

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 18.18 out of 20.97

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 21.23 out of 28.19

Confidence: medium

Additional weak hits (15):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.13 out of 25.75

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 18.55 out of 26.12

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 22.75 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.61 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 18.53 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.04 out of 21.84

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.72 out of 20.97

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 19.27 out of 29.38

Confidence: weak

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 18.77 out of 29.25

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.78 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.07 out of 21.84

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.17 out of 33.14

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 19.08 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 22.82 out of 36.53

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 33, location 3964466 - 4057001:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Leu) + (Ala - Ser - Ser - Ala - X - Leu - Phe - Ser - Leu)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS16300: Ala - Ser - Ser - Ala - X - Leu - Phe - Ser - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (468..859): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTLHFDYSVWEGSQIVAAELNAYGPTETTIYATV
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (76% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (1533..1940): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTLHFDVSVCEGSHILAGEINMYGTTETTVHATL
Nearest Stachelhaus code(s):: Ser DVWSIAMVHK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (2612..3015): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LQLHFDVSVCEGSHILAGEINMYGTTETTVHATL
Nearest Stachelhaus code(s):: Ser DVWSIAMVHK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (3695..4083): Ala

nrpys: Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LQLHFDVSVWEGSHIVAGELNAYGPTETTIYATT
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (4760..5147): X

nrpys: Gly, Ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: Tiny, hydrophilic, transition to aliphatic (Gly, Ala)
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LDLHFDVAVLEGNHILIGEINAYGPTEATIYLTA
Nearest Stachelhaus code(s):: Ala DVWCIAAIYK (71% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (5825..6221): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: WSLHFDYSVWEASQLTGGELNAYGPTETTVAATI
Nearest Stachelhaus code(s):: Leu DAWILGAVAK (68% 8Å match)
Stachelhaus code match:: 80% (moderate)

AMP-binding (6900..7285): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: Unpolar aromatic ring (Phe, Trp)
Single AA prediction:: phe (Phe)

Stachelhaus prediction details:

Stachelhaus sequence:: LQLHFDVSVWEGTHITVGEINAYGPSETTMCTTI
Nearest Stachelhaus code(s):: Phe DVWTAVAMCK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (7957..8361): Ser

nrpys: Ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LQLHFDVSVCEGSHILAGEINMYGTTETTVHATL
Nearest Stachelhaus code(s):: Ser DVWSIAMVHK (79% 8Å match)
Stachelhaus code match:: 90% (moderate)

AMP-binding (9041..9434): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: WSLHFDYSVWEGSQLTGGELNAYGPTETTVAATI
Nearest Stachelhaus code(s):: Leu DAWILGAVAK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

MMAR_RS30880: X - Leu

Search NORINE for peptide: strict or relaxed

AMP-binding (467..857): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LTLHFDYSVWEGSQLVGGELSVYGPTESTIFAAA
Nearest Stachelhaus code(s):: Ile DFWSTGVILK (59% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1536..1929): Leu

nrpys: Leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: WSLHFDYSVWEGSQLTGGELNAYGPTETTVAATI
Nearest Stachelhaus code(s):: Leu DAWILGAVAK (65% 8Å match)
Stachelhaus code match:: 80% (moderate)

MMAR_RS16315: X

AMP-binding (20..450): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: NASLHDMMVGFIAGVNGAETPFYGLAEAALTVSA
Nearest Stachelhaus code(s):: Pca DMGVLGCLMK (59% 8Å match); OH-Orn DGEAVGGVTK (29% 8Å match)
Stachelhaus code match:: 60% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
RpoN	Regulator of nitrogen assimilation and virulence
ZuR variant 1	Zinc-responsive repressor

NC_010612.1 - Region 25 - NRPS

Download region GenBank file

Download region SVG

Location: 4,443,193 - 4,492,699 nt. (total: 49,507 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase electron transfer oxidoreductase

MMAR_RS18085: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MMAR_RS18095: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MMAR_RS18100: flavin reductase domain protein FMN-binding

smcogs: SMCOG1160: flavin reductase domain protein FMN-binding

MMAR_RS18125: flavodoxin

smcogs: SMCOG1134: flavodoxin

Transferases: aminotransferase halogenase methyltransferase

MMAR_RS18040: aminotransferase class-III

smcogs: SMCOG1013: aminotransferase class-III

MMAR_RS18090: flavin-dependent trp 6 7 halogenase

halogenases: flavin-dependent trp 6 7 halogenase
MITE: MITE0000130Halogenation (identity: 68.90%)
smcogs: SMCOG1119: halogenase

MMAR_RS18110: methyltransferase

smcogs: SMCOG1248: methyltransferase

Translocases: permease transporter

MMAR_RS18025: sugar-binding lipoprotein

smcogs: SMCOG1143: sugar-binding lipoprotein

MMAR_RS18035: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001261.3	0.69	NRPS	AM-toxin	Alternaria alternata
BGC0001135.5	0.68	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0002286.3	0.66	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0000307.4	0.65	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.64	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001758.4	0.64	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.31 out of 18.46

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.92 out of 25.88

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.35 out of 18.57

Confidence: medium

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.90 out of 20.97

Confidence: medium

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (4):

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.19 out of 31.73

Confidence: weak

HipB

Description: Bacterial antitoxin HipB
Species: Escherichia coli BL21(DE3)
Score: 21.41 out of 33.73

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.18 out of 32.38

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 23.13 out of 32.93

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 34, location 4443192 - 4492699:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS18095: X - Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (514..909): X

nrpys: Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: QWRTFDIFLWEGQFFCGGEVNYYGATETTFDASF
Nearest Stachelhaus code(s):: Gln DAWQFGLIDK (62% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (2024..2426): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Aliphatic chain or phenyl group with -OH (Ser, Thr, Dhpg, Hpg)
Small clusters prediction:: thr (Thr)
Single AA prediction:: thr (Thr)

Stachelhaus prediction details:

Stachelhaus sequence:: LATHFDFSVWEGNQIFGGEINMYGITETTVHVTF
Nearest Stachelhaus code(s):: Thr DFWNIGMVHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CcpA	Catabolite control protein A
PsrA	Oleic acid responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence
ToxT	Regulator of MSHA biosynthesis

NC_010612.1 - Region 26 - NRP-metallophore,NRPS

Download region GenBank file

Download region SVG

Location: 4,514,449 - 4,585,890 nt. (total: 71,442 nt) Show pHMM detection rules used

NRP-metallophore: (VibH_like or Cy_tandem or (cds(Condensation and AMP-binding) and ((IBH_Asp and not SBH_Asp) or IBH_His or TBH_Asp or CyanoBH_Asp1 or CyanoBH_Asp2 or IPL or SalSyn or (EntA and EntC) or (GrbD and GrbE) or (FbnL and FbnM) or PvdO or PvdP or (Orn_monoox and not (KtzT or MetRS-like)) or Lys_monoox or VbsL)))
NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxygenase

MMAR_RS18440: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MMAR_RS18540: monooxygenase FAD-binding

smcogs: SMCOG1050: monooxygenase FAD-binding

Transferases: acylase

MMAR_RS18415: malonyl CoA-acyl carrier protein transacylase

smcogs: SMCOG1021: malonyl CoA-acyl carrier protein transacylase

Hydrolases: amidase esterase hydrolase peptidase

MMAR_RS18305: amidase

smcogs: SMCOG1105: amidase

MMAR_RS18405: thioesterase

smcogs: SMCOG1004: thioesterase

MMAR_RS18435: alpha/beta hydrolase domain-containing protein

smcogs: SMCOG1066: alpha/beta hydrolase domain-containing protein

MMAR_RS18505: gamma-glutamyltranspeptidase

smcogs: SMCOG1274: gamma-glutamyltranspeptidase

Lyases: decarboxylase

MMAR_RS18370: putative carboxymuconolactone decarboxylase

smcogs: SMCOG1298: putative carboxymuconolactone decarboxylase

Isomerases: isomerase

MMAR_RS18470: isochorismate synthase

smcogs: SMCOG1018: isochorismate synthase

Ligases: ligase synthase

MMAR_RS18385: condensation domain-containing protein

smcogs: SMCOG1127: condensation domain-containing protein

MMAR_RS18390: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS18395: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS18410: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MMAR_RS18430: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.69	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.69	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001027.5	0.68	NRPS, PKS	nocobactin NA, nocobactin NA 10152B	Nocardia farcinica IFM 10152
BGC0001833.4	0.68	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001434.3	0.67	NRPS	nematophin	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000342.4	0.68	NRPS	enniatin	Fusarium equiseti
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0001027.5	0.67	NRPS, PKS	nocobactin NA, nocobactin NA 10152B	Nocardia farcinica IFM 10152
BGC0001833.4	0.67	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0002286.3	0.67	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.67	NRPS	AM-toxin	Alternaria alternata
BGC0001825.4	0.67	NRPS	xenematide	Xenorhabdus nematophila AN6/1
BGC0001434.3	0.67	NRPS	nematophin	Xenorhabdus budapestensis
BGC0001132.4	0.67	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001128.4	0.66	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

ANR

Description: Anaerobic transcriptional regulator
Species: Pseudomonas putida KT2440
Score: 20.80 out of 26.33

Confidence: medium

AbrC3

Description: Antibiotic production activator
Species: Streptomyces coelicolor
Score: 18.07 out of 18.16

Confidence: strong

DosR

Description: Hypoxia stress response regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.18 out of 29.51

Confidence: medium

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.71 out of 26.85

Confidence: medium

Additional weak hits (11):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 19.24 out of 29.25

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.47 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 17.65 out of 20.01

Confidence: weak

CcpA

Description: Catabolite control protein A
Species: Streptococcus & Clostridium sp.
Score: 16.08 out of 20.97

Confidence: weak

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 18.08 out of 28.19

Confidence: weak

DmdR1

Description: Iron(II)-dependent repressor
Species: Streptomyces coelicolor
Score: 24.08 out of 36.53

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 21.31 out of 39.62

Confidence: weak

MntR

Description: Manganese transport regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.78 out of 39.62

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 19.84 out of 35.63

Confidence: weak

NuR

Description: Nickel-responsive regulator
Species: Streptomyces coelicolor
Score: 20.72 out of 30.98

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.02 out of 27.04

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 35, location 4514448 - 4585890:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-ohmal) + (X) + (D-X) + (Thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS18385: Thr

Search NORINE for peptide: strict or relaxed

AMP-binding (561..957): Thr

nrpys: Thr

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Small clusters prediction:: Polar, uncharged (aliphatic with -SH) (Cys)
Single AA prediction:: Polar, uncharged (aliphatic with -SH) (Cys)

Stachelhaus prediction details:

Stachelhaus sequence:: TAVSFDASVYDGNCTLGGDSGLGGATETAIHNTI
Nearest Stachelhaus code(s):: Thr DAYNTGLIHK (97% 8Å match)
Stachelhaus code match:: 100% (strong)

MMAR_RS18390: X

AMP-binding (459..859): X

nrpys: N6-ohLys

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: Long positively charged side chain (Orn, Lys, Arg)
Small clusters prediction:: N/A
Single AA prediction:: lys (Lys)

Stachelhaus prediction details:

Stachelhaus sequence:: YDHWFDASWQPGDTALGGEYNCYGPTEMTVEAVV
Nearest Stachelhaus code(s):: N6-ohLys DAQDAGCVEK (97% 8Å match); Lys DAQDAGCVEK (88% 8Å match)
Stachelhaus code match:: 100% (strong)

MMAR_RS18395: X

AMP-binding (499..884): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic (Arg, Asp, Glu, Asn, Lys, Gln, Orn, Aad)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: HGFSFDASLADVHLPVGGERNHYGPTEAVVCSTH
Nearest Stachelhaus code(s):: N6-ohLys DALHPGHVCK (91% 8Å match)
Stachelhaus code match:: 90% (moderate)

MMAR_RS18415: mmal

PKS_AT (102..402): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 66.7%; Isobutyryl-CoA: 62.5%; Methoxymalonyl-CoA: 58.3%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 83.4
Methoxymalonyl-CoA: 71.1
Ethylmalonyl-CoA: 64.9
Propionyl-CoA: 60.9
Malonyl-CoA: 47.2
2-Methylbutyryl-CoA: 42.4
trans-1,2-CPDA: 36.0
CHC-CoA: 28.5
Benzoyl-CoA: 21.5
Isobutyryl-CoA: 21.3
Acetyl-CoA: 14.1
inactive: 12.4
fatty_acid: 11.6
3-Methylbutyryl-CoA: 5.1

MMAR_RS18430: X

AMP-binding (30..432): X

nrpys: Sal

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Small clusters prediction:: Hydroxy-benzoic acid derivates (diOH-Bz, Sal)
Single AA prediction:: dhb (diOH-Bz)

Stachelhaus prediction details:

Stachelhaus sequence:: NASLFPLACPGGALQVGGSQQVFGMAEGLLNFTR
Nearest Stachelhaus code(s):: Sal PLPAQGVLNK (100% 8Å match)
Stachelhaus code match:: 100% (strong)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
ANR	Anaerobic transcriptional regulator
AbrC3	Antibiotic production activator
DosR	Hypoxia stress response regulator
RutR	Regulator of the pyrimidine and purine metabolism

NC_010612.1 - Region 27 - NRPS,PKS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 4,639,984 - 4,740,494 nt. (total: 100,511 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX) and not alpha_am_amid)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
PKS-like: (t2pks2 or ksIII)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxygenase

MMAR_RS28740: lysine/ornithine N-monooxygenase

smcogs: SMCOG1080: lysine/ornithine N-monooxygenase

Hydrolases: hydrolase

MMAR_RS18885: isochorismatase

smcogs: SMCOG1027: isochorismatase

MMAR_RS19010: beta-lactamase

smcogs: SMCOG1053: beta-lactamase

Ligases: ligase synthase

MMAR_RS18840: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS18930: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MMAR_RS18935: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MMAR_RS18950: 3-oxoacyl-(acyl carrier protein) synthase III

smcogs: SMCOG1084: 3-oxoacyl-(acyl carrier protein) synthase III

MMAR_RS30505: Beta-ketoacyl synthase

smcogs: SMCOG1093: Beta-ketoacyl synthase

MMAR_RS30795: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001273.3	0.83	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.83	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0001244.3	0.82	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0001276.3	0.71	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0002191.2	0.59	PKS	prolipyrone B, gibepyrone D	Fusarium graminearum PH-1
BGC0001284.4	0.57	PKS	alternariol	Parastagonospora nodorum SN15
BGC0001160.5	0.56	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.56	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0001254.3	0.55	PKS	ACT-Toxin II	Alternaria alternata
BGC0002154.2	0.53	PKS	1,3,5,8-tetrahydroxynapthalene, 1-(alpha-l-(2-O-methyl)-6-deoxymannopyranosyloxy)-3,6,8-trimethoxynaphthalene	Pyricularia oryzae 70-15

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001276.3	0.73	PKS	6-methylsalicyclic acid	Aspergillus terreus
BGC0001273.3	0.73	PKS	asperlactone	Aspergillus ochraceus
BGC0001275.3	0.73	PKS	6-methylsalicyclic acid	Glarea lozoyensis
BGC0000342.4	0.73	NRPS	enniatin	Fusarium equiseti
BGC0001244.3	0.73	PKS	(-)-Mellein	Parastagonospora nodorum
BGC0002135.2	0.67	NRPS	bovienimide A	Xenorhabdus bovienii SS-2004
BGC0000307.4	0.66	NRPS	AbT1	Aureobasidium pullulans
BGC0001833.4	0.66	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001135.5	0.65	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001132.4	0.65	NRPS	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.82 out of 18.46

Confidence: medium

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.46 out of 25.88

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 18.37 out of 20.47

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.38 out of 19.26

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.33 out of 27.78

Confidence: medium

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 20.48 out of 27.78

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 18.42 out of 19.52

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.90 out of 20.47

Confidence: medium

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 25.24 out of 30.22

Confidence: medium

Additional weak hits (19):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.74 out of 30.22

Confidence: weak

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.46 out of 25.75

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 20.51 out of 29.38

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 21.37 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.97 out of 32.74

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.20 out of 32.93

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 19.36 out of 25.88

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.35 out of 27.55

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 23.87 out of 32.74

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 18.13 out of 26.06

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 20.72 out of 30.25

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.73 out of 35.63

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 22.36 out of 32.93

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.43 out of 32.93

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 24.99 out of 32.38

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 20.99 out of 27.55

Confidence: weak

HypR

Description: L-hydroxyproline utilization repressor
Species: Streptomyces coelicolor
Score: 18.94 out of 22.40

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.61 out of 28.14

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.51 out of 21.84

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 36, location 4639983 - 4740494:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-X - X) + (ccmal) + (Me-ccmal) + (redmal - Me-ohmal - Me-ccmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 37, location 4639983 - 4688914:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-X - X) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 38, location 4665725 - 4739519:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (NMe-X - X) + (ccmal) + (Me-ccmal) + (redmal - Me-ohmal - Me-ccmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 39, location 4699543 - 4740494:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (redmal - Me-ohmal - Me-ccmal) + (ccmal)
Non-colinear ordering:: MMAR_RS30505 + MMAR_RS30795

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS18840: X - X

AMP-binding (445..834): X

nrpys: Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSMHFDYSVWEGSQFVGGEVNQFGPTETMMCVSM
Nearest Stachelhaus code(s):: Leu DYWSFGLVVK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

AMP-binding (1919..2307): X

nrpys: Gly, Ala, Val, Leu, Ile, Abu, Ival

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: Apolar, aliphatic (Gly, Ala, Val, Leu, Ile, Abu, Ival)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LSMHFDVSVWEGNLLVAGEINAYGATE--LWYSA
Nearest Stachelhaus code(s):: Ala DVWVLAAIIK (53% 8Å match)
Stachelhaus code match:: 70% (weak)

MMAR_RS18930: mal

PKS_AT (564..853): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 95.8%; inactive: 79.2%; Methylmalonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 170.2
inactive: 87.8
Methoxymalonyl-CoA: 61.4
Methylmalonyl-CoA: 58.7
CHC-CoA: 40.6
Propionyl-CoA: 38.3
2-Methylbutyryl-CoA: 29.9
Benzoyl-CoA: 26.1
Ethylmalonyl-CoA: 23.5
Isobutyryl-CoA: 22.6
fatty_acid: 21.1
Acetyl-CoA: 18.1
trans-1,2-CPDA: 18.0
3-Methylbutyryl-CoA: 0.0

MMAR_RS18935: mmal

PKS_AT (568..868): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 100.0%; Methoxymalonyl-CoA: 95.8%; Ethylmalonyl-CoA: 91.7%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 200.1
Ethylmalonyl-CoA: 187.8
Methoxymalonyl-CoA: 164.2
2-Methylbutyryl-CoA: 154.8
trans-1,2-CPDA: 122.9
Propionyl-CoA: 120.0
Malonyl-CoA: 107.1
CHC-CoA: 97.0
Isobutyryl-CoA: 81.7
Benzoyl-CoA: 58.8
Acetyl-CoA: 43.1
3-Methylbutyryl-CoA: 40.6
fatty_acid: 35.8
inactive: 15.7

MMAR_RS30505: mal - mmal - mmal

PKS_AT (561..857): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.7
inactive: 84.3
Methoxymalonyl-CoA: 65.5
Methylmalonyl-CoA: 56.9
Propionyl-CoA: 44.3
fatty_acid: 19.5
2-Methylbutyryl-CoA: 16.8
Acetyl-CoA: 14.7
trans-1,2-CPDA: 14.5
CHC-CoA: 14.3
Isobutyryl-CoA: 12.6
Benzoyl-CoA: 10.6
Ethylmalonyl-CoA: 7.5
3-Methylbutyryl-CoA: 0.0

PKS_AT (2641..2944): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 75.0%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 172.4
Ethylmalonyl-CoA: 158.0
Methoxymalonyl-CoA: 146.4
2-Methylbutyryl-CoA: 108.1
trans-1,2-CPDA: 100.2
Malonyl-CoA: 90.9
CHC-CoA: 78.2
Propionyl-CoA: 77.4
Isobutyryl-CoA: 53.2
Benzoyl-CoA: 28.7
fatty_acid: 24.4
Acetyl-CoA: 21.4
3-Methylbutyryl-CoA: 21.2
inactive: 18.4

PKS_AT (4187..4490): mmal

ATSignature: Methylmalonyl-CoA

Top 3 matches:: Methylmalonyl-CoA: 87.5%; Malonyl-CoA: 75.0%; Methoxymalonyl-CoA: 75.0%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 172.4
Ethylmalonyl-CoA: 158.0
Methoxymalonyl-CoA: 146.4
2-Methylbutyryl-CoA: 108.1
trans-1,2-CPDA: 100.2
Malonyl-CoA: 90.9
CHC-CoA: 78.2
Propionyl-CoA: 77.4
Isobutyryl-CoA: 53.2
Benzoyl-CoA: 28.7
fatty_acid: 24.4
Acetyl-CoA: 21.4
3-Methylbutyryl-CoA: 21.2
inactive: 18.4

MMAR_RS30795: mal

PKS_AT (554..850): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 91.7%; inactive: 87.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 169.7
inactive: 84.3
Methoxymalonyl-CoA: 65.5
Methylmalonyl-CoA: 56.9
Propionyl-CoA: 44.3
fatty_acid: 19.5
2-Methylbutyryl-CoA: 16.8
Acetyl-CoA: 14.7
trans-1,2-CPDA: 14.5
CHC-CoA: 14.3
Isobutyryl-CoA: 12.6
Benzoyl-CoA: 10.6
Ethylmalonyl-CoA: 7.5
3-Methylbutyryl-CoA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
CRP	Cyclic AMP receptor protein
ClgR	Caseinolytic protease gene regulator
CodY	Regulator of stationary phase and virulence in Gram-positive bacteria
PsrA	Oleic acid responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 28 - NRPS-like

Download region GenBank file

Download region SVG

Location: 4,879,821 - 4,922,922 nt. (total: 43,102 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX) and not alpha_am_amid)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase oxygenase

MMAR_RS19815: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

MMAR_RS19835: cytochrome P450

smcogs: SMCOG1007: cytochrome P450

MMAR_RS19870: cytochrome P450

smcogs: SMCOG1034: cytochrome P450

MMAR_RS19880: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MMAR_RS19885: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MMAR_RS19890: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

MMAR_RS19895: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Hydrolases: esterase

MMAR_RS19925: thioesterase superfamily protein

smcogs: SMCOG1144: thioesterase superfamily protein

Lyases: dehydratase

MMAR_RS19860: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: ligase

MMAR_RS19850: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS19905: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001135.5	0.61	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001758.4	0.61	NRPS	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0002174.2	0.60	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0000357.5	0.60	NRPS	cyclo-(D-Phe-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Trp-D-Val-L-Val), cyclo-(D-Phe-L-Phe-D-Val-L-Ile), cyclo-(D-Phe-L-Phe-D-Ile-L-Val), cyclo-(D-Tyr-L-Trp-D-Val-L-Ile), cyclo-(D-Tyr-L-Trp-D-Ile-L-Val), cyclo-(D-Tyr-L-Phe-D-Val-L-Ile), cyclo-(D-Tyr-L-Phe-D-Ile-L-Val)	Penicillium rubens Wisconsin 54-1255
BGC0001641.4	0.60	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001261.3	0.60	NRPS	AM-toxin	Alternaria alternata
BGC0002286.3	0.60	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001249.5	0.60	NRPS	dimethylcoprogen	Alternaria alternata
BGC0001166.5	0.60	NRPS	HC-toxin	Alternaria jesenskae
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 20.47 out of 20.47

Confidence: strong

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 19.46 out of 20.47

Confidence: strong

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.99 out of 23.79

Confidence: medium

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.60 out of 19.26

Confidence: medium

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 21.11 out of 24.78

Confidence: medium

NtrC

Description: Nitrogen regulatory protein C
Species: Pseudomonas putida KT2440
Score: 22.15 out of 29.72

Confidence: medium

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.92 out of 20.47

Confidence: medium

Additional weak hits (20):

MatP

Description: Cell cycle regulator
Species: Escherichia coli str. K-12 substr. MG1655
Score: 20.33 out of 25.75

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 17.96 out of 27.78

Confidence: weak

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 17.30 out of 21.84

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 18.47 out of 21.55

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.08 out of 25.88

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 18.53 out of 31.73

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 17.85 out of 26.12

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 17.00 out of 21.55

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.15 out of 21.55

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.30 out of 30.25

Confidence: weak

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 18.92 out of 25.88

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.39 out of 29.38

Confidence: weak

LuxO

Description: Repressor of luminescence
Species: Vibrio campbellii ATCC BAA-1116
Score: 19.60 out of 26.12

Confidence: weak

MogR

Description: Repressor of flagellar motility genes
Species: Listeria monocytogenes EGD-e
Score: 16.64 out of 26.06

Confidence: weak

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 19.81 out of 26.85

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.07 out of 30.25

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.81 out of 28.14

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 16.63 out of 28.14

Confidence: weak

HexR

Description: Glucose-responsive regulator
Species: Shewanella oneidensis MR-1
Score: 19.40 out of 31.73

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.64 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 40, location 4879820 - 4922922:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Phe)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS19850: Phe

Search NORINE for peptide: strict or relaxed

AMP-binding (14..413): Phe

nrpys: Phe

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic (Phe, Tyr, diOH-Bz, Ph-Gly, bOH-Tyr)
Large clusters prediction:: Aromatic side chain (Phe, Trp, Ph-Gly, Tyr, bOH-Tyr)
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LANAFDAATWESCIVVAGEFNAYGPTEATVCATM
Nearest Stachelhaus code(s):: Ph-Ser DAWTVAAVCK (79% 8Å match); Phe DAWTVAAVCK (76% 8Å match)
Stachelhaus code match:: 90% (moderate)

MMAR_RS19905: X

AMP-binding (25..403): X

nrpys: Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: LWTPYHTNGFALTALQGAAVTAYGMTENLGLTAL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
IolR	Regulator of the inositol catabolism
LexA variant 2	Repressor of DNA damage response
NtrC	Nitrogen regulatory protein C
VqsM	Regulator of quorum-sensing signalling systems

NC_010612.1 - Region 29 - T3PKS

Download region GenBank file

Download region SVG

Location: 5,284,592 - 5,325,632 nt. (total: 41,041 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MMAR_RS21545: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MMAR_RS21585: oxidoreductase

smcogs: SMCOG1161: oxidoreductase

MMAR_RS21630: aldehyde dehydrogenase

smcogs: SMCOG1017: aldehyde dehydrogenase

Transferases: acetyltransferase methyltransferase

MMAR_RS21530: methyltransferase

smcogs: SMCOG1089: methyltransferase

MMAR_RS21580: Methylation

MITE: MITE0000155Methylation (identity: 60.70%)
smcogs: SMCOG1150: isoprenylcysteine carboxyl methyltransferase

MMAR_RS21610: acetyl-CoA acetyltransferase

smcogs: SMCOG1124: acetyl-CoA acetyltransferase

Lyases: dehydratase hydratase

MMAR_RS21550: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

MMAR_RS21555: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

MMAR_RS21560: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

MMAR_RS21605: enoyl-CoA hydratase

smcogs: SMCOG1023: enoyl-CoA hydratase

Ligases: synthase

MMAR_RS21575: chalcone and stilbene synthase domain protein

smcogs: SMCOG1024: chalcone and stilbene synthase domain protein

Translocases: transport

MMAR_RS21540: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.80	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000866.5	0.47	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.45	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001647.3	0.43	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0001964.2	0.41	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001262.3	0.40	PKS	AK-toxin I	Alternaria alternata
BGC0000825.5	0.40	other (other)	staurosporine	Streptomyces sp. TP-A0274

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.3	0.80	PKS	2-methoxy-5-methyl-6-(13-methyltetradecyl)-1,4-benzoquinone, 2-methoxy-5-methyl-6-(13-methyltetradecyl)phenol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.3	0.53	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0000866.5	0.47	other (other)	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.3	0.45	other (other)	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001647.3	0.43	PKS	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001924.3	0.42	terpene	ascofuranone	Acremonium egyptiacum
BGC0001964.2	0.41	PKS	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0000667.3	0.41	terpene	PR-toxin	Penicillium roqueforti FM164
BGC0001262.3	0.40	PKS	AK-toxin I	Alternaria alternata
BGC0000825.5	0.40	other (other)	staurosporine	Streptomyces sp. TP-A0274

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

CRP

Description: Cyclic AMP receptor protein
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.36 out of 19.26

Confidence: medium

CatR

Description: H2O2-responsive repressor
Species: Streptomyces coelicolor
Score: 21.45 out of 25.31

Confidence: medium

Additional weak hits (6):

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.27 out of 30.22

Confidence: weak

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 15.27 out of 18.57

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 16.52 out of 27.78

Confidence: weak

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 17.72 out of 29.38

Confidence: weak

PerR

Description: Peroxide regulator
Species: Bacillus & Staphylococcus sp.
Score: 15.43 out of 28.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 21.96 out of 29.65

Confidence: weak

Detailed domain annotation

Selected features only

Show module domains

TFBS Finder

TFBS definitions

Regulator	Description
CRP	Cyclic AMP receptor protein
CatR	H2O2-responsive repressor

NC_010612.1 - Region 30 - terpene

Download region GenBank file

Download region SVG

Location: 5,847,600 - 5,871,955 nt. (total: 24,356 nt) Show pHMM detection rules used

terpene: (PT_phytoene_like or phytoene_synt or Lycopene_cycl or Lycopene_cycl_fung or T1TS or T1TS_KS or T2TS or TS_UbiA or TS_Pyr4)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase oxidoreductase

MMAR_RS24040: oxidoreductase

smcogs: SMCOG1083: oxidoreductase

MMAR_RS24090: dehydrogenase

smcogs: SMCOG1222: dehydrogenase

MMAR_RS24150: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: methyltransferase

MMAR_RS24055: methyltransferase

smcogs: SMCOG1089: methyltransferase

Lyases: dehydratase

MMAR_RS24035: L-carnitine dehydratase/bile acid-inducible

smcogs: SMCOG1189: L-carnitine dehydratase/bile acid-inducible

Ligases: synthetase

MMAR_RS24085: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

Translocases: permease transport

MMAR_RS24110: MMPL domain-containing transport protein

smcogs: SMCOG1035: MMPL domain-containing transport protein

MMAR_RS24135: phenylalanine-specific permease

smcogs: SMCOG1038: phenylalanine-specific permease

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.63	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000664.5	0.61	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.58	terpene	carotenoid	Myxococcus xanthus
BGC0000650.3	0.58	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0001456.3	0.57	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.57	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001227.3	0.56	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.56	terpene	carotenoid	Streptomyces avermitilis
BGC0000636.3	0.54	terpene	carotenoid	Brevibacterium linens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000656.5	0.63	terpene	zeaxanthin	Xanthobacter autotrophicus Py2
BGC0000664.5	0.61	terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000648.3	0.58	terpene	carotenoid	Myxococcus xanthus
BGC0000650.3	0.58	terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0001456.3	0.57	terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.3	0.57	terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000647.3	0.57	terpene	carotenoid	Rhodobacter sphaeroides
BGC0001227.3	0.56	terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000633.3	0.56	terpene	carotenoid	Streptomyces avermitilis
BGC0000636.3	0.54	terpene	carotenoid	Brevibacterium linens

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Subclass	Product name	Chain length	Initial cyclisations	Functional groups
tetraterpene	C40 carotenoid		C40	unknown	unknown

Genes with terpene domains:

MMAR_RS24085: PT_FPPS_like

Domain 1 (80 - 376): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

MMAR_RS24095: PT_phytoene_like

Domain 1 (16 - 307): Prenyltransferase; Phytoene synthase like

Subtype: unknown

Reactions:: FPP → squalene; FPP → diapophytoene; FPP → PSPP; GGPP → phytoene; PSPP → hydroxysqualene

MMAR_RS24100: Lycopene_cycl

Domain 1 (5 - 93): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

MMAR_RS24105: Lycopene_cycl

Domain 1 (6 - 96): Lycopene cyclase

Reactions:: C40_carotenoid → C40_carotenoid

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 16.73 out of 18.46

Confidence: medium

Additional weak hits (4):

FuR variant 1

Description: Ferric Uptake Regulator
Species: Bacillus, Pseudomonas, Yersinia sp.
Score: 18.17 out of 29.38

Confidence: weak

FuR variant 2

Description: Ferric Uptake Regulator
Species: Caulobacter crescentus CB15
Score: 21.33 out of 32.74

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.60 out of 33.14

Confidence: weak

DasR

Description: N-acetylglucosamine dependent repressor
Species: Streptomyces coelicolor
Score: 20.98 out of 27.04

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PSPP	Presqualene diphosphate

TFBS definitions

Regulator	Description
RpoN	Regulator of nitrogen assimilation and virulence

NC_010612.1 - Region 31 - RiPP-like

Download region GenBank file

Download region SVG

Location: 5,944,063 - 5,954,869 nt. (total: 10,807 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193 or (YcaO or TIGR03604))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: oxidoreductase

MMAR_RS24555: pyridine nucleotide-disulfide oxidoreductase

smcogs: SMCOG1175: pyridine nucleotide-disulfide oxidoreductase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002669.2	0.27	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0002804.2	0.26	other (other)	protegencin	Pseudomonas protegens CHA0
BGC0001882.3	0.21	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002669.2	0.27	ribosomal	TVA-YJ-2	Streptomyces sp. NRRL S-87
BGC0002804.2	0.26	other (other)	protegencin	Pseudomonas protegens CHA0
BGC0001882.3	0.21	PKS	chrysoxanthone A, chrysoxanthone B, chrysoxanthone C	Penicillium rubens Wisconsin 54-1255

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RutR

Description: Regulator of the pyrimidine and purine metabolism
Species: Escherichia coli str. K-12 substr. MG1655
Score: 22.50 out of 26.85

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.58 out of 21.84

Confidence: medium

Additional weak hits (3):

BldD

Description: Development and antibiotic global regulator
Species: Streptomyces coelicolor
Score: 19.05 out of 23.43

Confidence: weak

ClgR

Description: Caseinolytic protease gene regulator
Species: Corynebacterium glutamicum ATCC 13032
Score: 21.98 out of 30.22

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.19 out of 24.78

Confidence: weak

TFBS Finder

TFBS definitions

Regulator	Description
MexT	Global virulence regulator
RutR	Regulator of the pyrimidine and purine metabolism

NC_010612.1 - Region 32 - terpene-precursor

Download region GenBank file

Download region SVG

Location: 6,164,030 - 6,184,962 nt. (total: 20,933 nt) Show pHMM detection rules used

terpene-precursor: (PT_FPPS_like and not PT_HPP)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

Terpene

TFBS Finder

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Hydrolases: hydrolase

MMAR_RS25530: alpha/beta hydrolase fold protein

smcogs: SMCOG1036: alpha/beta hydrolase fold protein

Isomerases: mutase

MMAR_RS25560: phosphoglycerate mutase

smcogs: SMCOG1101: phosphoglycerate mutase

Ligases: synthase synthetase

MMAR_RS25555: Polyprenyl synthetase

smcogs: SMCOG1182: Polyprenyl synthetase

MMAR_RS30690: polyprenol-monophosphomannose synthase ppm1

smcogs: SMCOG1123: polyprenol-monophosphomannose synthase ppm1

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0001528.4	0.43	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0001077.4	0.42	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001075.5	0.38	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001605.3	0.37	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002007.2	0.37	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002162.3	0.50	terpene	sesterfisherol, sesterfisheric acid, compound 6, compound 7a, compound 5, compound 8	Aspergillus fischeri NRRL 181
BGC0002610.3	0.50	terpene	stellatic acid	Aspergillus stellatus
BGC0002736.2	0.49	terpene	preaspterpenacid I	Aspergillus terreus NIH2624
BGC0001528.4	0.43	terpene	betaestacin I, betaestacin II	Phoma betae
BGC0001077.4	0.42	PKS	6-anteisoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrogeranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-geranyl-2-methoxyhydroquinone, 6-palmityl-4-O-geranyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-geranyl-2-methoxyhydroquinone, 6-isopalmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-palmityl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-anteisoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone, 6-isoheptadecyl-4-O-dihydrofarnesyl-2-methoxyhydroquinone	Actinoplanes missouriensis 431
BGC0002218.2	0.38	terpene	(-)-Cyatha-3,12-diene	Dentipellis sp. KUC8613
BGC0001075.5	0.38	PKS, terpene	aurachin RE	Rhodococcus erythropolis
BGC0001605.3	0.37	terpene	gibberellin	Sinorhizobium fredii NGR234
BGC0002007.2	0.37	terpene	atolypene A, atolypene B	Amycolatopsis tolypomycina
BGC0000678.5	0.37	terpene	pentalenolactone	Streptomyces avermitilis MA-4680 = NBRC 14893

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Detailed terpene predictions

Product predictions:

Class	Product name	Chain length	Initial cyclisations	Functional groups
sesquiterpene precursor	FPP	C15	acyclic	PP
diterpene precursor	GGPP	C20	acyclic	PP
sesterterpene precursor	GFPP	C25	acyclic	PP
triterpene precursor	HPP	C30	acyclic	PP

Genes with terpene domains:

MMAR_RS25555: PT_FPPS_like

Domain 1 (30 - 308): Prenyltransferase; Farnesyl diphosphate synthase like

Subtype: unknown

Reactions:: IPP, DMAPP → FPP; IPP, DMAPP → GGPP; IPP, DMAPP → GFPP; IPP, DMAPP → HPP

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

PsrA

Description: Oleic acid responsive regulator
Species: Pseudomonas sp.
Score: 20.48 out of 25.88

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.02 out of 23.79

Confidence: medium

Additional weak hits (4):

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.56 out of 21.55

Confidence: weak

CodY

Description: Regulator of stationary phase and virulence in Gram-positive bacteria
Species: Bacillus, Lactococcus & Streptococcus sp.
Score: 19.34 out of 27.78

Confidence: weak

ArcA

Description: Repressor of carbon oxidation
Species: Escherichia coli str. K-12 substr. MG1655
Score: 16.93 out of 21.55

Confidence: weak

ArgR

Description: Regulator of arginine biosynthesis genes
Species: Streptomyces coelicolor
Score: 16.91 out of 20.01

Confidence: weak

Terpene

TFBS Finder

Glossary

Acronym	Full name
DMAPP	Dimethylallyl diphosphate
FPP	Farnesyl diphosphate
GFPP	Geranylfarnesyl diphosphate
GGPP	Geranylgeranyl diphosphate
HPP	Hexaprenyl diphosphate
IPP	Isopentenyl diphosphate
PP	Diphosphate

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
PsrA	Oleic acid responsive regulator
RpoN	Regulator of nitrogen assimilation and virulence

NC_010612.1 - Region 33 - NAPAA

Download region GenBank file

Download region SVG

Location: 6,361,415 - 6,395,341 nt. (total: 33,927 nt) Show pHMM detection rules used

NAPAA: (AMP-binding and TIGR02353)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MMAR_RS26500: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

MMAR_RS26505: dehydrogenase

smcogs: SMCOG1072: dehydrogenase

MMAR_RS26535: short-chain dehydrogenase/reductase SDR

smcogs: SMCOG1001: short-chain dehydrogenase/reductase SDR

Transferases: acyltransferase sulfotransferase

MMAR_RS26460: acyltransferase

smcogs: SMCOG1141: acyltransferase

MMAR_RS26545: Sulfotransferase domain

extras: Sulfotransfer_3: Sulfotransferase domain

Lyases: dehydratase

MMAR_RS26455: NAD-dependent epimerase/dehydratase

smcogs: SMCOG1010: NAD-dependent epimerase/dehydratase

Ligases: ligase

MMAR_RS26470: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

MMAR_RS26510: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.66	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002174.2	0.66	NRPS	ε-Poly-L-lysine	Epichloe festucae
BGC0001135.5	0.60	NRPS	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001250.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0001251.4	0.60	NRPS	epichloenin A	Epichloe festucae
BGC0000307.4	0.60	NRPS	AbT1	Aureobasidium pullulans
BGC0001166.5	0.59	NRPS	HC-toxin	Alternaria jesenskae
BGC0002286.3	0.59	NRPS	ririwpeptide A, ririwpeptide B, ririwpeptide C	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001641.4	0.59	NRPS	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001833.4	0.59	NRPS	icosalide A, icosalide B	Burkholderia gladioli
BGC0001128.4	0.59	NRPS	gamexpeptide C	Photorhabdus laumondii subsp. laumondii TTO1

Similar known clusters from MIBiG 4.0

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

RpoN

Description: Regulator of nitrogen assimilation and virulence
Species: Salmonella & Vibrio sp.
Score: 17.65 out of 18.46

Confidence: strong

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 18.79 out of 21.84

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 19.79 out of 23.79

Confidence: medium

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 19.02 out of 21.84

Confidence: medium

ZuR variant 1

Description: Zinc-responsive repressor
Species: Streptomyces coelicolor
Score: 20.65 out of 28.19

Confidence: medium

Additional weak hits (9):

MexT

Description: Global virulence regulator
Species: Pseudomonas aeruginosa PAO1
Score: 16.60 out of 21.84

Confidence: weak

ColR

Description: Phenol-responsive regulator
Species: Pseudomonas putida KT2440
Score: 19.47 out of 30.25

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.76 out of 27.55

Confidence: weak

RicR

Description: Copper-responsive regulator
Species: Mycobacterium tuberculosis H37Rv
Score: 24.96 out of 32.93

Confidence: weak

GnfM

Description: Regulator of nitrogen-fixation genes
Species: Geobacter sulfurreducens PCA
Score: 19.95 out of 27.55

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 18.01 out of 33.14

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 18.73 out of 24.78

Confidence: weak

NrtR

Description: NAD synthesis repressor
Species: Streptomyces coelicolor
Score: 20.52 out of 35.63

Confidence: weak

CsoR

Description: Copper-responsive repressor
Species: Streptomyces lividans
Score: 23.89 out of 32.38

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 45, location 6361414 - 6395341:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS26470: X

AMP-binding (25..467): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: EGALHVLARSLSVSIF------------TGGAGL
Nearest Stachelhaus code(s):
Stachelhaus code match:: 0% (weak)

MMAR_RS26510: X

AMP-binding (28..400): X

nrpys: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic (Ala, Gly, Val, Leu, Ile, Abu, Ival, Ser, Thr, Hpg, Dhpg, Cys, Pro, Hpr)
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: FAELFDASCEELSTIFGGEWNTYGPTEATVVACA
Nearest Stachelhaus code(s):: Lys DAEDIGTVVK (71% 8Å match); Gln or Tyr DAESVGTVVK (65% 8Å match)
Stachelhaus code match:: 90% (moderate)

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
IolR	Regulator of the inositol catabolism
MexT	Global virulence regulator
RpoN	Regulator of nitrogen assimilation and virulence
ZuR variant 1	Zinc-responsive repressor

NC_010612.1 - Region 34 - T1PKS

Download region GenBank file

Download region SVG

Location: 6,469,976 - 6,515,333 nt. (total: 45,358 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

binding site

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Gene overview

Tailoring

MIBiG comparison

KnownClusterBlast

SubClusterBlast

TFBS Finder

NRPS/PKS modules

NRPS/PKS domains

Gene/CDS overview

Filter:

Automatically zoom to filtered/selected features

Identifier	Product	Length		Function	Sequence		NCBI Blast	Filter details
		NT	AA		NT	AA

Tailoring functions

Oxidoreductases: dehydrogenase

MMAR_RS26915: acyl-CoA dehydrogenase

smcogs: SMCOG1006: acyl-CoA dehydrogenase

Transferases: acyltransferase transferase

MMAR_RS26925: acetyl-CoA carboxylase, carboxyl transferase,

smcogs: SMCOG1059: acetyl-CoA carboxylase, carboxyl transferase,

MMAR_RS26995: acyltransferase

smcogs: SMCOG1141: acyltransferase

MMAR_RS27000: acyltransferase

smcogs: SMCOG1141: acyltransferase

MMAR_RS27005: acyltransferase

smcogs: SMCOG1141: acyltransferase

Hydrolases: esterase hydrolase

MMAR_RS26945: putative esterase

smcogs: SMCOG1104: putative esterase

MMAR_RS26950: putative esterase

smcogs: SMCOG1104: putative esterase

MMAR_RS26990: hydrolase

smcogs: SMCOG1179: hydrolase

Ligases: ligase synthase

MMAR_RS26930: Beta-ketoacyl synthase

smcogs: SMCOG1022: Beta-ketoacyl synthase

MMAR_RS26935: AMP-dependent synthetase and ligase

smcogs: SMCOG1002: AMP-dependent synthetase and ligase

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001161.5	0.55	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001163.3	0.55	PKS	1-heptadecene	Moorea producens 3L
BGC0001162.3	0.55	PKS	1-heptadecene	Moorea producens JHB
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001831.3	0.47	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002238.3	0.47	PKS	2,4'-dihydroxy-3'-methoxypropiophenone	Aspergillus oryzae RIB40

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001160.5	0.61	PKS	1-nonadecene, (14Z)-1,14-nonadecadiene	Synechococcus sp. PCC 7002
BGC0001164.3	0.60	PKS	1-heptadecene	Cyanothece sp. PCC 7822
BGC0002192.3	0.58	PKS	FR901512	fungal sp. No.14919
BGC0001161.5	0.55	PKS	1-heptadecene	Moorea bouillonii PNG
BGC0001163.3	0.55	PKS	1-heptadecene	Moorea producens 3L
BGC0001162.3	0.55	PKS	1-heptadecene	Moorea producens JHB
BGC0002171.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger ATCC 1015
BGC0002275.2	0.48	NRPS, PKS	pyrophen, campyrone B	Aspergillus niger CBS 101883
BGC0001831.3	0.47	PKS	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0002238.3	0.47	PKS	2,4'-dihydroxy-3'-methoxypropiophenone	Aspergillus oryzae RIB40

Similar known clusters from MIBiG 4.0

No significant matches found.

Similar subclusters

No significant matches found.

Transcription Factor Binding Sites

Binding sites found:

VqsM

Description: Regulator of quorum-sensing signalling systems
Species: Pseudomonas aeruginosa PAO1
Score: 17.83 out of 20.47

Confidence: medium

ToxT

Description: Regulator of MSHA biosynthesis
Species: Vibrio cholerae O395
Score: 16.08 out of 18.57

Confidence: medium

IolR

Description: Regulator of the inositol catabolism
Species: Caulobacter crescentus CB15
Score: 18.33 out of 23.79

Confidence: medium

AfsQ1

Description: Two-component system AfsQ1-Q2, activator of antibiotic production
Species: Streptomyces coelicolor
Score: 17.28 out of 19.52

Confidence: medium

Additional weak hits (4):

SypG

Description: Regulator of biofilm formation and host colonization
Species: Vibrio fischeri ES114
Score: 17.52 out of 29.25

Confidence: weak

ZuR variant 2

Description: Zinc-responsive repressor
Species: Pseudomonas protegens Pf-5
Score: 17.50 out of 33.14

Confidence: weak

LexA variant 1

Description: Repressor of DNA damage response
Species: Streptomyces coelicolor
Score: 20.10 out of 29.65

Confidence: weak

LexA variant 2

Description: Repressor of DNA damage response
Species: Bacillus subtilis subsp. subtilis str. 168
Score: 19.69 out of 24.78

Confidence: weak

Module view

Legend

Detailed domain annotation

Selected features only

Show module domains

NRPS/PKS products

NRPS/PKS substrates

TFBS Finder

Predicted core structure(s)

For candidate cluster 46, location 6469975 - 6515333:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS substrate predictions

MMAR_RS26930: pk

PKS_AT (725..1028): pk

ATSignature: Malonyl-CoA, Methylmalonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%; Methylmalonyl-CoA: 54.2%

minowa: fatty_acid

Prediction, score:

fatty_acid: 148.5
Methylmalonyl-CoA: 64.5
Methoxymalonyl-CoA: 58.3
Malonyl-CoA: 42.7
Isobutyryl-CoA: 34.2
Ethylmalonyl-CoA: 33.1
trans-1,2-CPDA: 29.7
Propionyl-CoA: 29.5
inactive: 25.4
2-Methylbutyryl-CoA: 19.5
CHC-CoA: 18.6
Acetyl-CoA: 12.6
Benzoyl-CoA: 10.3
3-Methylbutyryl-CoA: 0.0

MMAR_RS26935: NH2

CAL_domain (172..506): NH2

minowa: NH2

Prediction, score:

NH2: 56.9
Acetyl-CoA: 38.8
fatty_acid: 20.2
shikimic_acid: 0.0
AHBA: 0.0

Link to PARAS substrate predictor

TFBS definitions

Regulator	Description
AfsQ1	Two-component system AfsQ1-Q2, activator of antibiotic production
IolR	Regulator of the inositol catabolism
ToxT	Regulator of MSHA biosynthesis
VqsM	Regulator of quorum-sensing signalling systems